[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55062.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ca3A.bssp"
#ERROR : Can't open dsspfile "2ca4A.bssp"
#ERROR : Can't open dsspfile "2blfA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"

## Summary of PDB Search
:359
    2e-17  31%  2ca3A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    4e-17  31%  2ca4A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    6e-17  31%  2blfA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    2e-16  30%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
:359

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ca3A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
2blfA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxFNQEGVTPNDELFNVFGTALTSMCSKPATELVDVEGGVANFYVNVGGNIKKNFTIDVRDLAEDAN
2ca3A           -----FDEGLITPNDAFFVMYHLAGIPLEIDPDA-----------FRLEIKGKVGTPLSLSLQDLKNDFP
2ca4A           -----FDEGLITPNDAFFVRYALAGIPLEIDPDA-----------FRLEIKGKVGTPLSLSLQDLKNDFP
2blfA           -----FDEGLITPNDAFFVRYHLAGIPLEIDPDA-----------FRLEIKGKVGTPLSLSLQDLKNDFP
2c9xA           -----FDEGLITPNDAFFVRYHLAGIPLEIDPDA-----------FRLEIKGKVGTPLSLSLQDLKNDFP


                         +         .         .         .         .         *         .:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
2ca3A           ASEVVAVNQCSGNSMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGFVKALSIDHATDGEVMLAYSMN
2ca4A           ASEVVAVNQCSGNSMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGFVKALSIDHATDGEVMLAYSMN
2blfA           ASEVVAVNQCSGNSMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGFVKALSIDHATDGEVMLAYSMN
2c9xA           ASEVVAVNQCSGNSMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGFVKALSIDHATDGEVMLAYSMN


                         .         .         .         +         .         .         .:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEI
2ca3A           GADLPWLNGYPLRLVVPGYYGTYWVKHL--NEITVIDKEFDGFWMKTAYRIPDNITNVENGASVKAG-EV
2ca4A           GADLPWLNGYPLRLVVPGYYGTYWVKHL--NEITVIDKEFDGFWMKTAYRIPDNITNVENGASVKAG-EV
2blfA           GADLPWLNGYPLRLVVPGYYGTYWVKHL--NEITVIDKEFDGFWMKTAYRIPDNITNVENGASVKAG-EV
2c9xA           GADLPWLNGYPLRLVVPGYYGTYWVKHL--NEITVIDKEFDGFWMKTAFRIPDNITNVENGASVKAG-EV


                         .         *         .         .         .         .         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPL
2ca3A           PLRGIAFDGGYGITQVSVSADAGKSWTNATLDGLGKYSFRGWKAVLPL-TKGDHVLMCRATNARGETQPM
2ca4A           PLRGIAFDGGYGITQVSVSADAGKSWTNATLDGLGKYSFRGWKAVLPL-TKGDHVLMCRATNARGETQPM
2blfA           PLRGIAFDGGYGITQVSVSADAGKSWTNATLDGLGKYSFRGWKAVLPL-TKGDHVLMCRATNARGETQPM
2c9xA           PLRGIAFDGGYGITQVSVSADAGKSWTNATLDGLGKYSFRGWKAVLPL-TKGDHVLMCRATNARGETQPM


                         .         .         .         .         *         .         .:420
query           AATxxxxxx
2ca3A           QAT------
2ca4A           QAT------
2blfA           QAT------
2c9xA           QAT------