[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV54563.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2rnjA.bssp"
#ERROR : Can't open dsspfile "1fseE.bssp"
#ERROR : Can't open dsspfile "1fseD.bssp"
#ERROR : Can't open dsspfile "1fseB.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"

## Summary of PDB Search
:474
    1e-04  37%  2rnjA  [x.x.x] RESPONSE REGULATOR PROTEIN VRAR
    1e-04  38%  1fseE  [a.4.6] GERE
    1e-04  38%  1fseD  [a.4.6] GERE
    1e-04  38%  1fseB  [a.4.6] GERE
    1e-04  38%  1fseA  [a.4.6] GERE
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rnjA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rnjA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rnjA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rnjA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rnjA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTAREAE
2rnjA           ---------------------------------------------------------------LTEREME
1fseE           ---------------------------------------------------------------LTKRERE
1fseD           ---------------------------------------------------------------LTKRERE
1fseB           ---------------------------------------------------------------LTKRERE
1fseA           ---------------------------------------------------------------LTKRERE


                         .         .         +         .         .         .         .:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIxxxxxxxxx
2rnjA           ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
1fseE           VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAV---------
1fseD           VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAV---------
1fseB           VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAV---------
1fseA           VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAV---------