[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55195.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wdwB.bssp"
#ERROR : Can't open dsspfile "1v8zD.bssp"
#ERROR : Can't open dsspfile "1v8zB.bssp"
#ERROR : Can't open dsspfile "1v8zA.bssp"
#ERROR : Can't open dsspfile "1x1qA.bssp"
#ERROR : Can't open dsspfile "1x1qB.bssp"
#ERROR : Can't open dsspfile "2o2eB.bssp"
#ERROR : Can't open dsspfile "2o2eA.bssp"
#ERROR : Can't open dsspfile "1qoqB.bssp"
#ERROR : Can't open dsspfile "1wsyB.bssp"
#ERROR : Can't open dsspfile "1qopB.bssp"
#ERROR : Can't open dsspfile "1kfcB.bssp"
#ERROR : Can't open dsspfile "1k8xB.bssp"
#ERROR : Can't open dsspfile "1k3uB.bssp"
#ERROR : Can't open dsspfile "2cloB.bssp"
#ERROR : Can't open dsspfile "2clmB.bssp"
#ERROR : Can't open dsspfile "2cllB.bssp"
#ERROR : Can't open dsspfile "2cleB.bssp"
#ERROR : Can't open dsspfile "1bksB.bssp"
#ERROR : Can't open dsspfile "1a5sB.bssp"
#ERROR : Can't open dsspfile "1a5aB.bssp"
#ERROR : Can't open dsspfile "1fuyB.bssp"
#ERROR : Can't open dsspfile "1k8zB.bssp"
#ERROR : Can't open dsspfile "1k7xB.bssp"
#ERROR : Can't open dsspfile "2j9yB.bssp"
#ERROR : Can't open dsspfile "1ubsB.bssp"
#ERROR : Can't open dsspfile "2tysB.bssp"
#ERROR : Can't open dsspfile "2j9zB.bssp"
#ERROR : Can't open dsspfile "1k7fB.bssp"
#ERROR : Can't open dsspfile "2wsyB.bssp"
#ERROR : Can't open dsspfile "2dh5A.bssp"
#ERROR : Can't open dsspfile "2rhgB.bssp"
#ERROR : Can't open dsspfile "2dh6A.bssp"
#ERROR : Can't open dsspfile "2zsjD.bssp"
#ERROR : Can't open dsspfile "2zsjA.bssp"

## Summary of PDB Search
:461
    4e-26  35%  1wdwB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN 1
    4e-26  35%  1v8zD  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN 1
    4e-26  35%  1v8zB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN 1
    4e-26  35%  1v8zA  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN 1
    2e-17  34%  1x1qA  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    4e-15  35%  1x1qB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    8e-14  31%  2o2eB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    8e-14  31%  2o2eA  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  1qoqB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  1wsyB  [x.x.x] TRYPTOPHAN SYNTHASE (E.C.4.2.1.20)
    1e-11  27%  1qopB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  1kfcB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  1k8xB  [c.79.1] TRYPTOPHAN SYNTHASE, BETA PROTEIN
    1e-11  27%  1k3uB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  2cloB  [c.79.1 (1a50B)] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  2clmB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  2cllB  [c.79.1 (1k7eB)] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  2cleB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-11  27%  1bksB  [c.79.1] TRYPTOPHAN SYNTHASE
    1e-11  27%  1a5sB  [c.79.1] TRYPTOPHAN SYNTHASE (BETA CHAIN)
    1e-11  27%  1a5aB  [c.79.1] TRYPTOPHAN SYNTHASE (BETA CHAIN)
    2e-11  27%  1fuyB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    3e-11  28%  1k8zB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    3e-11  28%  1k7xB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    5e-11  27%  2j9yB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    6e-11  27%  1ubsB  [c.79.1] TRYPTOPHAN SYNTHASE
    6e-11  27%  2tysB  [c.79.1] TRYPTOPHAN SYNTHASE
    2e-10  26%  2j9zB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    2e-10  27%  1k7fB  [c.79.1] TRYPTOPHAN SYNTHASE BETA CHAIN
    3e-10  26%  2wsyB  [c.79.1] TRYPTOPHAN SYNTHASE
    4e-10  27%  2dh5A  [x.x.x] TRYPTOPHAN SYNTHASE BETA SUBUNIT
    5e-09  29%  2rhgB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    2e-08  29%  2dh6A  [x.x.x] TRYPTOPHAN SYNTHASE BETA SUBUNIT
    2e-05  43%  2zsjD  [x.x.x] THREONINE SYNTHASE
    2e-05  43%  2zsjA  [x.x.x] THREONINE SYNTHASE
:461

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLPNGQVAAPEDLAPVFCDELVRQELDDDTAYVDIP
1wdwB           ----------------------------------------------------------------------
1v8zD           ----------------------------------------------------------------------
1v8zB           ----------------------------------------------------------------------
1v8zA           ----------------------------------------------------------------------
1x1qA           ----------------------------------------------------------------------
1x1qB           ----------------------------------------------------------------------
2o2eB           -----------------------------------VPEALMAVIEEVTAAYQKERVSQDFLDDLDR----
2o2eA           -----------------------------------VPEALMAVIEEVTAAYQKERVSQDFLDDLDR----
1qoqB           ----------------------------------------------------------------------
1wsyB           ----------------------------------------------------------------------
1qopB           ----------------------------------------------------------------------
1kfcB           ----------------------------------------------------------------------
1k8xB           ----------------------------------------------------------------------
1k3uB           ----------------------------------------------------------------------
2cloB           ----------------------------------------------------------------------
2clmB           ----------------------------------------------------------------------
2cllB           ----------------------------------------------------------------------
2cleB           ----------------------------------------------------------------------
1bksB           ----------------------------------------------------------------------
1a5sB           ----------------------------------------------------------------------
1a5aB           ----------------------------------------------------------------------
1fuyB           ----------------------------------------------------------------------
1k8zB           ----------------------------------------------------------------------
1k7xB           ----------------------------------------------------------------------
2j9yB           ----------------------------------------------------------------------
1ubsB           ----------------------------------------------------------------------
2tysB           ----------------------------------------------------------------------
2j9zB           ----------------------------------------------------------------------
1k7fB           ----------------------------------------------------------------------
2wsyB           ----------------------------------------------------------------------
2dh5A           ----------------------------------------------------------------------
2rhgB           ----------------------------------------------------------------------
2dh6A           ----------------------------------------------------------------------
2zsjD           ------------------------------------------------------------------VDEN
2zsjA           ------------------------------------------------------------------VDEN


                         .         .         *         .         .         .         .:140
query           EPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKAQDLDGITTETGA
1wdwB           ----------RPTPLYYAKRLTEKIGG-AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
1v8zD           ----------RPTPLYYAKRLTEKIGG-AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
1v8zB           ----------RPTPLYYAKRLTEKIGG-AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
1v8zA           ----------RPTPLYYAKRLTEKIGG-AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
1x1qA           ----------RPTPLYHAKRLSEYWGG-AQVFLKREDLLHTGAHKINNTLGQALLAR-RGKRRVIAETGA
1x1qB           ----------RPTPLYHAKRLSEYWGG-AQVFLKREDLLHTGAHKINNTLGQALLAR-RGKRRVIAETGA
2o2eB           ---LQANYAGRPSPLYEATRLSQHAGS-ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGA
2o2eA           ---LQANYAGRPSPLYEATRLSQHAGS-ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGA
1qoqB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1wsyB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1qopB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1kfcB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1k8xB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1k3uB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2cloB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2clmB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2cllB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2cleB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1bksB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1a5sB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1a5aB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1fuyB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1k8zB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1k7xB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2j9yB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1ubsB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHTTNQVLGQALLAKRMGKSEIIAETGA
2tysB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHTTNQVLGQALLAKRMGKSEIIAETGA
2j9zB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAEVGA
1k7fB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2wsyB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2dh5A           ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
2rhgB           ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2dh6A           ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
2zsjD           TPIVTLYE--GNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSFKMTLAISKAVEA--------------
2zsjA           TPIVTLYE--GNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSFKMTLAISKAVEA--------------


                         +         .         .         .         .         *         .:210
query           GQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETFDAHVTPSPSDTTEIGRKMLAEHPDSSGSLG
1wdwB           GQHGVATAMAGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNS---------------GSRTLK
1v8zD           GQHGVATAMAGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNS---------------GSRTLK
1v8zB           GQHGVATAMAGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNS---------------GSRTLK
1v8zA           GQHGVATAMAGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNS---------------GSRTLK
1x1qA           GQHGVSVATVAALFGLECVV------YGEEDVRRQALNVF---------------RKLLGAEPVAAGSLK
1x1qB           GQHGVSVATVAALFGLECVV------YGEEDVRRQALNVF---------------RKLLG--AEVRPTLK
2o2eB           GQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVV-----AVQTGSKTLKD------AIN
2o2eA           GQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVV-----AVQTGSKTLKD------AIN
1qoqB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALADWSGSYE
1wsyB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1qopB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1kfcB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1k8xB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1k3uB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2cloB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2clmB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2cllB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2cleB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1bksB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1a5sB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1a5aB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1fuyB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDLWNEALRDWSGSYE
1k8zB           GQHGVXXXXXXXXXXXKCRIYMAKDVERQSPFRMRLM-----------------GAEVIPVH-SGSATLK
1k7xB           GQHGVXXXXXXXXXXXKCRIYMAKDVERQSPFRMRLM-----------------GAEVIPVH-SGSATLK
2j9yB           GNHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1ubsB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2tysB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2j9zB           GNHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
1k7fB           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2wsyB           GQHGVXXXXXXXXXXXKCRIYM-GAKDSPNVFRMRLM---GAEVITLKDACNEALRDWSGSYETAHYMLG
2dh5A           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2rhgB           GQHGVXXXXXXXXXXXKCRIYNV--------FRMRLM-----------------GAEVIALR-DWSGSYE
2dh6A           GQHGVXXXXXXXXXXXKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYE
2zsjD           ----------------------------------------------------------------------
2zsjA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TAISEAVERALNIPGNKGRYTLGSVLNQVVLHQSVIGLESYAAFEELGEYPDVVIXXXXXXXXXXXLIAP
1wdwB           DAINEAL-RDWVATFEYTHYLIGSVVGPVRDFQSVIGREAKAILEAEGQLPDVIVACVGGGSNAMGIFYP
1v8zD           DAINEAL-RDWVATFEYTHYLIGSVVGPVRDFQSVIGREAKAILEAEGQLPDVIVACVGGGSNAMGIFYP
1v8zB           DAINEAL-RDWVATFEYTHYLIGSVVGPVRDFQSVIGREAKAILEAEGQLPDVIVACVGGGSNAMGIFYP
1v8zA           DAINEAL-RDWVATFEYTHYLIGSVVGPVRDFQSVIGREAKAILEAEGQLPDVIVACVGGGSNAMGIFYP
1x1qA           DATNEAIRDWINV--RTTFYILGSVVGPVRDFQSVIGEEKRQSLELFGRLPDALIAAVGGGSNAIGLFAP
1x1qB           DATNEAIDWITNV--RTTFYILGSVVGPVRDFQSVIGEEKRQSLELFGRLPDALIAAVGGGSNAIGLFAP
2o2eB           EAFRDWVANADNT-----YYCFGTAATMVRDFQRIIGMEARVQIQQAGRLPDAVVACVGGGSNAIGIFHA
2o2eA           EAFRDWVANADNT-----YYCFGTAATMVRDFQRIIGMEARVQIQQAGRLPDAVVACVGGGSNAIGIFHA
1qoqB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1wsyB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1qopB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1kfcB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1k8xB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1k3uB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2cloB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2clmB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2cllB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2cleB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1bksB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1a5sB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1a5aB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1fuyB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1k8zB           DACNEALR---DWPGSTAHYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1k7xB           DACNEALR---DWPGSTAHYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2j9yB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1ubsB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2tysB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2j9zB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
1k7fB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2wsyB           TA--------------AGPHPYPTIVRE---FQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2dh5A           TA----------------HYMLGTAAGPVREFQRMIGEETKAILEREGRLPDAVIACVGGGSNAIGMFAD
2rhgB           TA----------------HYMLGTAAGPVREFQRMIGEETKAILDKEGRLPDAVIACVGGGSNAIGMFAD
2dh6A           TA----------------HYMLGTAAGPVREFQRMIGEETKAILEREGRLPDAVIACVGGGSNAIGMFAD
2zsjD           ----------------------------------------------------------------------
2zsjA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FMRDKIKGVRPDTRFVAVEPASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMS
1wdwB           FVNDK------KVKLVGVE-AGGKGLESGKHSLNAGQVGVFHGMLSYFLQDEEGQIKPTHAPGLDYPGVG
1v8zD           FVNDK------KVKLVGVE-AGGKGLESGKHSLNAGQVGVFHGMLSYFLQDEEGQIKPTHAPGLDYPGVG
1v8zB           FVNDK------KVKLVGVE-AGGKGLESGKHSLNAGQVGVFHGMLSYFLQDEEGQIKPTHAPGLDYPGVG
1v8zA           FVNDK------KVKLVGVE-AGGKGLESGKHSLNAGQVGVFHGMLSYFLQDEEGQIKPTHAPGLDYPGVG
1x1qA           FAY--LPEGRP--KLIGVEAAG-EGLSTGRHAASIGAGKRGVLHGSYYLLYD-------------YPGVG
1x1qB           FA--YLPEGRP--KLIGVEAASV-------------------------------------SAGLDYPGVG
2o2eB           FLDD------PGVRLVGFEAA-------------------------------------------------
2o2eA           FLDD------PGVRLVGFEAA-------------------------------------------------
1qoqB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1wsyB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1qopB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1kfcB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1k8xB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1k3uB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2cloB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2clmB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2cllB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2cleB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1bksB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1a5sB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1a5aB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1fuyB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1k8zB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1k7xB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2j9yB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1ubsB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2tysB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2j9zB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
1k7fB           FINDTSVGL------IGVEPGG------HRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2wsyB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2dh5A           FINETLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPMMQTEQIEESYSIS----AGLDFPSVG
2rhgB           FINDTLIGVEPGGHGIETGEHGAP-LKHGRVGIYF---GMKAPM--MQTADGQIEESYSISAGLDFPSVG
2dh6A           FINETNVGL------IGVEPGVGPQNSTGRADYVSITDDEALEAFKTLCLHEGIIP--------------
2zsjD           ----------------------------------------------------------------------
2zsjA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PIVSKLKHDGYLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
1wdwB           PEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAK---EMSRDEIIIVNLSG
1v8zD           PEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAK---EMSRDEIIIVNLSG
1v8zB           PEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAK---EMSRDEIIIVNLSG
1v8zA           PEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAK---EMSRDEIIIVNLSG
1x1qA           PEHSYYADAGVAEYASVTDEEALEGFKLLARLEGIIPALESAHAIAYAA----KVVPEDKDQVVVINLSG
1x1qB           PEHSYYADAGVAEYASVTDEEALEGFKLLARLEGIIPALESAHAIAYAA----KVVPEDKDQVVVINLSG
2o2eB           ----------------------------------------------------------------------
2o2eA           ----------------------------------------------------------------------
1qoqB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1wsyB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1qopB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1kfcB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1k8xB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1k3uB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2cloB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2clmB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2cllB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2cleB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1bksB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1a5sB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1a5aB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1fuyB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1k8zB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1k7xB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2j9yB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1ubsB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2tysB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2j9zB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
1k7fB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2wsyB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2dh5A           PQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIP---------------------------------
2rhgB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPXXXXXXXXXXXXKMMREQPE--KEQLLVVNLSG
2dh6A           ----------------------------------------------------------------------
2zsjD           ----------------------------------------------------------------------
2zsjA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TGYFDMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wdwB           RGDKDL-----------------------------------
1v8zD           RGDKDL-----------------------------------
1v8zB           RGDKDL-----------------------------------
1v8zA           RGDKDL-----------------------------------
1x1qA           RGDKDV-----------------------------------
1x1qB           RGDKDV-----------------------------------
2o2eB           -----------------------------------------
2o2eA           -----------------------------------------
1qoqB           RGDKDI-----------------------------------
1wsyB           RGDKDI-----------------------------------
1qopB           RGDKDI-----------------------------------
1kfcB           RGDKDI-----------------------------------
1k8xB           RGDKDI-----------------------------------
1k3uB           RGDKDI-----------------------------------
2cloB           RGDKDI-----------------------------------
2clmB           RGDKDI-----------------------------------
2cllB           RGDKDI-----------------------------------
2cleB           RGDKDI-----------------------------------
1bksB           RGDKDI-----------------------------------
1a5sB           RGDKDI-----------------------------------
1a5aB           RGDKDI-----------------------------------
1fuyB           RGDKDI-----------------------------------
1k8zB           RGDKDI-----------------------------------
1k7xB           RGDKDI-----------------------------------
2j9yB           RGDKDI-----------------------------------
1ubsB           RGDKDI-----------------------------------
2tysB           RGDKDI-----------------------------------
2j9zB           RGDKDI-----------------------------------
1k7fB           RGDKDI-----------------------------------
2wsyB           RGDKDI-----------------------------------
2dh5A           -----------------------------------------
2rhgB           RGDKDI-----------------------------------
2dh6A           -----------------------------------------
2zsjD           -----------------------------------------
2zsjA           -----------------------------------------