[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO51003.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nxzA2.bssp"
#ERROR : Can't open dsspfile "1vhkA2.bssp"
#ERROR : Can't open dsspfile "1v6zA2.bssp"
#ERROR : Can't open dsspfile "1k3rA2.bssp"
#ERROR : Can't open dsspfile "1nxzA1.bssp"
#ERROR : Can't open dsspfile "1vhkA1.bssp"
#ERROR : Can't open dsspfile "1c7sA3.bssp"

## Summary of PDB Search
:247
    1e-33  33%  1nxzA2 [c.116.1.5] HYPOTHETICAL PROTEIN HI0303 A:74 -- 247
    6e-33  37%  1vhkA2 [c.116.1.5] HYPOTHETICAL PROTEIN YQEU A:74 -- 253
    5e-32  34%  1v6zA2 [c.116.1.5] HYPOTHETICAL PROTEIN TTHA0657 A:67 -- 228
    6e-29  12%  1k3rA2 [c.116.1.2] CONSERVED PROTEIN MT0001 A:1 -- 92 A:164 -- 262
    1e-17  32%  1nxzA1 [b.122.1.2] HYPOTHETICAL PROTEIN HI0303 A:2 -- 73
    1e-13  24%  1vhkA1 [b.122.1.2] HYPOTHETICAL PROTEIN YQEU A:2 -- 73
    1e-04  10%  1c7sA3 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:338 -- 780
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEx
1nxzA2          ----------------------------------------------------------------------
1vhkA2          ----------------------------------------------------------------------
1v6zA2          ----------------------------------------------------------------------
1k3rA2          ----------------------------------------------------------------------
1nxzA1          IPRIYHPISLENQTQCYLSEDAANHVARVLRXTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGREL-
1vhkA1          --RYFIELTKQEAPTFSITGEEVHHIVNVXRXNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTN-
1c7sA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
1nxzA2          --ESHLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLDAERXDKKIQQWQKIAIAACEQC
1vhkA2          --ELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKRE---------RWTKIAKEAAEQS
1v6zA2          --EVGVEVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEXGEG---KLRRLRAVALEAAKQS
1k3rA2          --PDSLTAETGDLKIKTYKVVLIARAASIFGVKRIVIYHDDADGEARFIRDILTYMDKVFPIMRELKHVG
1nxzA1          ----------------------------------------------------------------------
1vhkA1          ----------------------------------------------------------------------
1c7sA3          -----------------------------IDRMQAWQDGLKDAESSKAFATSRVGVNFWDTLYWGGFDSV


                         +         .         .         .         .         *         .:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPXXXXXXXXXXX
1nxzA2          GRNIVPEIRPLXKLQDWCAEN-DGALKLNLHP-RAHYSIKTLPT---IPAGGVRLLIGSEGGLSAQEIAQ
1vhkA2          YRNEVPRVXDVHSFQQLLQRXQDFDKCVVAYESAFSAIVSSLPK-----GSSLLIVFGPEGGLTEAEVER
1v6zA2          GRVVVPEVLPPIPLKAVPQVAQ--GLVAHV---GATARVREVLD----PEKPLALAVGPEGGFAEEEVAL
1k3rA2          ILPPLRTGYEVLDTRRNLAESLKTGADVVVATSRNASPITSILDEVKTAREAAILFGGP---YKGLPEID
1nxzA1          ----------------------------------------------------------------------
1vhkA1          ----------------------------------------------------------------------
1c7sA3          NNKGYEVVVSNPDYVYMDFPYEVNPDERGYYWGTRFSDERKVFSFAPDNMPQNAETSV------------


                         .         .         .         +         .         .         .:280
query           XXXXXXYPVTLGSRILRTETAGPAALTMVLYQFGELG
1nxzA2          TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
1vhkA2          LTEQDGVTCGLGPRILRTETAPLYALSAISYQTELL-
1v6zA2          LEARGFTPVSLGRRILRAETAALALLALCTAGEG---
1k3rA2          ADIWVNTLPGQCTETVRTEEAVLATLSVFNMLT----
1nxzA1          -------------------------------------
1vhkA1          -------------------------------------
1c7sA3          -------------------------------------