[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO51163.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xwmA.bssp"
#ERROR : Can't open dsspfile "1sumB.bssp"

## Summary of PDB Search
:204
    8e-11  10%  1xwmA  [a.7.12.1] PHOSPHATE UPTAKE REGULATOR
    2e-08   6%  1sumB  [a.7.12.1] PHOSPHATE TRANSPORT SYSTEM PROTEIN PHOU HOMOLOG
:204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHTIIKELNKTFVTPL
1xwmA           -------------------------------------------------------DFALWLIAAQQPVAT
1sumB           -------------------------------------------------------EKAMEVLGLFSPIGK


                         .         .         *         .         .         .         .:140
query           EREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQEVEKSIGKLVTKRFLEIRTH
1xwmA           DLRRIVAAASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDREDASLAAQI
1sumB           PLLTVTAGAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEV


                         +         .         .         .         .         *         .:210
query           AVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYEMLEEVTDACEDVANILESILMxxx
1xwmA           ADMDHRVDEQYGEMMASLLAVAKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVK---
1sumB           CRMDSKVDDLYEKVREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYM-----