[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55248.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "3fvwB.bssp"
#ERROR : Can't open dsspfile "3fvwA.bssp"
#ERROR : Can't open dsspfile "3gfsC.bssp"
#ERROR : Can't open dsspfile "3gfsF.bssp"
#ERROR : Can't open dsspfile "3gfsA.bssp"
#ERROR : Can't open dsspfile "3gfrD.bssp"
#ERROR : Can't open dsspfile "3gfrA.bssp"
#ERROR : Can't open dsspfile "3gfqB.bssp"
#ERROR : Can't open dsspfile "3gfqA.bssp"
#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "2gswA.bssp"
#ERROR : Can't open dsspfile "2fzvD.bssp"
#ERROR : Can't open dsspfile "2v9cB.bssp"
#ERROR : Can't open dsspfile "2v9cA.bssp"

## Summary of PDB Search
:187
    1e-25  42%  1rttA  [c.23.5] CONSERVED HYPOTHETICAL PROTEIN
    8e-21  38%  3fvwB  [x.x.x] PUTATIVE NAD(P)H-DEPENDENT FMN REDUCTASE
    4e-20  38%  3fvwA  [x.x.x] PUTATIVE NAD(P)H-DEPENDENT FMN REDUCTASE
    2e-07  33%  3gfsC  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfsF  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfsA  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfrD  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfrA  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfqB  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    6e-07  33%  3gfqA  [x.x.x] FMN-DEPENDENT NADPH-AZOREDUCTASE
    9e-06  35%  1nni1  [c.23.5] HYPOTHETICAL PROTEIN YHDA
    9e-06  35%  2gswA  [x.x.x] YHDA
    1e-04  28%  2fzvD  [x.x.x] PUTATIVE ARSENICAL RESISTANCE PROTEIN
    4e-04  37%  2v9cB  [x.x.x] FMN-DEPENDENT NADH-AZOREDUCTASE 1
    4e-04  37%  2v9cA  [x.x.x] FMN-DEPENDENT NADH-AZOREDUCTASE 1
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
1rttA           IKVLGISGSLRSGSYNSAALQEAIGLVP---PGMSIELADISGIPLYNEDVYALGPPAVERFREQIRAAD
3fvwB           -RILFIVGSFSEGSFNRQLAKKAETIIGDR-AQVSY--LSYDRVPFFNQDLETSVHPEVAHAREEVQEAD
3fvwA           -RILFIVGSFSEGSFNRQLAKKAETIIGDR-AQVSY--LSYDRVPFFNQDLETSVHPEVAHAREEVQEAD
3gfsC           MNMLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfsF           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfsA           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfrD           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfrA           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfqB           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
3gfqA           --MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
1nni1           ---LVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
2gswA           ---LVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
2fzvD           VRILLLYGSLRARSFSRLAVEEAARLLQFFGAETR--IFDPSDLPLPDQSDDHPA---VKELRALSEWSE
2v9cB           -RILAVHASPRERSQSRRLAEVFLAAYREAHPEVGRVPLPAVTEAFVAAAF-HPQPEQRSLAMQALFDSD
2v9cA           -RILAVHASPRERSQSRRLAEVFLAAYREAHPEVGRVPLPAVTEAFVAAAF-HPQPEQRSLAMQALFDSD


                         .         .         *         .         .         .         .:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
1rttA           ALLFATPEYNYSMAGVLKNAIDWASRP----PEQPFSGKPAAILGASAGRFGTARAQYHLRQTLVFLDVH
3fvwB           AIWIFSPVYNYAIPGPVKNXXXXXXXXXXPTGPSVLQDKIVTVSSVANGASPEEVFEDYR-SLLPFI-RH
3fvwA           AIWIFSPVYNYAIPGPVKNXXXXXXXXXXPTGPSVLQDKIVTVSSVA---NGAEVFEDYR-SLLPFI-RH
3gfsC           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfsF           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfsA           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfrD           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfrA           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfqB           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
3gfqA           AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
1nni1           AIVLLSPEY-HSGSGALKNALDFLS---------------------------------------------
2gswA           AIVLLSPEY-HSGSGALKNALDFLS---------------------------------------------
2fzvD           GQVWCSPERHGQITSVMKAQIDHLPRP---TQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPN--
2v9cB           LLVISTPMYNFSVPSGLKAWIDQIVR--------------------------------------------
2v9cA           LLVISTPMYNFSVPSGLKAWIDQIVR--------------------------------------------


                         +         .         .         .         .         *         .:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVExxxx
1rttA           PLNKPEVMISSAQNAFDAQGRL-------------------------
3fvwB           LVD--QLTGVPINSEAWSTGILKVSAKLAELSAQADALLSAIE----
3fvwA           LVD--QLTGVPINSEAWSTGILKVSAKLAELSAQADALLSAIE----
3gfsC           -----------------------------------------------
3gfsF           -----------------------------------------------
3gfsA           -----------------------------------------------
3gfrD           -----------------------------------------------
3gfrA           -----------------------------------------------
3gfqB           -----------------------------------------------
3gfqA           -----------------------------------------------
1nni1           -----------------------------------------------
2gswA           -----------------------------------------------
2fzvD           -----QSSIAKAFQEFDAAGRMK---PSPYYDRIADVMEELV-----
2v9cB           -----------------------------------------------
2v9cA           -----------------------------------------------