[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV54981.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oqrA.bssp"
#ERROR : Can't open dsspfile "1p2fA.bssp"
#ERROR : Can't open dsspfile "1ys7B.bssp"
#ERROR : Can't open dsspfile "1mvoA.bssp"
#ERROR : Can't open dsspfile "1ys6B.bssp"
#ERROR : Can't open dsspfile "1ys7A.bssp"
#ERROR : Can't open dsspfile "1ys6A.bssp"
#ERROR : Can't open dsspfile "2gwrA.bssp"
#ERROR : Can't open dsspfile "2zwmA.bssp"
#ERROR : Can't open dsspfile "1nxpA.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "2jpbA.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "1nxtA.bssp"
#ERROR : Can't open dsspfile "1opcA.bssp"
#ERROR : Can't open dsspfile "1oddA.bssp"
#ERROR : Can't open dsspfile "1kgsA.bssp"
#ERROR : Can't open dsspfile "2zxjA.bssp"
#ERROR : Can't open dsspfile "1w25A.bssp"
#ERROR : Can't open dsspfile "2v0nA.bssp"
#ERROR : Can't open dsspfile "2iynB.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1zesC.bssp"
#ERROR : Can't open dsspfile "1zesA.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1zesB.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "2jbaA.bssp"
#ERROR : Can't open dsspfile "1xheB.bssp"
#ERROR : Can't open dsspfile "1xheA.bssp"
#ERROR : Can't open dsspfile "2jb9B.bssp"
#ERROR : Can't open dsspfile "2jb9A.bssp"
#ERROR : Can't open dsspfile "3i5aA.bssp"
#ERROR : Can't open dsspfile "2jbaB.bssp"
#ERROR : Can't open dsspfile "1nxoA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "1xhfA.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "3gt7A.bssp"
#ERROR : Can't open dsspfile "1sd5A.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1nxxA.bssp"
#ERROR : Can't open dsspfile "2hwvA.bssp"
#ERROR : Can't open dsspfile "2iynA.bssp"
#ERROR : Can't open dsspfile "1nxsA.bssp"
#ERROR : Can't open dsspfile "2d1vA.bssp"
#ERROR : Can't open dsspfile "1srrC.bssp"
#ERROR : Can't open dsspfile "1srrB.bssp"
#ERROR : Can't open dsspfile "1srrA.bssp"
#ERROR : Can't open dsspfile "1peyC.bssp"
#ERROR : Can't open dsspfile "2jvjA.bssp"
#ERROR : Can't open dsspfile "2jvkA.bssp"
#ERROR : Can't open dsspfile "1zgzB.bssp"
#ERROR : Can't open dsspfile "1zgzA.bssp"
#ERROR : Can't open dsspfile "1natA.bssp"
#ERROR : Can't open dsspfile "1fspA.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "2hqrA.bssp"
#ERROR : Can't open dsspfile "1rnlA.bssp"
#ERROR : Can't open dsspfile "1qqiA.bssp"
#ERROR : Can't open dsspfile "2iynC.bssp"
#ERROR : Can't open dsspfile "1gxqA.bssp"
#ERROR : Can't open dsspfile "1gxpE.bssp"
#ERROR : Can't open dsspfile "1gxpB.bssp"
#ERROR : Can't open dsspfile "1gxpA.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "2jviA.bssp"
#ERROR : Can't open dsspfile "2j8eA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "3f7nA.bssp"
#ERROR : Can't open dsspfile "2pmuB.bssp"
#ERROR : Can't open dsspfile "2jzyA.bssp"
#ERROR : Can't open dsspfile "2pl1A.bssp"
#ERROR : Can't open dsspfile "2pkxB.bssp"
#ERROR : Can't open dsspfile "2pkxA.bssp"
#ERROR : Can't open dsspfile "2ftkE.bssp"
#ERROR : Can't open dsspfile "2pmuA.bssp"
#ERROR : Can't open dsspfile "3fftA.bssp"
#ERROR : Can't open dsspfile "1udrB.bssp"
#ERROR : Can't open dsspfile "1udrA.bssp"
#ERROR : Can't open dsspfile "3ffxA.bssp"
#ERROR : Can't open dsspfile "3ffwA.bssp"
#ERROR : Can't open dsspfile "2qzjA.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "1zitA.bssp"
#ERROR : Can't open dsspfile "3jteA.bssp"
#ERROR : Can't open dsspfile "3eodA.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "1qkkA.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1l5zA.bssp"
#ERROR : Can't open dsspfile "1l5yB.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1zh4A.bssp"
#ERROR : Can't open dsspfile "1zh2B.bssp"
#ERROR : Can't open dsspfile "1mavA.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1yioA.bssp"
#ERROR : Can't open dsspfile "1jbeA.bssp"
#ERROR : Can't open dsspfile "2pmuD.bssp"
#ERROR : Can't open dsspfile "1m5uA.bssp"
#ERROR : Can't open dsspfile "1zh2A.bssp"
#ERROR : Can't open dsspfile "1mb3A.bssp"
#ERROR : Can't open dsspfile "1mihA.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "2hqnA.bssp"
#ERROR : Can't open dsspfile "1f4vC.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "2pmuF.bssp"
#ERROR : Can't open dsspfile "1mb0A.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1vlzB.bssp"
#ERROR : Can't open dsspfile "1vlzA.bssp"
#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "2pmuC.bssp"
#ERROR : Can't open dsspfile "2k4jA.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "1ymvA.bssp"
#ERROR : Can't open dsspfile "1ymuA.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "1qmpD.bssp"
#ERROR : Can't open dsspfile "2r25B.bssp"
#ERROR : Can't open dsspfile "1qmpB.bssp"
#ERROR : Can't open dsspfile "1oxkB.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1qmpA.bssp"
#ERROR : Can't open dsspfile "2i6fC.bssp"
#ERROR : Can't open dsspfile "2i6fB.bssp"
#ERROR : Can't open dsspfile "2i6fA.bssp"
#ERROR : Can't open dsspfile "3h5iA.bssp"
#ERROR : Can't open dsspfile "2gkgA.bssp"
#ERROR : Can't open dsspfile "2nt4A.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "2qr3A.bssp"
#ERROR : Can't open dsspfile "3eulC.bssp"
#ERROR : Can't open dsspfile "3eulB.bssp"
#ERROR : Can't open dsspfile "3eulA.bssp"
#ERROR : Can't open dsspfile "2id7A.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "2zayA.bssp"
#ERROR : Can't open dsspfile "2nt3A.bssp"
#ERROR : Can't open dsspfile "2id9A.bssp"
#ERROR : Can't open dsspfile "1heyA.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "3hv2B.bssp"
#ERROR : Can't open dsspfile "3hv2A.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "1tuvA.bssp"
#ERROR : Can't open dsspfile "2qxyB.bssp"
#ERROR : Can't open dsspfile "2qxyA.bssp"

## Summary of PDB Search
:235
    8e-39  35%  2oqrA  [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3
    6e-28  36%  1p2fA  [c.23.1 - a.4.6] RESPONSE REGULATOR
    8e-28  34%  1ys7B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    8e-28  45%  1mvoA  [c.23.1] PHOP RESPONSE REGULATOR
    1e-27  34%  1ys6B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    2e-26  34%  1ys7A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    2e-26  35%  1ys6A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    2e-26  35%  2gwrA  [x.x.x] DNA-BINDING RESPONSE REGULATOR MTRA
    2e-24  43%  2zwmA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
    7e-22  40%  1nxpA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    9e-22  40%  2a9oA  [x.x.x] RESPONSE REGULATOR
    8e-20  39%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    1e-18  42%  2jpbA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN OMPR
    3e-18  40%  2a9qA  [x.x.x] RESPONSE REGULATOR
    4e-18  40%  1nxtA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    6e-18  41%  1opcA  [x.x.x] OMPR
    6e-18  41%  1oddA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN OMPR
    6e-18  34%  1kgsA  [c.23.1 - a.4.6] DNA BINDING RESPONSE REGULATOR D
    5e-17  41%  2zxjA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN WALR
    5e-17  34%  1w25A  [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
    5e-17  34%  2v0nA  [x.x.x] RESPONSE REGULATOR PLED
    2e-16  33%  2iynB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-16  35%  3dgfC  [x.x.x] RESPONSE REGULATOR
    3e-16  35%  3dgeC  [x.x.x] RESPONSE REGULATOR
    4e-16  33%  1zesC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-16  33%  1zesA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-16  33%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-15  34%  1zesB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    5e-15  37%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    5e-15  37%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    8e-15  32%  2jbaA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-14  36%  1xheB  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    1e-14  36%  1xheA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    1e-14  31%  2jb9B  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-14  31%  2jb9A  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-14  36%  3i5aA  [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN
    4e-14  31%  2jbaB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    7e-14  36%  1nxoA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-13  31%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    3e-13  34%  1xhfA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    3e-13  31%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    3e-13  35%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    3e-13  35%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    4e-13  31%  3gt7A  [x.x.x] SENSOR PROTEIN
    6e-13  37%  1sd5A  [c.23.1] PUTATIVE ANTITERMINATOR
    6e-13  37%  1s8nA  [c.23.1] PUTATIVE ANTITERMINATOR
    6e-13  35%  1nxxA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    1e-12  32%  2hwvA  [x.x.x] DNA-BINDING RESPONSE REGULATOR VICR
    1e-12  33%  2iynA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-12  34%  1nxsA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-12  33%  2d1vA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
    2e-12  29%  1srrC  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-12  29%  1srrB  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-12  29%  1srrA  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-12  29%  1peyC  [c.23.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    3e-12  29%  2jvjA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    4e-12  29%  2jvkA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    5e-12  33%  1zgzB  [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-12  33%  1zgzA  [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-12  29%  1natA  [x.x.x] SPORULATION RESPONSE REGULATORY PROTEIN
    5e-12  29%  1fspA  [c.23.1 (1puxA)] STAGE 0 SPORULATION PROTEIN F
    5e-12  31%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-12  25%  2hqrA  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    1e-11  34%  1rnlA  [x.x.x] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    1e-11  39%  1qqiA  [a.4.6] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  34%  2iynC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  39%  1gxqA  [a.4.6] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  39%  1gxpE  [a.4.6] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  39%  1gxpB  [a.4.6] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  39%  1gxpA  [a.4.6] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-11  34%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    1e-11  29%  2jviA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    5e-11  34%  2j8eA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    1e-10  29%  1tmyA  [c.23.1 (1u0sY)] CHEY PROTEIN
    2e-10  34%  3f7nA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-10  31%  2pmuB  [x.x.x] RESPONSE REGULATOR PHOP
    2e-10  35%  2jzyA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PCOR
    3e-10  29%  2pl1A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    3e-10  29%  2pkxB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    3e-10  29%  2pkxA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    3e-10  29%  2ftkE  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    4e-10  32%  2pmuA  [x.x.x] RESPONSE REGULATOR PHOP
    4e-10  33%  3fftA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    6e-10  33%  1udrB  [c.23.1] CHEY PROTEIN
    6e-10  33%  1udrA  [c.23.1] CHEY PROTEIN
    6e-10  33%  3ffxA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-09  32%  3ffwA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-09  29%  2qzjA  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR
    3e-09  32%  1p6qA  [c.23.1] CHEY2
    3e-09  32%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-09  29%  1zitA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    9e-09  27%  3jteA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    9e-09  31%  3eodA  [x.x.x] PROTEIN HNR
    1e-08  31%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    2e-08  28%  1qkkA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-08  25%  1m5tA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    2e-08  28%  1l5zA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-08  28%  1l5yB  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-08  28%  1l5yA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    3e-08  30%  1zh4A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-08  30%  1zh2B  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-08  27%  1mavA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    3e-08  30%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    6e-08  24%  1yioA  [x.x.x] RESPONSE REGULATORY PROTEIN
    6e-08  28%  1jbeA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    7e-08  32%  2pmuD  [x.x.x] RESPONSE REGULATOR PHOP
    7e-08  27%  1m5uA  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    1e-07  30%  1zh2A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-07  24%  1mb3A  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    1e-07  29%  1mihA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-07  25%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-07  25%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-07  25%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-07  29%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-07  27%  2hqnA  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-07  29%  1f4vC  [c.23.1] CHEMOTAXIS CHEY PROTEIN
    2e-07  29%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    2e-07  29%  1cyeA  [x.x.x] CHEY
    2e-07  29%  3chyA  [c.23.1 (1a0oA)] CHEY
    2e-07  29%  1chnA  [x.x.x] CHEY
    2e-07  32%  2pmuF  [x.x.x] RESPONSE REGULATOR PHOP
    2e-07  26%  1mb0A  [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
    2e-07  28%  1ab5A  [c.23.1] CHEY
    3e-07  29%  1vlzB  [c.23.1] CHEY
    3e-07  29%  1vlzA  [c.23.1] CHEY
    3e-07  28%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-07  33%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    5e-07  32%  2pmuC  [x.x.x] RESPONSE REGULATOR PHOP
    5e-07  34%  2k4jA  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    5e-07  23%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    6e-07  29%  1ymvA  [x.x.x] CHEY
    6e-07  29%  1ymuA  [c.23.1] CHEY
    6e-07  28%  5chyA  [x.x.x] CHEY
    8e-07  25%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    8e-07  25%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-06  28%  1ehcA  [x.x.x] CHEY
    1e-06  28%  6chyA  [c.23.1] CHEY
    1e-06  28%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-06  28%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-06  28%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-06  27%  2cheA  [x.x.x] CHEY
    2e-06  30%  1qmpD  [c.23.1] SPO0A
    3e-06  28%  2r25B  [x.x.x] OSMOSENSING HISTIDINE PROTEIN KINASE SLN1
    3e-06  30%  1qmpB  [c.23.1] SPO0A
    3e-06  28%  1oxkB  [c.23.1] SLN1
    3e-06  28%  1oxbB  [c.23.1] SLN1
    4e-06  30%  1qmpA  [c.23.1] SPO0A
    5e-06  24%  2i6fC  [x.x.x] RESPONSE REGULATOR FRZS
    5e-06  24%  2i6fB  [x.x.x] RESPONSE REGULATOR FRZS
    5e-06  24%  2i6fA  [x.x.x] RESPONSE REGULATOR FRZS
    5e-06  31%  3h5iA  [x.x.x] RESPONSE REGULATOR/SENSORY BOX PROTEIN/GGDEF
    5e-06  24%  2gkgA  [x.x.x] RESPONSE REGULATOR HOMOLOG
    7e-06  24%  2nt4A  [x.x.x] RESPONSE REGULATOR HOMOLOG
    7e-06  33%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    7e-06  33%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    7e-06  33%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    2e-05  29%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-05  24%  2qr3A  [x.x.x] TWO-COMPONENT SYSTEM RESPONSE REGULATOR
    2e-05  26%  3eulC  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    2e-05  26%  3eulB  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    2e-05  26%  3eulA  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    3e-05  29%  2id7A  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    3e-05  28%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    4e-05  22%  2zayA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    6e-05  23%  2nt3A  [x.x.x] RESPONSE REGULATOR HOMOLOG
    1e-04  28%  2id9A  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    1e-04  31%  1heyA  [x.x.x] CHEY
    2e-04  27%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    2e-04  27%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    2e-04  28%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    3e-04  30%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    4e-04  27%  3hv2B  [x.x.x] RESPONSE REGULATOR/HD DOMAIN PROTEIN
    4e-04  27%  3hv2A  [x.x.x] RESPONSE REGULATOR/HD DOMAIN PROTEIN
    5e-04  22%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    5e-04  22%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    6e-04  36%  1tuvA  [d.58.4] PROTEIN YGIN
    6e-04  32%  2qxyB  [x.x.x] RESPONSE REGULATOR
    6e-04  32%  2qxyA  [x.x.x] RESPONSE REGULATOR
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
2oqrA           ---VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRAR
1p2fA           --KIAVVDDDKNILKKVSEKLQQLGRVFLTGED-----FLNDEEAFHVVVLDVL-PDYSGYEICRIKETR
1ys7B           -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
1mvoA           -KKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVCKQLRQQ
1ys6B           -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
1ys7A           -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
1ys6A           -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
2gwrA           -QRILVVDDDASLAELTIVLRGE-GFDTAVIGDGTQALTAXXXXXXXXXXXXXXXG--NGIDVCRVLRDS
2zwmA           -KKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKK
1nxpA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKT
2a9oA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKT
2a9rA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL-LMLPEIDGLEVAKTIRKT
2jpbA           ----------------------------------------------------------------------
2a9qA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILD-----LDGLEVAKTIRKT
1nxtA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL-LMLP--DGLEVAKTIRKT
1opcA           ----------------------------------------------------------------------
1oddA           ----------------------------------------------------------------------
1kgsA           --RVLVVEDERDLADLI-TEALKKEFTVDVCYDGEEGYAL--NEPFDVVILDIL-PVHDGWEILK-SRES
2zxjA           ----------------------------------------------------------------------
1w25A           --RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDD
2v0nA           --RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDD
2iynB           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
3dgfC           -KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEK
3dgeC           -KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEK
1zesC           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
1zesA           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
1b00A           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
1zesB           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSA--VNQLNWPDLILLDWMLPGGSGIQFIKHLKRE
3breB           ---VLLVDDQAMIGEAVRSLASEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGN
3breA           ---VLLVDDQAMIGEAVRSLASEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGN
2jbaA           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRE
1xheB           ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
1xheA           ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
2jb9B           -RRILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFIKHLKRE
2jb9A           -RRILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFIKHLKRE
3i5aA           ---VLLVDDQAMIGEAVRGLAGHESIDFHFCADPHQAIAQAVQIKPTVILQDLVMPGLDGLTLVREYRSN
2jbaB           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLKRE
1nxoA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPXXXXXXXXXXXXEVAKTIR----K
1dc7A           ---VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQR
1xhfA           ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEHQILSEYDIN--LVIDINLPGKNGLLLARELREQ
3cfyA           --RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQN
2ayzA           ---ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQL
2ayxA           ---ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQL
3gt7A           --EILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQ
1sd5A           -RRVLIAEDEALIRMDLAEMLREEGYEIVEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASK
1s8nA           -RRVLIAEDEALIRMDLAEMLREEGYEIVEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASK
1nxxA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPXXXXXXXXXXX----EVAKTIRKT
2hwvA           ----------------------------------------------------------------------
2iynA           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
1nxsA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAL--EQFEAEQXXXXXXXXXXXXXXXVAKTIRKT
2d1vA           ----------------------------------------------------------------------
1srrC           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1srrB           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1srrA           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1peyC           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
2jvjA           -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
2jvkA           -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVI
1zgzB           ---IVIVEDEPVTQARLQSYFTQEGYTVSVTASGA-GLREIQNQSVDLILLDINLPDENGLLT-RALRER
1zgzA           ---IVIVEDEPVTQARLQSYFTQEGYTVSVTASGA-GLREIQNQSVDLILLDINLPDENGLLT-RALRER
1natA           -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1fspA           -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1dc8A           ---VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPD-VLLSIRMPGMDGLALLKQIKQR
2hqrA           --RVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLV----MVSDKNALSFVSRIKEK
1rnlA           ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
1qqiA           ----------------------------------------------------------------------
2iynC           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
1gxqA           ----------------------------------------------------------------------
1gxpE           ----------------------------------------------------------------------
1gxpB           ----------------------------------------------------------------------
1gxpA           ----------------------------------------------------------------------
1a04A           ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
2jviA           -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
2j8eA           --KFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRAD
1tmyA           -KRVLIVDDAAFMRMMLKDIITKAGYEVAEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKI
3f7nA           --KFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRAD
2pmuB           ----------------------------------------------------------------------
2jzyA           ----------------------------------------------------------------------
2pl1A           --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSN
2pkxB           --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSN
2pkxA           --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSN
2ftkE           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLL-MKIPGMDGIEILKRMKVI
2pmuA           ----------------------------------------------------------------------
3fftA           --KFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1udrB           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1udrA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
3ffxA           --KFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRAD
3ffwA           --KFLVVDDQSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRAD
2qzjA           --KILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNV
1p6qA           --KVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRAN
1d4zA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1zitA           MKRVLVVDDEESITSSLSAILEEEGYH----PDTAKTLREAEKKIKELIVLDVWMPDGDGVNFIDFIKEN
3jteA           LAKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNDVVITDMKMPKLSGMDILREIKKI
3eodA           -KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIA-----GLKLLEHIRNR
3cu5B           --RILIVDDEKLTRD--GLIANINWKALSFADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVDNILKL
1qkkA           ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
1m5tA           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKED
1l5zA           ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
1l5yB           ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
1l5yA           ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
1zh4A           MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFIRDLRQW
1zh2B           MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFIRDLRQW
1mavA           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKED
1dz3A           --KVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAG
1yioA           ---VFVVDDDMSVREGLRNLLRSAGFEVETFDCASTFLEHRRPEQHGCLVLDMRMPGMSGIELQEQLTAI
1jbeA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAA
2pmuD           ----------------------------------------------------------------------
1m5uA           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKED
1zh2A           ---VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFIRDLRQW
1mb3A           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKED
1mihA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRAD
1dcmA           -----IVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
1dbwB           -----IVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
1dbwA           -----IVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
1ab6A           --KFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
2hqnA           ----------------------------------------------------------------------
1f4vC           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1djmA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1cyeA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
3chyA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1chnA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
2pmuF           ----------------------------------------------------------------------
1mb0A           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKE-
1ab5A           --KFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1vlzB           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1vlzA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
3dzdA           -KRVLVVDDEESITSSLSAILEEEG----YHPDTAKTLREAEKKIKELIVLDV-WPDGDGVNFIDFIKEN
3cu5A           --RILIVDDEKLTRD--GLIANINWKALSFADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVDNILKL
2pmuC           ----------------------------------------------------------------------
2k4jA           ----------------------------------------------------------------------
3cg4A           ----VIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIPG---DGWDTIRAILDN
1ymvA           --KFLVVDDGGTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1ymuA           --KFLVVDDFSTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
5chyA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1d5wB           -----IVDDEEPVRKSLAFMLTMNGFAVKMHQS-AEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDL
1d5wA           -----IVDDEEPVRKSLAFMLTMNGFAVKMHQS-AEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDL
1ehcA           --KFLVVDKFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
6chyA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1e6mA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRAD
1e6lA           --KFLVVDAFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1e6kA           --KFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
2cheA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRAD
1qmpD           --KVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLL-IIMPHLDGLAVLERIRA-
2r25B           --KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFLTSKGENYNMIFMDVQMPKVDGLLSTKMIRDL
1qmpB           --KVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLL-IIMPHLDGLAVLERIRAQ
1oxkB           --KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFLTSKGENYNMIFMDVQMPKVDGLLSTKMIRDL
1oxbB           --KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFLTSKGENYNMIFMDVQMPKVDGLLSTKMIRDL
1qmpA           --KVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLL-IIMPHLDGLAVLERIRAG
2i6fC           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
2i6fB           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
2i6fA           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
3h5iA           -KKILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVKVSGGWYPDLILMDIELGEMDGVQTALAIQQI
2gkgA           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
2nt4A           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
3cz5C           ---------------------------------------------PDIVVMDLTLPGPGGIEATRHIRQW
3cz5B           ---------------------------------------------PDIVVMDLTLPGPGGIEATRHIRQW
3cz5A           ---------------------------------------------PDIVVMDLTLPGPGGIEATRHIRQW
1c4wA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVI-SWNMPNMDGLELLKTIRAD
2qr3A           ---IIIVDDNKGVLTAVQLLLKNHFSKVIXXXXXXXXXXXXREENPEVVLLDMNFTSNEGLFWLHEIKRQ
3eulC           ------------------------------ADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAAAVRSY
3eulB           ------------------------------ADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAAAVRSY
3eulA           ------------------------------ADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAAAVRSY
2id7A           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVI-SWNMPNMDGLELLKTIRAD
3c97A           ----VLIAEDNDICRLVAAKALECTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNY
2zayA           --RIMLVDTQXXXXXXXXXXXXQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKN
2nt3A           -KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVLSAGQNGYLICKLKKDD
2id9A           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVI-SWNMPNMDGLELLKTIRAD
1heyA           ------------------------------AEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
3crnB           LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALF-IKLPDEG---TELLEKAH
3crnA           LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALF-IKLPDEG---TELLEKAH
3cwoX           ------------------------------ATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKI
3c3mA           ---ILVVDDSPIVDVFVTLERG--GYRPITAFSGEECLEALNATPPDLVLLDI---EPDGWETLERIKTD
3hv2B           --EILLVDSQEVIXXXXXXXXSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQ
3hv2A           --EILLVDSQEVIXXXXXXXXSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQ
3cg0B           ---VLIVEDGRLAAATLRIQLESLGYVLGVFDNGEEAVRCAPDLRPDIALVDIMLGALDGVETAARL-AA
3cg0A           ---VLIVEDGRLAAATLRIQLESLGYVLGVFDNGEEAVRCAPDLRPDIALVDIMLGALDGVETAARL-AA
1tuvA           ----------------------------------------------------------------------
2qxyB           -----VVVDESRITFLAVKNALEKGFNVIWAKNEQEAFTFLRREKIDLVFVDVFEGE-ESLNLIRRIREE
2qxyA           -----VVVDESRITFLAVKNALEKGFNVIWAKNEQEAFTFLRREKIDLVFVDVFEGE-ESLNLIRRIREE


                         .         .         *         .         .         .         .:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
2oqrA           S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDSEMSD--GVLESGPVR
1p2fA           PETW-VILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKG---------LYDFGDLK
1ys7B           DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTA---TSSSETITVGPLE
1mvoA           KLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRS--------------------
1ys6B           DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTA---TSSSETITVGPLE
1ys7A           DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTA---TSSSETITVGPLE
1ys6A           DNDVPVCVLSARVD--DRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTATSSS---ETITVGPLE
2gwrA           GVP---IVLTAKTDTVDVVLGLESGADDY-IKPFKPKEXXXXXXXXXXXNDDEPAE-------LSIADVE
2zwmA           -YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR---------------------
1nxpA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
2a9oA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR---------------------
2a9rA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
2jpbA           --------------------------------------------------------------VIAFGKFK
2a9qA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR---------------------
1nxtA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
1opcA           --------------------------------------------------------------VIAFGKFK
1oddA           --------------------------------------------------------------VIAFGKFK
1kgsA           GVNTPVL-LTALSDVEYRVKGLN-GADDYLPKPFDLRELIARVRALIRRKSESKSTKLVCGDL------I
2zxjA           ----------------------------------------------------------------------
1w25A           PTTIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTR----------------------
2v0nA           PTTIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTR----------------------
2iynB           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRIS-------------------
3dgfC           WKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVK--------------------------
3dgeC           WKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVK--------------------------
1zesC           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
1zesA           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
1b00A           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
1zesB           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
3breB           PATIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSR----------------------
3breA           PATIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSR----------------------
2jbaA           SMTIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRIS-------------------
1xheB           A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR---------------------
1xheA           A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR---------------------
2jb9B           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
2jb9A           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
3i5aA           PLTIPIIVLSTKEDPLIKSAAFAAGANDYLVKLPDNIELVARIRYHSR----------------------
2jbaB           SMTIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRR---------------------
1nxoA           TSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
1dc7A           HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVE--------------------------
1xhfA           ANVA--LFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR---------------------
3cfyA           DIPTSVIIATAHGS-VDLAVNIQKGAEDFLEKPINADRLKTSVALHLKRAKL------------------
2ayzA           GLTLPVIGVTANALAEEKQRCLESGMDSCLSKP-------------------------------------
2ayxA           GLTLPVIGVTANALAEEKQRCLESGMDSCLSKP-------------------------------------
3gt7A           PRTIPVILLTILSDPRDVVRSLECGADDFITKPCKDVVLASHVK--------------------------
1sd5A           RI-APIVVLTAQRDLVER--ARDAGAMAYLVKPFSISDLIPAIELAVSR---------------------
1s8nA           RI-APIVVLTAQRDLVER--ARDAGAMAYLVKPFSISDLIPAIELAVSR---------------------
1nxxA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
2hwvA           ------------------------------------------------------------------GDLT
2iynA           SMTIPVVMLTARGE---------TGADDYITKPFSPKELVARIKAVMR----------------------
1nxsA           S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
2d1vA           ---------------------------------------------------------------IHIGSLV
1srrC           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1srrB           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1srrA           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1peyC           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
2jvjA           DENIRVIIMTAYGELDMAQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
2jvkA           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1zgzB           S-TVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNLLWR---------------------
1zgzA           S-TVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNLLWR---------------------
1natA           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1fspA           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
1dc8A           HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVE--------------------------
2hqrA           HSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYRSKALVARIEARLRFWG---------SNVIEIGDLT
1rnlA           SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
1qqiA           ----------------------------------------------------------------------
2iynC           SMTIPVVMLTA------------TGADDYITKPFSPKELVARIKAVMRR---------------------
1gxqA           ----------------------------------------------------------------------
1gxpE           ----------------------------------------------------------------------
1gxpB           ----------------------------------------------------------------------
1gxpA           ----------------------------------------------------------------------
1a04A           SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
2jviA           DENIRVIIMTAYGELDMIQESKELGALTAFAKPFDIDEIRDAVKKYL-----------------------
2j8eA           GAALPVLMVTARAKKENIIAAAQAGASGYVVKPF------------------------------------
1tmyA           DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVV------------------------------
3f7nA           GAALPVLMVTALAKKENIIAAAQAGASGYVVKPF------------------------------------
2pmuB           ----------------------------------------------------------PRNVRLTFADIE
2jzyA           ----------------------------------------------------------------------
2pl1A           DVSLPILVLTARESWQDKVEVLSAGADDYVTKPF-------HIEEVARQA--------------------
2pkxB           DVSLPILVLTARESWQDKVEVLSAGADDYVTKPF-------HIEEVARQA--------------------
2pkxA           DVSLPILVLTARESWQDKVEVLSAGADDYVTKPF-------HIEEVARQA--------------------
2ftkE           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
2pmuA           ----------------------------------------------------------------------
3fftA           GAALPVLMVTARAKKENIIAAAQAGASGYVVKPF------------------------------------
1udrB           GAALPVLMVTAEADAENIKALAQAGASGYVVKPF------------------------------------
1udrA           GAALPVLMVTAEADAENIKALAQAGASGYVVKPF------------------------------------
3ffxA           GAALPVLMVTAHAKKENIIAAAQAGASGYVVKPF------------------------------------
3ffwA           GAALPVLMVTAYAKKENIIAAAQAGASGYVVKPF------------------------------------
2qzjA           -TTCPIVYTYINEDILN---ALNSGGDDYLIKPLNLEILYAKVKAILRRNS-------------------
1p6qA           PATAAFIILTAQGDLVQKAAAL--GANNVLAKPFTIEKMKAAIEA-------------------------
1d4zA           GAALPVLMVTAEAKKENVIAAAQAGASGYVVKPF------------------------------------
1zitA           SPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIK--------------------------
3jteA           TPHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKKL------------------
3eodA           GDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------------
3cu5B           YPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIM------------------------------
1qkkA           DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPF------------------------------------
1m5tA           DAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLER---------------------
1l5zA           DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPF------------------------------------
1l5yB           DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPF------------------------------------
1l5yA           DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPF------------------------------------
1zh4A           SAV-PVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHS-------------------
1zh2B           SAV-PVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHS-------------------
1mavA           DAHIPVVAVTAEERI------REGGCEAYISKPISVVHFLETIKRLLER---------------------
1dz3A           FEHQPVIMLTAFGDVTKKAV--ELGASYFILKPFDMENLAHHI---------------------------
1yioA           SDGIPIVFITAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQ----------------------
1jbeA           MSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
2pmuD           ----------------------------------------------------------------------
1m5uA           DAHIPVVAVTA----------IRGGCEAYISKPISVVHFLETIKRLLER---------------------
1zh2A           SAV-PVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHS-------------------
1mb3A           DDLAHIPVVA----VTDEERIREGGCEAYISKPISVVHFLETIKRLLER---------------------
1mihA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1dcmA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
1dbwB           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
1dbwA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
1ab6A           GAALPVLMTTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
2hqnA           -------------------------------------------------------------NVIEIGDLT
1f4vC           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1djmA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1cyeA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
3chyA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1chnA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
2pmuF           ----------------------------------------------------------------------
1mb0A           ----------------------------------------------------------------------
1ab5A           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1vlzB           GAALPVLMVXXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1vlzA           GAALPVLMVXXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
3dzdA           SPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYSKKAPP--------------
3cu5A           YPDCSVIFMSGYSD------KEYLRAIRYVEKPIDPSEIM------------------------------
2pmuC           ----------------------------------------------------------------------
2k4jA           ----------------------------------------------------------------------
3cg4A           SLEQGIAIVLTAKNAPDAKIGLQEYVVDYITKPFDNEDLI------------------------------
1ymvA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1ymuA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
5chyA           GAALPVLMVTXXXXXXXXXXXXXXGASGWVVKPF------------------------------------
1d5wB           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
1d5wA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
1ehcA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
6chyA           GAALPVLMVXXXXXXXXXXXXXXXGASGWVVKPF------------------------------------
1e6mA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1e6lA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1e6kA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
2cheA           SAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
1qmpD           GHQPNVIMLTAFGDVTKKAV--ELGASYFILKPFDMENLAHHI---------------------------
2r25B           GYTSPIVALTAFADDSNIKECLESGMNGFLSKP-------------------------------------
1qmpB           P---NVIMLTAFGDVTKKAV--ELGASYFILKPFDMENLAHHI---------------------------
1oxkB           GYTSPIVALTAFADDSNIKECLESGMNGFLSKP-------------------------------------
1oxbB           GYTSPIVALTAFADDSNIKECLESGMNGFLSKP-------------------------------------
1qmpA           FEHQPVIMLTAFGDVTKKAV--ELGASYFILKPFDMENLAHHI---------------------------
2i6fC           DLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLV------------------------------
2i6fB           DLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLV------------------------------
2i6fA           DLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLV------------------------------
3h5iA           S-ELPVVFLTAHTEVVEKIRSVTAYG--YVMKSATEQVLITIVEMALR----------------------
2gkgA           DLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLV------------------------------
2nt4A           DLKNVPIVIIGNPDGFAQFRKLKAHADEYVAKPVDADQLV------------------------------
3cz5C           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILRRA--------------------
3cz5B           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILRRA--------------------
3cz5A           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILRRA--------------------
1c4wA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
2qr3A           YRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLL---ETLLNAASQA-----------------
3eulC           ELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEIV------------------------------
3eulB           ELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEIV------------------------------
3eulA           ELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEIV------------------------------
2id7A           GAALPVLMVXXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
3c97A           ERTHNTKRASXXXXXXXXXXXXRPGADEYVSKPLNPNQL-------------------------------
2zayA           PQTAPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRVLK----------------------
2nt3A           DLKNVPIVIIGNPDGFAQHRKLKAHADEAVAKPVDADQLV------------------------------
2id9A           GAALPVLMVXXXXXXXXXXXXXXXGASGWVVKPF------------------------------------
1heyA           GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
3crnB           KLRPGKKIVTGYASLENSVFSLNAGADAY-IKPVNPRDLLEKIKEKL-----------------------
3crnA           KLRPGKKIVTGYASLENSVFSLNAGADAY-IKPVNPRDLLEKIKEKL-----------------------
3cwoX           DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIV---------------------------------------
3c3mA           PATRDIVLLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLAR---------------------
3hv2B           YPSTTRILLTGDPDLINEGEIYR-----YLSKPWD-----------------------------------
3hv2A           YPSTTRILLTGDPDLINEGEIYR-----YLSKPWD-----------------------------------
3cg0B           GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHKKKL------------------
3cg0A           GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHKKKL------------------
1tuvA           ------------------GVSFQSMAPDSIVM-IEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRI
2qxyB           FPDTKVAVLSA---YVDKDLSVKAGAVDYILKPFRLDYLLERVK--------------------------
2qxyA           FPDTKVAVLSA---YVDKDLSVKAGAVDYILKPFRLDYLLERVK--------------------------


                         +         .         .         .         .         *         .:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
2oqrA           MDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEA
1p2fA           IDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFW--EDPVSPRVVDTVIKRIRKAIED
1ys7B           VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLE-
1mvoA           ----------------------------------------------------------------------
1ys6B           VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
1ys7A           VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDF-ADTNVVDVFIGYLRRKLE-
1ys6A           VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
2gwrA           IDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWG--YRADTRLVNVHVQRLRAKVEK
2zwmA           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2jpbA           LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
2a9qA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
1opcA           LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
1oddA           LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
1kgsA           LDTATKKAYRGSKEIDLTKKEYQILEYLVNK-NRVVTKEELQEHLWVFSDV-----LRSHIKNLR-XXXX
2zxjA           -----YSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
3i5aA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1nxoA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1nxxA           ----------------------------------------------------------------------
2hwvA           IHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGXXXXXXXXXXXXXEKIED
2iynA           ----------------------------------------------------------------------
1nxsA           ----------------------------------------------------------------------
2d1vA           IFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGXXXXXXXXXXXXXEKIED
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
1zgzB           ----------------------------------------------------------------------
1zgzA           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2hqrA           ISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKM-D
1rnlA           ----------------------------------------------------------------------
1qqiA           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
2iynC           ----------------------------------------------------------------------
1gxqA           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
1gxpE           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
1gxpB           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
1gxpA           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
1a04A           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
2pmuB           LDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKI--
2jzyA           -------VIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDD
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
2pmuA           LDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKI--
3fftA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
2qzjA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1qkkA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1mavA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1yioA           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
2pmuD           LDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDF--GVNVVESYVSYLRRKI--
1m5uA           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
1mb3A           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
2hqnA           ISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKM-D
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
2pmuF           LDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVW------DVNVVESYVSYLRRKI--
1mb0A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1vlzB           ----------------------------------------------------------------------
1vlzA           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
2pmuC           LDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVW-------VNVVESYVSYLRRKI--
2k4jA           -DANIFRVDKDSKKLDLTRAEYEILSLLISKKGYVFXXXXXXXXXXXXXXXXXXXXXDVIIGRLRSKIEK
3cg4A           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1qmpD           ----------------------------------------------------------------------
2r25B           ----------------------------------------------------------------------
1qmpB           ----------------------------------------------------------------------
1oxkB           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
2i6fC           ----------------------------------------------------------------------
2i6fB           ----------------------------------------------------------------------
2i6fA           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
2gkgA           ----------------------------------------------------------------------
2nt4A           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
2id7A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
2nt3A           ----------------------------------------------------------------------
2id9A           ----------------------------------------------------------------------
1heyA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
3hv2B           ----------------------------------------------------------------------
3hv2A           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1tuvA           LQPG------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPSDPRVIQTVWGIGYRFEPEGxxx
2oqrA           DPANPVHLVTVRGLGYKLE------
1p2fA           DPNRPRYIKTIWGVGY---------
1ys7B           -AGGPRLLHTVRGVGF---------
1mvoA           -------------------------
1ys6B           G-GGPRLLHTVRGVGF---------
1ys7A           --AGPRLLHTVRGVGF---------
1ys6A           G-GGPRLLHTVRGVGF---------
2gwrA           DPENPTVVLTVRGVGYKAGP-----
2zwmA           -------------------------
1nxpA           -------------------------
2a9oA           -------------------------
2a9rA           -------------------------
2jpbA           DPAHPRYIQTVWGLGYVFVPDG---
2a9qA           -------------------------
1nxtA           -------------------------
1opcA           DPAHPRYIQTVWGLGYVFVPD----
1oddA           DPAHPRYIQTVWGLGYVFVPD----
1kgsA           XXXXXXIIHTVRGIGY---------
2zxjA           DPSHPEYIVTRRGVGY---------
1w25A           -------------------------
2v0nA           -------------------------
2iynB           -------------------------
3dgfC           -------------------------
3dgeC           -------------------------
1zesC           -------------------------
1zesA           -------------------------
1b00A           -------------------------
1zesB           -------------------------
3breB           -------------------------
3breA           -------------------------
2jbaA           -------------------------
1xheB           -------------------------
1xheA           -------------------------
2jb9B           -------------------------
2jb9A           -------------------------
3i5aA           -------------------------
2jbaB           -------------------------
1nxoA           -------------------------
1dc7A           -------------------------
1xhfA           -------------------------
3cfyA           -------------------------
2ayzA           -------------------------
2ayxA           -------------------------
3gt7A           -------------------------
1sd5A           -------------------------
1s8nA           -------------------------
1nxxA           -------------------------
2hwvA           SPSHPTYLVTRRGVGY---------
2iynA           -------------------------
1nxsA           -------------------------
2d1vA           NPSHPNWIVTRRGVGY---------
1srrC           -------------------------
1srrB           -------------------------
1srrA           -------------------------
1peyC           -------------------------
2jvjA           -------------------------
2jvkA           -------------------------
1zgzB           -------------------------
1zgzA           -------------------------
1natA           -------------------------
1fspA           -------------------------
1dc8A           -------------------------
2hqrA           KPLGISTVETVRRRGYRF-------
1rnlA           -------------------------
1qqiA           GGHD-RMVQTVRGTGYRF-------
2iynC           -------------------------
1gxqA           GGHD-RMVQTVRGTGYRF-------
1gxpE           GGHD-RMVQTVRGTGYRF-------
1gxpB           GGHD-RMVQTVRGTGYRF-------
1gxpA           GGHD-RMVQTVRGTGYRF-------
1a04A           -------------------------
2jviA           -------------------------
2j8eA           -------------------------
1tmyA           -------------------------
3f7nA           -------------------------
2pmuB           DTGEKRLLHTLRGVGY---------
2jzyA           D-FEPKLIHTVRGAGYVLE------
2pl1A           -------------------------
2pkxB           -------------------------
2pkxA           -------------------------
2ftkE           -------------------------
2pmuA           DTGEKRLLHTLRGVGY---------
3fftA           -------------------------
1udrB           -------------------------
1udrA           -------------------------
3ffxA           -------------------------
3ffwA           -------------------------
2qzjA           -------------------------
1p6qA           -------------------------
1d4zA           -------------------------
1zitA           -------------------------
3jteA           -------------------------
3eodA           -------------------------
3cu5B           -------------------------
1qkkA           -------------------------
1m5tA           -------------------------
1l5zA           -------------------------
1l5yB           -------------------------
1l5yA           -------------------------
1zh4A           -------------------------
1zh2B           -------------------------
1mavA           -------------------------
1dz3A           -------------------------
1yioA           -------------------------
1jbeA           -------------------------
2pmuD           DTGEKRLLHTLRGVGY---------
1m5uA           -------------------------
1zh2A           -------------------------
1mb3A           -------------------------
1mihA           -------------------------
1dcmA           -------------------------
1dbwB           -------------------------
1dbwA           -------------------------
1ab6A           -------------------------
2hqnA           KPLGISTVETVRRRGYRF-------
1f4vC           -------------------------
1djmA           -------------------------
1cyeA           -------------------------
3chyA           -------------------------
1chnA           -------------------------
2pmuF           DTGEKRLLHTLRGVGY---------
1mb0A           -------------------------
1ab5A           -------------------------
1vlzB           -------------------------
1vlzA           -------------------------
3dzdA           -------------------------
3cu5A           -------------------------
2pmuC           DTGEKRLLHTLRGVGY---------
2k4jA           NPKQPQYIISVRGIGYKLE------
3cg4A           -------------------------
1ymvA           -------------------------
1ymuA           -------------------------
5chyA           -------------------------
1d5wB           -------------------------
1d5wA           -------------------------
1ehcA           -------------------------
6chyA           -------------------------
1e6mA           -------------------------
1e6lA           -------------------------
1e6kA           -------------------------
2cheA           -------------------------
1qmpD           -------------------------
2r25B           -------------------------
1qmpB           -------------------------
1oxkB           -------------------------
1oxbB           -------------------------
1qmpA           -------------------------
2i6fC           -------------------------
2i6fB           -------------------------
2i6fA           -------------------------
3h5iA           -------------------------
2gkgA           -------------------------
2nt4A           -------------------------
3cz5C           -------------------------
3cz5B           -------------------------
3cz5A           -------------------------
1c4wA           -------------------------
2qr3A           -------------------------
3eulC           -------------------------
3eulB           -------------------------
3eulA           -------------------------
2id7A           -------------------------
3c97A           -------------------------
2zayA           -------------------------
2nt3A           -------------------------
2id9A           -------------------------
1heyA           -------------------------
3crnB           -------------------------
3crnA           -------------------------
3cwoX           -------------------------
3c3mA           -------------------------
3hv2B           -------------------------
3hv2A           -------------------------
3cg0B           -------------------------
3cg0A           -------------------------
1tuvA           -------------------------
2qxyB           -------------------------
2qxyA           -------------------------