[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV54358.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qo8A.bssp"
#ERROR : Can't open dsspfile "1q9iA.bssp"
#ERROR : Can't open dsspfile "1jrzA.bssp"
#ERROR : Can't open dsspfile "1e39A.bssp"
#ERROR : Can't open dsspfile "1ksuA.bssp"
#ERROR : Can't open dsspfile "1kssA.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "1d4cB.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"
#ERROR : Can't open dsspfile "1jrxA.bssp"
#ERROR : Can't open dsspfile "1qjdA.bssp"
#ERROR : Can't open dsspfile "1p2hA.bssp"
#ERROR : Can't open dsspfile "1p2eA.bssp"
#ERROR : Can't open dsspfile "1jryA.bssp"
#ERROR : Can't open dsspfile "2b7sA.bssp"
#ERROR : Can't open dsspfile "1lj1A.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "2b7rA.bssp"
#ERROR : Can't open dsspfile "1m64A.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "2nvkX.bssp"
#ERROR : Can't open dsspfile "2i0zA.bssp"

## Summary of PDB Search
:589
    5e-22  28%  1qo8A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3 FUMARATE
    6e-16  25%  1q9iA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    3e-14  25%  1jrzA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C
    3e-14  25%  1e39A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    1e-13  25%  1ksuA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C
    1e-13  25%  1kssA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C
    1e-13  28%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    1e-13  28%  1d4cB  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    1e-13  28%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    1e-13  25%  1jrxA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C
    2e-13  25%  1qjdA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    2e-13  25%  1p2hA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    2e-13  25%  1p2eA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    2e-13  25%  1jryA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C
    2e-13  25%  2b7sA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    3e-13  25%  1lj1A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    3e-13  29%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    3e-13  25%  2b7rA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    4e-13  25%  1m64A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    8e-06  29%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    8e-06  29%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    8e-06  29%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    1e-05  29%  2nvkX  [x.x.x] THIOREDOXIN REDUCTASE
    3e-04  59%  2i0zA  [x.x.x] NAD(FAD)-UTILIZING DEHYDROGENASES
:589

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFE
1qo8A           -------------------------------------------------------------------SFD
1q9iA           ----------------------------------------------------------------------
1jrzA           ----------------------------------------------------------------------
1e39A           ----------------------------------------------------------------------
1ksuA           ----------------------------------------------------------------------
1kssA           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1jrxA           ----------------------------------------------------------------------
1qjdA           ----------------------------------------------------------------------
1p2hA           ----------------------------------------------------------------------
1p2eA           ----------------------------------------------------------------------
1jryA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1lj1A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
1m64A           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
1qo8A           IKPMPFSDAKKKKSWDTQVLVVGAGSAGFNASLAAKKAGANVILFSGGNSMISAGGMN-AVGTKQQTAHG
1q9iA           -----------------------------------TDSGAKVILI--EKEPVIGGNAKLAAGTDQQKAKK
1jrzA           ----------------------------------------------------------------------
1e39A           ----------------------------------------------------------------------
1ksuA           ----------------------------------------------------------------------
1kssA           ----------------------------------------------------------------------
1d4cC           ---------------------------------------------------LAAGGMN-AAETKPQAKLG
1d4cB           ---------------------------------------------------LAAGGMN-AAETKPQAKLG
1d4cA           ---------------------------------------------------LAAGGMN-AAETKPQAKLG
1jrxA           ----------------------------------------------------------------------
1qjdA           ----------------------------------------------------------------------
1p2hA           ----------------------------------------------------------------------
1p2eA           ----------------------------------------------------------------------
1jryA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1lj1A           ----------------------------------------------------------------------
1d4dA           ---------------------------------------------------LAAGGMN-AAETKPQAKLG
2b7rA           ----------------------------------------------------------------------
1m64A           ----------------------------------------------------------------------
3dh9A           -------------SYDYDLIVIGGGSAGLACAKEAVLNGARVACL-DFVKPTPTLGTKWGVGGTC-VNVG
3dghB           -------------SYDYDLIVIGGGSAGLACAKEAVLNGARVACL-DFVKPTPTLGTKWGVGGTC-VNVG
3dghA           -------------SYDYDLIVIGGGSAGLACAKEAVLNGARVACL-DFVKPTPTLGTKWGVGGTC-VNVG
2nvkX           --------------YDYDLIVIGGGSAGLACAKEAVLNGARVACL-DFVKPTPTLGTKWGVGGTC-VNVG
2i0zA           -----------------DVIVIGGGPSGLMAAIGAAEEGANVLL--------------------------


                         +         .         .         .         .         *         .:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
1qo8A           V----EDKVEWFIEDAMKGGRQQNDIKLVTILAEQSADGVQWLESL--GANLDDLKRSGGARVDRTHRPH
1q9iA           ITDSPE-----LMFEDTMKGGQNINDPALVKVLSSHSKDS---VDWMTAMGADLT-DVGMMGGASVNRAH
1jrzA           ----------------------------------------------------------------------
1e39A           ----------------------------------------------------------------------
1ksuA           ----------------------------------------------------------------------
1kssA           ----------------------------------------------------------------------
1d4cC           IEDKKQIMID-----DTMKGGRNINDPELVKVLNNSSDSIDWL----------TSMGADMTDVGRMGGAS
1d4cB           IEDKKQIMID-----DTMKGGRNINDPELVKVLNNSSDSIDWL----------TSMGADMTDVGRMGGAS
1d4cA           IEDKKQIMID-----DTMKGGRNINDPELVKVLNNSSDSIDWL----------TSMGADMTDVGRMGGAS
1jrxA           ----------------------------------------------------------------------
1qjdA           ----------------------------------------------------------------------
1p2hA           ----------------------------------------------------------------------
1p2eA           ----------------------------------------------------------------------
1jryA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1lj1A           ----------------------------------------------------------------------
1d4dA           IEDKKQIMID-----DTMKGGRNINDPELVKVLNNSSDSIDWL----------TSMGADMTDVGRMGGAS
2b7rA           ----------------------------------------------------------------------
1m64A           ----------------------------------------------------------------------
3dh9A           CIPMHQASLLGEAVHEAAAYGWNVDDKDWHKLVQNHIKSVNWVVDLRDKK-------VEYINGLGSFV--
3dghB           CIPMHQASLLGEAVHEAAAYGWNVDDKDWHKLVQNHIKSVNWVVDLRDKK-------VEYINGLGSFV--
3dghA           CIPMHQASLLGEAVHEAAAYGWNVDDKDWHKLVQNHIKSVNWVVDLRDKK-------VEYINGLGSFV--
2nvkX           CIPMHQASLLGEAVHEAAAYGWNVDDKDWHKLVQNHIKSVNWVVDLRDKK-------VEYINGLGSFV--
2i0zA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
1qo8A           ----------GGKSSGPE-----IIDTLRKAAKEQGIDTRLSRVVKLVVNDDHSV--VGAVVHGKHTGYY
1q9iA           RPT-----------GGCGVGAHVVQVLYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1jrzA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1e39A           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1ksuA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1kssA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1d4cC           ------VNRSHRPTXXXXXXXXXXXXLWDNAVK-RGTDIRLNSRVVRIL--EDASGKVTGVLVK---GEY
1d4cB           ------VNRSHRPTXXXXXXXXXXXXLWDNAVK-RGTDIRLNSRVVRIL--EDASGKVTGVLVK---GEY
1d4cA           ------VNRSHRPTXXXXXXXXXXXXLWDNAVK-RGTDIRLNSRVVRIL--EDASGKVTGVLVK---GEY
1jrxA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1qjdA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1p2hA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1p2eA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1jryA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
2b7sA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1lj1A           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1d4dA           ------VNRSHRPTXXXXXXXXXXXXLWDNAVK-RGTDIRLNSRVVRILED----GKVTGVLVK---GEY
2b7rA           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
1m64A           --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
3dh9A           -DSHTLLAKLKSGER-TITAQTFVIAVGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGA-------
3dghB           -DSHTLLAKLKSGER-TITAQTFVIAVGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGA-------
3dghA           -DSHTLLAKLKSGER-TITAQTFVIAVGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGA-------
2nvkX           -DSHTLLAKLKSGER-TITAQTFVIAVGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGA-------
2i0zA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
1qo8A           M--IGAKSVVLATGGYGMNKEMIAYYRPTMKDMTSSNNIT----------ATGDGVLMAKEIGASWVQAH
1q9iA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1jrzA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1e39A           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1ksuA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1kssA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1d4cC           TGYIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPG----------ATGDGLDVALQAGAATREYI
1d4cB           TGYIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPG----------ATGDGLDVALQAGAATREYI
1d4cA           TGYIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPG----------ATGDGLDVALQAGAATREYI
1jrxA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1qjdA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1p2hA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1p2eA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1jryA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
2b7sA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1lj1A           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1d4dA           TGYIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPG----------ATGDGLDVALQAGAATRQYI
2b7rA           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
1m64A           Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
1qo8A           PT---VGKDSRILISETVRGVGAVMVNKDGNRFISELTTRDKASDAILKQPGQFAWIIFDNQLY------
1q9iA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1jrzA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTYDKASAAILAQTGKSAYLIFDDSVRK-----
1e39A           QAAPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1ksuA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1kssA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1d4cC           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFD----------
1d4cB           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFD----------
1d4cA           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFD----------
1jrxA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRK-----
1qjdA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1p2hA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1p2eA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1jryA           QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTKDKASAAILAQTGKSAYLIFDDSVRK-----
2b7sA           QAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1lj1A           FAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRK-----
1d4dA           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFD----------
2b7rA           QAHPTLSVKGGVMVTDAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
1m64A           FAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
1qo8A           ------------KKAKMVRGY-----DHLEM--LYKGDTVEQ-LAKSTGMKVADLAKTVSDYNGYVASGK
1q9iA           --------------------SLCKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1jrzA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1e39A           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1ksuA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1kssA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1d4cC           --------DSIRKSLKAIEGYV---HLNIVK----EGKTIEELAKQIDVPAAELA-KTVTAYNGFVKSGK
1d4cB           --------DSIRKSLKAIEGYV---HLNIVK----EGKTIEELAKQIDVPAAELA-KTVTAYNGFVKSGK
1d4cA           --------DSIRKSLKAIEGYV---HLNIVK----EGKTIEELAKQIDVPAAELA-KTVTAYNGFVKSGK
1jrxA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1qjdA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1p2hA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1p2eA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1jryA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
2b7sA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1lj1A           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1d4dA           --------DSIRKSLKAIEGYV---HLNIVK----EGKTIEELAKQIDVPAAELA-KTVTAYNGFVSGK-
2b7rA           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
1m64A           --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGDSYAN
1qo8A           DTAFGR-ADMPLNMTQSPYYAVKVAPGIHHTM---GGVAINTTASVLDLQSKPIDGLFAAGEVTG-----
1q9iA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1jrzA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1e39A           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1ksuA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHYTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1kssA           DTDFER-PNLPRALNEGNYYA--IEVTP-GVHATMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1d4cC           DAQFER-PDLPRELVVAPFYA--LEIAPAVHHTM-GGLVIDTKAEVKSEKGKPITGLYAAGEVTG-----
1d4cB           DAQFER-PDLPRELVVAPFYA--LEIAPAVHHTM-GGLVIDTKAEVKSEKGKPITGLYAAGEVTG-----
1d4cA           DAQFER-PDLPRELVVAPFYA--LEIAPAVHHTM-GGLVIDTKAEVKSEKGKPITGLYAAGEVTG-----
1jrxA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1qjdA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1p2hA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1p2eA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1jryA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
2b7sA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1lj1A           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1d4dA           DAQFER-PDLPRELVVAPFYA--LEIAPAVHHTM-GGLVIDTKAEVKSEKTKPITGLYAAGEVTG-----
2b7rA           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
1m64A           DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           CYNFAICGHNLGMNCNTFAYMLGKDLAEx
1qo8A           -----------------------------
1q9iA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1jrzA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1e39A           VHGANRLGGNAISDIITFGRLAGEEAAK-
1ksuA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1kssA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1d4cC           -----------------------------
1d4cB           -----------------------------
1d4cA           -----------------------------
1jrxA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1qjdA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1p2hA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1p2eA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1jryA           VHGANRLGGNAISDIITFGRLAGEEAAK-
2b7sA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1lj1A           VHGANRLGGNAISDIITFGRLAGEEAAK-
1d4dA           -----------------------------
2b7rA           VHGANRLGGNAISDIITFGRLAGEEAAK-
1m64A           VHGANRLGGNAISDIITFGRLAGEEAAK-
3dh9A           -----------------------------
3dghB           -----------------------------
3dghA           -----------------------------
2nvkX           -----------------------------
2i0zA           -----------------------------