[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "1xewY.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1xexB.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"

## Summary of PDB Search
:1228
    4e-71  32%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-61  35%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-57  33%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    1e-57  33%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    8e-56  31%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    6e-54  43%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    5e-53  45%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-52  44%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-52  44%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-52  44%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    7e-52  44%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-52  44%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-51  44%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    8e-50  41%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    8e-50  41%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    5e-48  43%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    1e-47  42%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    4e-46  33%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-44  43%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    2e-39  38%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-39  38%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-38  38%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-38  38%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    7e-38  38%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-37  37%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-33  37%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-24  31%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-22  34%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-22  34%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    6e-21  35%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-20  38%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-20  33%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-20  33%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-20  33%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-20  38%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-20  38%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-20  38%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-20  34%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-20  37%  2oukB  [x.x.x] PROTEIN ARTP
    7e-20  37%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    9e-20  37%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-20  37%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-20  38%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-19  34%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-19  34%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-19  34%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-19  35%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  33%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-19  33%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-19  37%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-19  38%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-19  34%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  34%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-19  34%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-18  32%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-18  32%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  33%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  33%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-17  33%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-17  35%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  35%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17  33%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17  31%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-17  33%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-17  34%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    5e-17  33%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-16  30%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-16  44%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16  31%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-16  38%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-16  31%  2d2eA  [x.x.x] SUFC PROTEIN
    6e-16  34%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-16  30%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    2e-15  28%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    4e-15  33%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    4e-15  33%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    5e-15  32%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    5e-15  32%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    5e-15  33%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  33%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-14  36%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    6e-14  37%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-13  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-13  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-13  31%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-13  25%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-12  31%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-12  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-12  34%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    5e-12  34%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-11  31%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-11  36%  1yqtA  [x.x.x] RNASE L INHIBITOR
    4e-11  28%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-11  28%  1ji0A  [c.37.1] ABC TRANSPORTER
    8e-11  30%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-10  27%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-10  21%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    8e-10  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    1e-09  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-09  39%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-09  39%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-09  39%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-09  39%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-09  39%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    7e-09  26%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-08  29%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-08  29%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-06  27%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-06  29%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-06  29%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-06  29%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    6e-06  40%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    6e-06  40%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    6e-06  42%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-06  39%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-05  30%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    6e-05  28%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-04  36%  1xewY  [c.37.1] SMC PROTEIN
    3e-04  32%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    9e-04  36%  1xexB  [c.37.1] SMC PROTEIN
    4e-49  33%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG(query 217->585)
    6e-46  42%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA(query 349->573)
    2e-42  45%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA(query 352->584)
    4e-44  38%  2ghiA  [x.x.x] TRANSPORT PROTEIN(query 351->585)
    6e-40  37%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    1e-39  36%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    1e-39  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    6e-40  37%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN(query 352->572)
    9e-39  36%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    1e-39  36%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    9e-39  36%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->572)
    1e-36  35%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING(query 352->583)
    1e-36  35%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING(query 352->583)
    7e-39  38%  2ghiB  [x.x.x] TRANSPORT PROTEIN(query 351->585)
    2e-38  38%  2ghiC  [x.x.x] TRANSPORT PROTEIN(query 351->585)
    2e-38  44%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA(query 351->571)
    3e-35  39%  2ghiD  [x.x.x] TRANSPORT PROTEIN(query 351->585)
    5e-25  31%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    5e-25  31%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    8e-24  30%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    3e-25  32%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1(query 352->584)
    2e-23  31%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    2e-22  30%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    4e-19  31%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 352->584)
    1e-21  31%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 351->588)
    2e-09  29%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 368->574)
    2e-09  29%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 368->574)
    6e-11  26%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING(query 368->574)
    3e-11  29%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING(query 352->574)
    8e-13  27%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    8e-13  27%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    8e-13  27%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    3e-12  29%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    3e-12  29%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    3e-12  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    4e-10  27%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    9e-09  28%  2oukB  [x.x.x] PROTEIN ARTP(query 369->574)
    9e-09  28%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER(query 369->574)
    7e-12  29%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    7e-12  29%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    1e-10  30%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 368->573)
    4e-11  27%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    4e-11  27%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    4e-11  27%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    4e-12  27%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    5e-15  35%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 368->575)
    5e-15  35%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 368->575)
    3e-10  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID(query 368->573)
    2e-10  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 368->573)
    1e-12  30%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-12  30%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    8e-13  30%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    8e-13  30%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    8e-13  30%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    8e-13  30%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    2e-13  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-05  25%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN(query 368->574)
    2e-10  27%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    2e-09  27%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    6e-13  30%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 352->568)
    6e-13  30%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 352->568)
    2e-09  27%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    2e-08  27%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 369->574)
    4e-09  27%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    4e-12  26%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 368->576)
    1e-10  27%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->574)
    4e-05  23%  1b0uA  [c.37.1] HISTIDINE PERMEASE(query 369->574)
    2e-08  27%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    2e-05  24%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK(query 368->574)
    3e-08  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    3e-09  27%  2d2fA  [x.x.x] SUFC PROTEIN(query 350->569)
    3e-11  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    7e-09  39%  2d2eA  [x.x.x] SUFC PROTEIN(query 350->434)
    8e-08  26%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    5e-09  24%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1(query 348->584)
    6e-08  27%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN(query 369->570)
    7e-09  32%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 367->574)
    7e-09  32%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 367->574)
    1e-08  34%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN(query 368->580)
    1e-08  34%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN(query 368->580)
    4e-11  32%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 352->568)
    3e-08  30%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 367->574)
    1e-08  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING(query 365->577)
    2e-06  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN(query 328->579)
    2e-10  29%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->569)
    2e-10  29%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->569)
    6e-10  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->569)
    1e-05  28%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BINDING(query 368->574)
    1e-09  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->569)
    2e-09  30%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->569)
    1e-04  26%  1yqtA  [x.x.x] RNASE L INHIBITOR(query 375->558)
    4e-06  25%  1ji0A  [c.37.1] ABC TRANSPORTER(query 368->447)
    2e-05  19%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER(query 350->547)
    8e-08  36%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->574)
    4e-07  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 483->580)
    4e-07  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 483->580)
    4e-07  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 483->580)
    4e-07  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 483->580)
    4e-07  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 483->580)
    9e-04  28%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 972->1067)
    4e-04  29%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 972->1063)
:1228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGIL
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ------ERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAY
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDA
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           --------------------------------------------------------------------EG
3g5uA           --------------------------------------------------------------------EG
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           -------------------------------------------------------------EGVKTKQKA
2iwhB           -------------------------------------------------------------EGVKTKQKA
2ihyA           ----------------------------------------------------------------------
2ix8A           -------------------------------------------------------------EGVKTKQKA
2iw3B           -------------------------------------------------------------EGVKTKQKA
2iw3A           -------------------------------------------------------------EGVKTKQKA
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ---------------------------------------------------------------------A
2awnD           ---------------------------------------------------------------------A
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           LASGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDYDIKN-GVGAQPIEIKQG
1pf4A           --------------------------------------------------------------------NG
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ---------------------------------------------------------------------A
2awoA           ---------------------------------------------------------------------A
2awnB           ---------------------------------------------------------------------A
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ---------------------------------------------------------------------A
2r6gA           ---------------------------------------------------------------------A
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ---------------------------------------------------------------------A
2d2fA           ---------------------------------------------------------------------S
2awoC           ---------------------------------------------------------------------A
2d2eA           ---------------------------------------------------------------------S
2bbsA           ----------------------------------------------------------------------
3gfoA           -------------------------------------------------------------------EDY
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           -----------------------------------------------KLSERVDVERETLVEYPRLVKDY
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ---------------------------------------------------------------------S
2awnA           ---------------------------------------------------------------------A
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           NVQFSGVVFNYPTRPSPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
3g5uA           NVQFSGVVFNYPTRPSPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           IVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iwhB           IVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2ihyA           ----------------------------------------------------------------------
2ix8A           IVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iw3B           IVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iw3A           IVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2r6fB           ---------------EHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEV---------------------
2r6fA           ---------------EHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEV---------------------
2awoD           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG-------
2awnD           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG-------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ------ITLSGKGYERFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPY-SGNIFINGMEVRKI
1xexB           ----------------------------------------------------------------------
2hydA           RIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDF
1pf4A           EVDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
3b60A           -LEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2ghiA           NIEFSDVNFSYPKQTNHTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKY
2ff7A           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ffbA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3b5jA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
1mt0A           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ffaA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2fgkA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
1xefA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
1mv5D           -LSARHVDFAY-DDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
1mv5A           -LSARHVDFAY-DDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
2ghiB           NIEFSDVNFSYPKQTNHTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKY
2ghiC           NIEFSDVNFSYPKQTNHTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKY
1z2rA           AAEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2ghiD           NIEFSDVNFSYHR----TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKY
2ixfC           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixfA           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixeA           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
1jj7A           -VQFQDVSFAYPNRPDVVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQY
2ixfD           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixgA           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixeD           -VKFQDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2cbzA           SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAI--------
2it1B           -----------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
2it1A           -----------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
3d31A           -----------------SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
1q12A           -VQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2pzgA           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2pzeB           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2pzeA           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
3fh6A           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awoA           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awnB           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2pzfA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2oukB           ------------------LKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXN-LKAKDT
2oljA           ------------------LKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXN-LKAKDT
2r6gB           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2r6gA           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1g6hA           -----------------ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1xmiE           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1xmiC           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1xmiA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2pzfB           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2yz2B           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE--RKK
2yz2A           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE--RKK
1gajA           -----------------ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1g9xA           -----------------ALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1r10A           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0zD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0zC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0zB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0zA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0xD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0xC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0xB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0xA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0wC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0wB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1r0wA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1q3hD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1q3hC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1q3hB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1q3hA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1xf9D           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1xf9C           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1xf9B           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1xf9A           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
1xfaA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-
2yyzA           -----------------AVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDI
2bboA           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1xmjA           -VVMENVTAFWET---PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1l2tB           -IKLKNVTKTYKMGEEIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
1l2tA           -IKLKNVTKTYKMGEEIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
2bbtA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2bbsB           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1xmiD           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
3dhwC           -----------------ALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
2pzgB           -VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1b0uA           ------------------LKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLV
2bbtB           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
1g291           -----------------AVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGGIFVPPK
2awnC           SVQLQNVTVS---------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL------------------
2d2fA           QLEIRDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILEL
2awoC           SVQLQNVTVS---------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2d2eA           QLEIRDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILEL
2bbsA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
3gfoA           ILKVEELNYNYSDGTH-ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNIDYSRK
2pcjA           ------------------LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYT
3fvqB           ----------------PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIKNT
3fvqA           ----------------PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIKNT
1z47B           -----------------SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
1z47A           -----------------SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
1f3oA           -IKLKNVTKTYKEEIIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDL
1xmiB           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-
2onkA           --------------AEKRLGNFRLNVDGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPL
3bk7A           G--------SFKLEVEPG------EIRKGEVIGIVGPNGIGKTTFVKMLA---------------GVEEP
2zu0C           -LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLAL
2d3wA           -LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLAL
2d3wB           -LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLAL
1v43A           -----------------AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYL
2d3wD           -LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLAL
2d3wC           -LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLAL
1yqtA           ------------------------EIKKGEVIGIVGPNGIGKTTFVKLAG----------------VEEP
1ji0A           -----------------AIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1sgwA           KLEIRDLSVGYD---KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI---
2awnA           SVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHL
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           NVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIFIDSLPDKYNTRVGDKGTQL
3g5uA           NVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIFIDSLPDKYNTRVGDKGTQL
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           LTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKL
1pf4A           KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSL
3b60A           TLASLRNQVALVSQNVHLFNDTVANNIAYAREEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLL
2ghiA           NRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKL
2ff7A           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
2ffbA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
3b5jA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
1mt0A           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
2ffaA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
2fgkA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
1xefA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
1mv5D           SLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARFVENMPDQLNTEVGERGVKI
1mv5A           SLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARFVENMPDQLNTEVGERGVKI
2ghiB           NRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK-MKL
2ghiC           NRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATEEVIKATKSAQLYD-FIEALPKKWDTIVG--GMKL
1z2rA           TLASLRNQVALVSQNVHLFNDTVANNIAYAREEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLL
2ghiD           NRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIV------L
2ixfC           DHHYLHTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQL
2ixfA           DHHYLHTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQL
2ixeA           DHHYLHTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQL
1jj7A           EHRYLHRQVAAVGQEPQVFGRSLQENIAYGTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQL
2ixfD           DHHYLHTQVAAVGQ--LLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQL
2ixgA           DHHYLHTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQL
2ixeD           DHHYLHTQVAAV--GPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDT-----EVQL
2cbzA           -----KGSVAYVPQQAWIQNDSLRENILFGCQ-LEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNL
2it1B           PPKD--RNVGLVFQNWALYHMTVYKNIRKAPREEIDKKVREVAKMLHIDKLLNRYPW-----------QL
2it1A           PPKD--RNVGLVFQNWALYHMTVYKNIRKAPREEIDKKVREVAKMLHIDKLLNRYPW-----------QL
3d31A           SPEK--HDIAFVYQNYSLFHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLT--------L
1q12A           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2pzgA           GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
2pzeB           GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
2pzeA           GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
3fh6A           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2awoA           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2awnB           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2pzfA           GKIKHSGRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
2oukB           NLNKVREEVGMVFQRFNLFPHTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKHAYPD-------SL
2oljA           NLNKVREEVGMVFQRFNLFPHTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKHAYPD-------SL
2r6gB           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2r6gA           PPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
1g6hA           EPAELYHGIVRTFQTPQPLKETVLENLLIGEPGWIPKEEEMVEKAFKILEFLK-LSHLYDRKAG----EL
1xmiE           GKIKHSGRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
1xmiC           GKIKHSGRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
1xmiA           GKIKHSGRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
2pzfB           GKIKHSGRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
2yz2B           GY-EIRRNIGIAFQEDQFFAERVVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPF-----------FL
2yz2A           GY-EIRRNIGIAFQEDQFFAERVVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPF-----------FL
1gajA           EPAELYHGIVRTFQTPQPLKETVLENLLIGNPGWIPKEEEMVEKAFKILEFLK-LSHLYDRKAG----EL
1g9xA           EPAELYHGIVRTFQTPQPLKETVLENLLIGNPGWIPKEEEMVEKAFKILEFLK-LSHLYDRKAG----EL
1r10A           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0zD           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0zC           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0zB           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0zA           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0xD           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0xC           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0xB           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0xA           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0wC           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0wB           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1r0wA           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1q3hD           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1q3hC           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1q3hB           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1q3hA           GIIKHSGRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1xf9D           GIIKHSGRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1xf9C           GIIKHSGRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1xf9B           GIIKHSGRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1xf9A           GIIKHSGRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
1xfaA           GIIKHSGRVSFCSQFSWIMPGTIKENIIRG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTL
2yyzA           --PPKYREVGMVFQNYALYHMTVFENIARARRISKDEVEKRVVEIARKLLIDN--------LLDRKPTQL
2bboA           GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
1xmjA           GKIKHSGRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITL
1l2tB           DDDELRDKIGFVFQQFNLYRGAMSGEERRKR------ALECLKMAELEERFANHKPN-----------QL
1l2tA           DDDELRDKIGFVFQQFNLYRGAMSGEERRKR------ALECLKMAELEERFANHKPN-----------QL
2bbtA           GKIKHSGRISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG--GITL
2bbsB           GKIKHSGRISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG--GITL
1xmiD           GKIKHSGRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--ITL
3dhwC           SESELTKAIGMIFQHFNLLSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDKHDSYPSNL
2pzgB           GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG---ITL
1b0uA           RDKDLRTRLTMVFQHFNLWSHTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDE---RAQGKYPVHL
2bbtB           GKIKHSGRISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG---ITL
1g291           DRD-----IAMVFQSYALYHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELL-----GLTELLNRKPREL
2awnC           -------GVGMVFQSYALYPHSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2d2fA           SPDEARKGLFLAFQPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDESYLSRYLNEG--F
2awoC           PPAE--RGVGMVALYPHL---SVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ-----LAHLLDRKPKAL
2d2eA           SPDEARKGLFLAFQ--------------------------------------------------------
2bbsA           GKIKHSGRISFCSQNSWIMPGTIKENI------IGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITL
3gfoA           GIMKLRESIGIVFQDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVD------NALKRTGIEHLKDKPTHL
2pcjA           NEKELSRKLGFVFQFHYLIPELTAENVKMGKPKKEAKERGEYLLSEL----------GLGDKLSRKPYEL
3fvqB           NLPVRERRLGYLVQEGVLFPHTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELAGRYPHEL
3fvqA           NLPVRERRLGYLVQEGVLFPHTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELAGRYPHEL
1z47B           PPQK--RNVGLVFQNYALFQHTVYDNVSFGLREKRVPKDEMDARVRELLRFMNRFPH-----------EL
1z47A           PPQK--RNVGLVFQNYALFQHTVYDNVSFGLREKRVPKDEMDARVRELLRFMNRFPH-----------EL
1f3oA           DDDELRDKIGFVFQQFNLIPLLTAENVERGASGERRKRALECLKAELEERFANHKPN-----------QL
1xmiB           GKIKHSGRISFCSQFSWIMPGTIKENIIAG---------------------VSYDEYRYRSVIKACQLEL
2onkA           PPER--RGIGFVPQDYALFPHSVYRNIAYGLXXXXXXXXXXXXXXMAEKL-------GIAHLLDRKPARL
3bk7A           TEGKVEWDLTVAYKPQYIKAETVYELLSKIDSSKLNSNFYKTELLK---------PLGIIDLYDRNVEDL
2zu0C           SPEDRAGGIFMAFQVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLT--RSVNVGF
2d3wA           SPEDRAGGIFMAFQVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLT--RSVNVGF
2d3wB           SPEDRAGGIFMAFQVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLT--RSVNVGF
1v43A           PPKD--RNISMVFQHMTVY-ENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYP-----------AQL
2d3wD           SPEDRAGGIFMAFQVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLT--RSVNVGF
2d3wC           SPEDRAGGIFMAFQVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLT--RSVNVGF
1yqtA           TEGKIEWDLTVAYKPQYIYEGTVYELLSKIDASKLNSNFYKTELLK---------PLGIIDLYDREVNEL
1ji0A           PAHVINRGIALVPEGRRIFPETVYENL-------------------------------------------
1sgwA           --TKVKGKIFFLPEEIIVPRKISVEDYLKA-------VASLYGVKVNKNEIMDALESVEVLDLKKKLGEL
2awnA           PPAE--RGVGMVFQSYALRVNQVAEVLAIGR-----------------------------TLVAEPSVFL
2vf8B           --------------------------------------------------------------LGQPATEL
2vf8A           --------------------------------------------------------------LGQPATEL
2vf7C           --------------------------------------------------------------LGQPATEL
2vf7B           --------------------------------------------------------------LGQPATEL
2vf7A           --------------------------------------------------------------LGQPATEL
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVL
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           SGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVI
3g5uA           SGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVI
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           SGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVI
1pf4A           SGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVV
3b60A           SXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXX
2ghiA           SGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILL
2ff7A           SGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVM
2ffbA           SGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVM
3b5jA           SGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVM
1mt0A           SGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVM
2ffaA           SGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVM
2fgkA           SGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVM
1xefA           SGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVM
1mv5D           SGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFI
1mv5A           SGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFI
2ghiB           SGGERQRIAIARCLLKDPKIVIFDEAT--SDSKTEYLFQKAVEDLRKNRTLIIIAHR--TISSAESIILL
2ghiC           --GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILL
1z2rA           SXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXX
2ghiD           SGGERQRIAIARCLLKDPKIVIFD------DSKTEYLFQKAVED---NRTLIIIAHRLSTISSAESIILL
2ixfC           SGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESWASRTVLLITHQLSLAERAHHILFL
2ixfA           SGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESWASRTVLLITHQLSLAERAHHILFL
2ixeA           SGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESWASRTVLLITQQLSLAERAHHILFL
1jj7A           SGGQRQAVALARALIRKPCVLILDDATSALDANSEQLLYESPERY--SRSVLLITQHLSLVEQADHILFL
2ixfD           SGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESWASRTVLLITHQLSLAERAHHILFL
2ixgA           AVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESWASRTVLLITQQLSLAERAHHILFL
2ixeD           SGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESWASRTVLLITQQLSLAERAHHILFL
2cbzA           SGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHGKHIFENVIKGMLKNKTRILVTHSMSYLPQVDVIIVM
2it1B           SGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQLGITTVYVTHQAEALAMADRIAVI
2it1A           SGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQLGITTVYVTHQAEALAMADRIAVI
3d31A           SGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNTVLHITHQTEARIMADRIAVV
1q12A           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2pzgA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2pzeB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2pzeA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
3fh6A           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2awoA           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2awnB           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2pzfA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2oukB           SGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAEGMTMVVVTHEMGFAVG-DRVLFM
2oljA           SGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAEGMTMVVVTHEMGFAVG-DRVLFM
2r6gB           SGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2r6gA           SGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
1g6hA           SGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHIFNHVLELKAKGITFLIIEHRLDIVLNIDHLYVM
1xmiE           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1xmiC           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1xmiA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2pzfB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2yz2B           SGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTGKTVILISHDIETVINVDRVVVL
2yz2A           SGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTGKTVILISHDIETVINVDRVVVL
1gajA           SGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHIFNHVLELKAKGITFLIIEHRLDIVLNIDHLYVM
1g9xA           SGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHIFNHVLELKAKGITFLIIEHRLDIVLNIDHLYVM
1r10A           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0zD           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0zC           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0zB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0zA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0xD           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0xC           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0xB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0xA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0wC           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0wB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1r0wA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1q3hD           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1q3hC           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1q3hB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1q3hA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1xf9D           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1xf9C           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1xf9B           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1xf9A           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
1xfaA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL
2yyzA           SGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQLGITSVYVTHQAEAMTMASRIAVF
2bboA           SEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1xmjA           SEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1l2tB           SGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEGKTVVVVTHDINVARFGERIIYL
1l2tA           SGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEGKTVVVVTHDINVARFGERIIYL
2bbtA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2bbsB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1xmiD           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
3dhwC           SGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDIRLGLTILLITHEMDVVKRCDCVAVI
2pzgB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1b0uA           SGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSSHVIFL
2bbtB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1g291           SGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQLGVTTIYVTHQVEAMTMGDRIAVM
2awnC           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2d2fA           SGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGGALVITHYQRILNYIQPDKVHVM
2awoC           SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLRLGRTMIYVTHQVEAMTLADKIVVL
2d2eA           ----------------------------------------------------------------------
2bbsA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
3gfoA           SFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKEMQKELGXXXXXXXXXXXXVPLYCDNVFVM
2pcjA           SGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTIVMVTHERELAELTHRTLEM
3fvqB           SGGXXXXXXXXXXXXPDPELILLDEPFSALD---EQLRRQIREDMIAGKSAVFVSHREEALQYADRIAVM
3fvqA           SGGXXXXXXXXXXXXPDPELILLDEPFSALD---EQLRRQIREDMIAGKSAVFVSHREEALQYADRIAVM
1z47B           SGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVEMGVTSVFVTHQEEALEVADRVLVL
1z47A           SGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVEMGVTSVFVTHQEEALEVADRVLVL
1f3oA           SGGQQQRVAIARALANNPPIILADEPTGALDSEKIQLLKKLNEE--DGKTVVVVTHDINVARFGERIIYL
1xmiB           SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
2onkA           SGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMERFVQREFDVPILHVTHDLEAAMLADEVAVM
3bk7A           SGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEEKTALVVEHDVLMIYVSDRLIVF
2zu0C           SGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKSFIIVTHRILDYIKPDYVHVL
2d3wA           SGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKSFIIVTHRILDYIKPDYVHVL
2d3wB           SGGEKKRNDILQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRIIVTHYRILDYIKPDYVHVL
1v43A           SGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQLKVTTIYVTHQVEAMTMGDRIAVM
2d3wD           SGGEKKRNDILQMAVLEPELCILDESDGL-DIDALKVVADGVNSLRDGKSFIIVTHRILDYIKPDYVHVL
2d3wC           SGGEKKRNDILQMAVLEPELCILDES---DDIDALKVVADGVNSLRDGKSFIIVTHRILDYIKPDYVHVL
1yqtA           SGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNKTALVVEHDVLIDYVSDRLV--
1ji0A           ----------------------------------------------------------------------
1sgwA           SQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR-------------
2awnA           ---------------LDEPLSNLDAALRV---QMRIEISRLHKRL--GRTMIYVTHQVEAMTLADKIVVL
2vf8B           SGGEAQRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVAGNTVIAVEHKMQVVAASDWVLDI
2vf8A           SGGEAQRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVAGNTVIAVEHKMQVVAASDWVLDI
2vf7C           SGGEAQRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVAGNTVIAVEHKMQVVAASDWVLDI
2vf7B           SGGEAQRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVAGNTVIAVEHKMQVVAASDWVLDI
2vf7A           SGGEAQRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVAGNTVIAVEHKMQVVAASDWVLDI
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DGGRKVEEGTHQELLAASGTYAKMWRQYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           QNGKVKEHGTHQQLLAQKGIYFSM----------------------------------------------
3g5uA           QNGKVKEHGTHQQLLAQKGIYFSM----------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ENGHIVETGTHRELIAKQGAYEHLY---------------------------------------------
1pf4A           DEGEIIERGRHAD---------------------------------------------------------
3b60A           XXXXXXXRGTHSELLAQHGVYAQL----------------------------------------------
2ghiA           NKGKIVEKGTHKDLLKLNGEYAEMW---------------------------------------------
2ff7A           EKGKIVEQGKHK----------------------------------------------------------
2ffbA           EKGKIVEQGKHK----------------------------------------------------------
3b5jA           EKGKIVEQGKHK----------------------------------------------------------
1mt0A           EKGKIVEQGKHK----------------------------------------------------------
2ffaA           EKGKIVEQGKHK----------------------------------------------------------
2fgkA           EKGKIVEQGKHK----------------------------------------------------------
1xefA           EKGKIVEQGKHK----------------------------------------------------------
1mv5D           EKGQITGSGKHNELVATHPLYAK-----------------------------------------------
1mv5A           EKGQITGSGKHNELVATHPLYAK-----------------------------------------------
2ghiB           NKGKIVEKGTHKDLLKLNGEYAEMW---------------------------------------------
2ghiC           NKGKIVEKGTHKDLLKLNGEYAEMW---------------------------------------------
1z2rA           XXXXXXXRGTH-----------------------------------------------------------
2ghiD           NKGKIVEKGTHKDLLKLNGEYAEMW---------------------------------------------
2ixfC           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
2ixfA           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
2ixeA           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
1jj7A           EGGAIREGGTHQQLMEKKGCYWAM----------------------------------------------
2ixfD           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
2ixgA           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
2ixeD           KEGSVCEQGTHLQLMERGGCYRSM----------------------------------------------
2cbzA           SGGKISEMGSYQELLARDGAFAEFLRTY------------------------------------------
2it1B           REGEILQVGTPDEV--------------------------------------------------------
2it1A           REGEILQVGTPDEV--------------------------------------------------------
3d31A           MDGKLIQVGKPEEI--------------------------------------------------------
1q12A           DAGRVAQVGKPLEL--------------------------------------------------------
2pzgA           HEGSSYFYGTFSEL--------------------------------------------------------
2pzeB           HEGSSYFYGTFSEL--------------------------------------------------------
2pzeA           HEGSSYFYGTFSEL--------------------------------------------------------
3fh6A           DAGRVAQVGKPLEL--------------------------------------------------------
2awoA           DAGRVAQVGKPLEL--------------------------------------------------------
2awnB           DAGRVAQVGKPLEL--------------------------------------------------------
2pzfA           HEGSSYFYGTFSEL--------------------------------------------------------
2oukB           DGGYIIEEGKPEDL--------------------------------------------------------
2oljA           DGGYIIEEGKPEDL--------------------------------------------------------
2r6gB           DAGRVAQVGKPLEL--------------------------------------------------------
2r6gA           DAGRVAQVGKPLEL--------------------------------------------------------
1g6hA           FNGQIIAEGRGEE---------------------------------------------------------
1xmiE           HEGSSYFYGTFSEL--------------------------------------------------------
1xmiC           HEGSSYFYGTFSEL--------------------------------------------------------
1xmiA           HEGSSYFYGTFSEL--------------------------------------------------------
2pzfB           HEGSSYFYGTFSEL--------------------------------------------------------
2yz2B           EKGKKVFDGTRMEFL-------------------------------------------------------
2yz2A           EKGKKVFDGTRMEFL-------------------------------------------------------
1gajA           FNGQIIAEGRGEE---------------------------------------------------------
1g9xA           FNGQIIAEGRGEE---------------------------------------------------------
1r10A           HQGSSYFYGTFSEL--------------------------------------------------------
1r0zD           HQGSSYFYGTFSEL--------------------------------------------------------
1r0zC           HQGSSYFYGTFSEL--------------------------------------------------------
1r0zB           HQGSSYFYGTFSEL--------------------------------------------------------
1r0zA           HQGSSYFYGTFSEL--------------------------------------------------------
1r0xD           HQGSSYFYGTFSEL--------------------------------------------------------
1r0xC           HQGSSYFYGTFSEL--------------------------------------------------------
1r0xB           HQGSSYFYGTFSEL--------------------------------------------------------
1r0xA           HQGSSYFYGTFSEL--------------------------------------------------------
1r0wC           HQGSSYFYGTFSEL--------------------------------------------------------
1r0wB           HQGSSYFYGTFSEL--------------------------------------------------------
1r0wA           HQGSSYFYGTFSEL--------------------------------------------------------
1q3hD           HQGSSYFYGTFSEL--------------------------------------------------------
1q3hC           HQGSSYFYGTFSEL--------------------------------------------------------
1q3hB           HQGSSYFYGTFSEL--------------------------------------------------------
1q3hA           HQGSSYFYGTFSEL--------------------------------------------------------
1xf9D           HQGSSYFYGTFSEL--------------------------------------------------------
1xf9C           HQGSSYFYGTFSEL--------------------------------------------------------
1xf9B           HQGSSYFYGTFSEL--------------------------------------------------------
1xf9A           HQGSSYFYGTFSEL--------------------------------------------------------
1xfaA           HQGSSYFYGTFSEL--------------------------------------------------------
2yyzA           NQGKLVQYGTPDEV--------------------------------------------------------
2bboA           HEGSSYFYGTFSEL--------------------------------------------------------
1xmjA           HEGSSYFYGTFSEL--------------------------------------------------------
1l2tB           KDGEVERE--------------------------------------------------------------
1l2tA           KDGEVERE--------------------------------------------------------------
2bbtA           HEGSSYFYGTFSEL--------------------------------------------------------
2bbsB           HEGSSYFYGTFSEL--------------------------------------------------------
1xmiD           HEGSSYFYGTFSEL--------------------------------------------------------
3dhwC           SNGELIEQDTVSEVFS------------------------------------------------------
2pzgB           HEGSSYFYGTFSEL--------------------------------------------------------
1b0uA           HQGKIEEEGDPEQV--------------------------------------------------------
2bbtB           HEGSSYFYGTFSEL--------------------------------------------------------
1g291           NRGVLQQVGSPDEV--------------------------------------------------------
2awnC           DAGRVAQVGKPLEL--------------------------------------------------------
2d2fA           MDGRVVATG-------------------------------------------------------------
2awoC           DAGRVAQVGKPLEL--------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           HEGSSYFYGTFSEL--------------------------------------------------------
3gfoA           KEGRVILQGNPKEVFAEKEVIRKV----------------------------------------------
2pcjA           KDGKVVGEIT------------------------------------------------------------
3fvqB           KQGRILQTASPHEL--------------------------------------------------------
3fvqA           KQGRILQTASPHEL--------------------------------------------------------
1z47B           HEGNVEQFGTPEEVYEKPGT--------------------------------------------------
1z47A           HEGNVEQFGTPEEVYEKPGT--------------------------------------------------
1f3oA           KDGEVERE--------------------------------------------------------------
1xmiB           HEGSSYFYGTFSEL--------------------------------------------------------
2onkA           LNGRIVEKGKLKELFSA-----------------------------------------------------
3bk7A           EG----EPGRHGRALPPMG---------------------------------------------------
2zu0C           YQGRIVKSG-------------------------------------------------------------
2d3wA           YQGRIVKSG-------------------------------------------------------------
2d3wB           YQGRIVKSG-------------------------------------------------------------
1v43A           NRGQLLQIGSPTEV--------------------------------------------------------
2d3wD           YQGRIVKSG-------------------------------------------------------------
2d3wC           YQGRIVKSG-------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           DAGRVAQVGKPLEL--------------------------------------------------------
2vf8B           DGGRLVAQGTPAEVAQAAGS--------------------------------------------------
2vf8A           DGGRLVAQGTPAEVAQAAGS--------------------------------------------------
2vf7C           DGGRLVAQGTPAEVAQAAGS--------------------------------------------------
2vf7B           DGGRLVAQGTPAEVAQAAGS--------------------------------------------------
2vf7A           DGGRLVAQGTPAEVAQAAGS--------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AVGLAGMVVVFVASRNDYKKTYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESM
2hydA           AIGIALFIFVIVRPPIEFIRQYLAQWTSNKDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDF
1pf4A           --------LMFVRGLSGFASSYCLSWVSGNVVRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGA
3g60A           --------------------------------------------IGWFDVHDVGELNTRLTDDVSKINEG
3g5uA           --------------------------------------------IGWFDVHDVGELNTRLTDDVSKINEG
3b60A           --------------------------------RRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASS
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           --------------------------------RRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASS
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ
2hydA           ILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKL----TRERSQALAEVQ
1pf4A           TSRALVSIVREGASIIGLLTLMFWNSWQLSLVLIVVAP----VVAFAISFVSKRFRKISRNMQTAMGHRQ
3g60A           IGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPLSAGIWA---KILSSFTDKELHAYAKAGAVAE
3g5uA           IGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPLSAGIWA---KILSSFTDKELHAYAKAGAVAE
3b60A           SSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPISIAIRVVSKRFRSISKNMQNTMG-QVTTSAE
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           SSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPISIAIRVVSKRFRSISKNMQNT--MGQVTTSA
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGG
2hydA           GFLQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGS
1pf4A           QTMKLVS-----------AQSIADPVIQMIXXXXXXXXXXXXXXDSIRAELTPGT---------------
3g60A           EVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE
3g5uA           EVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE
3b60A           QMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLAL-------AFVLYAAS
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ERLQGMKMVSA--------SSISDPIIQL-------------IASLALAFVLYAASFPSVMDSLTAGT--
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           --LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVELLKDETVAPRFKIV---VEYIAAIGADLIDERI
2iwhB           --LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVELLKDETVAPRFKIV---VEYIAAIGADLIDERI
2ihyA           ----------------------------------------------------------------------
2ix8A           --LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVELLKDETVAPRFKIV---VEYIAAIGADLIDERI
2iw3B           --LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVELLKDETVAPRFKIV---VEYIAAIGADLIDERI
2iw3A           --LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVELLKDETVAPRFKIV---VEYIAAIGADLIDERI
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEARGSASADVPGHDLSFQGVRFG
2hydA           ITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDNGVGAQPIEIKQGRIDIDHVSFQ
1pf4A           --------FTVVFSAMFGPLKALTSVTSEFQRGMAACQTLFGLMDLETERGKYEAERVNGEVDVKDVTFT
3g60A           YSIQVLTVFFSVLIGAFGQASPNIEAFANARGAAYEVFKIKPSIDSFSKSGHKPDNIQGN-LEFKNIHFS
3g5uA           YSIQVLTVFFSVLIGAFGQASPNIEAFANARGAAYEVFKIKPSIDSFSKSGHKPDNIQGN-LEFKNIHFS
3b60A           FPSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRLFAILDSEQEKGKRVIDRATGDLEFRNVTFT
2ghiA           ----------------------------------------------------------GVNIEFSDVNFS
2ff7A           -----------------------------------------------------------HDITFRNIRFR
2ffbA           -----------------------------------------------------------HDITFRNIRFR
3b5jA           -----------------------------------------------------------HDITFRNIRFR
1mt0A           ------------------------------------------------------------DITFRNIRFR
2ffaA           -----------------------------------------------------------HDITFRNIRFR
2fgkA           ------------------------------------------------------------DITFRNIRFR
1xefA           ------------------------------------------------------------DITFRNIRFR
1mv5D           -------------------------------------------------------------LSARHVDFA
1mv5A           -------------------------------------------------------------LSARHVDFA
2ghiB           ----------------------------------------------------------GVNIEFSDVNFS
2ghiC           ----------------------------------------------------------GVNIEFSDVNFS
1z2rA           ------------ITVVFSSMIALMRPLKSLTNVNAQFQR-------------------GMAAEFRNVTFT
2ghiD           ----------------------------------------------------------GVNIEFSDVNFS
2ixfC           -------------------------------------------------------------VKFQDVSFA
2ixfA           -------------------------------------------------------------VKFQDVSFA
2ixeA           -------------------------------------------------------------VKFQDVSFA
1jj7A           -------------------------------------------------------------VQFQDVSFA
2ixfD           -------------------------------------------------------------VKFQDVSFA
2ixgA           -------------------------------------------------------------VKFQDVSFA
2ixeD           -------------------------------------------------------------VKFQDVSFA
2cbzA           ----------------------------------------------------------------------
2it1B           ------------------------------------------------------------EIKLENIVKK
2it1A           ------------------------------------------------------------EIKLENIVKK
3d31A           ----------------------------------------------------------------------
1q12A           -------------------------------------------------------------VQLQNVTKA
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           -------------------------------------------------------------VQLQNVTKA
2awoA           -------------------------------------------------------------VQLQNVTKA
2awnB           -------------------------------------------------------------VQLQNVTKA
2pzfA           ------------------------------------------------------------EVVMENVTAF
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           -------------------------------------------------------------VQLQNVTKA
2r6gA           -------------------------------------------------------------VQLQNVTKA
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ---------------------------------------------------------------FEKAKQN
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           -------------------------------------------------------------LKVEELNYN
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           -------------------------------------------------------------IEFVGVEKI
1z47A           -------------------------------------------------------------IEFVGVEKI
1f3oA           -------------------------------------------------------------IKLKNVTKT
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           -------------------------------------------------------------LSIKDLHVS
2d3wA           -------------------------------------------------------------LSIKDLHVS
2d3wB           -------------------------------------------------------------LSIKDLHVS
1v43A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wD           -------------------------------------------------------------LSIKDLHVS
1oxvA           --------------------------------------------------------------------FK
1oxsC           --------------------------------------------------------------------FK
2d3wC           -------------------------------------------------------------LSIKDLHVS
1yqtA           ----------------------------------------------------------------------
2nq2C           -------------------------------------------------------------LSVENLGFY
1ji0A           -------------------------------------------------------------LEVQSLHVY
1l7vC           ----------------------------------------------------------------------
2nq2D           -------------------------------------------------------------LSVENLGFY
1sgwA           -------------------------------------------------------------LEIRDLSVG
2qi9C           ----------------------------------------------------------------------
2awnA           -------------------------------------------------------------VQLQNVTKA
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ix3A           IDQQAWFTHIT----PYMTIFLHEKKAKDILDEFRK----RAVDNIPVGPNFDDEEDEGEDLCNCEFSLA
2iwhB           IDQQAWFTHIT----PYMTIFLHEKKAKDILDEFRK----RAVDNIPVGPNFDDEEDEGEDLCNCEFSLA
2ihyA           ----------------------------------------------------------------------
2ix8A           IDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGPNFDDEEDEGEDLCNCEFSLA
2iw3B           IDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGPNFDDEEDEGEDLCNCEFSLA
2iw3A           IDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGPNFDDEEDEGEDLCNCEFSLA
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           --------------------------------------------------------------------FK
2ihyB           ----------------------------------------------------------------------
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------------VQLQNVTKA
2awnD           -------------------------------------------------------------VQLQNVTKA


                         .         *         .         .         .         .         +:1050
query           YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIV
2hydA           YNDNEILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
1pf4A           YQGKEALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALV
3g60A           YPSRQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVV
3g5uA           YPSRQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVV
3b60A           YPGREVLRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALV
2ghiA           YPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIV
2ff7A           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
2ffbA           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
3b5jA           YKPDSILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
1mt0A           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
2ffaA           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
2fgkA           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
1xefA           YKPDSILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLA-LADPNWLRRVGVV
1mv5D           YDDEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFV
1mv5A           YDDEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFV
2ghiB           YPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIV
2ghiC           YPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIV
1z2rA           YPGREVLRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALV
2ghiD           Y--HRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIV
2ixfC           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV
2ixfA           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV
2ixeA           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV
1jj7A           YPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAV
2ixfD           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV
2ixgA           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV
2ixeD           YPNHQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHH--YLHTQVA
2cbzA           --DPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS-VAYVPQQAWIQN----
2it1B           FGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD--RNVGLV
2it1A           FGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD--RNVGLV
3d31A           ------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK--HDIAFV
1q12A           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2pzgA           -GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2pzeB           -GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2pzeA           -GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
3fh6A           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2awoA           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2awnB           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2pzfA           WGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2oukB           FGSLEVLKGINVHIREGEVVVVIGPSGSGKSTCLNLLEDFXXXXXXXXXXNLKNLNKVREE-----VGMV
2oljA           FGSLEVLKGINVHIREGEVVVVIGPSGSGKSTCLNLLEDFXXXXXXXXXXNLKNLNKVREE-----VGMV
2r6gB           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2r6gA           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
1g6hA           FGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KEPAELYHYGIV
1xmiE           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
1xmiC           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
1xmiA           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2pzfB           -GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2yz2B           --EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIR---RNIGIA
2yz2A           --EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIR---RNIGIA
1gajA           FGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KEPAELYHYGIV
1g9xA           FGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KEPAELYHYGIV
1r10A           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0zD           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0zC           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0zB           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0zA           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0xD           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0xC           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0xB           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0xA           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0wC           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0wB           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1r0wA           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1q3hD           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1q3hC           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1q3hB           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1q3hA           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1xf9D           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1xf9C           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1xf9B           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1xf9A           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
1xfaA           -----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI------
2yyzA           FGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFD--DVLVNDIPPKYREVGMV
2bboA           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
1xmjA           FWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
1l2tB           ------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKKIGFV
1l2tA           ------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKKIGFV
2bbtA           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI------
2bbsB           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI------
1xmiD           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
3dhwC           ----QALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKQIGMI
2pzgB           -GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
1b0uA           YGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNILKVADKNQLTRLTMV
2bbtB           NNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI------
1g291           FGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVRDIAMV
2awnC           ---------------EGEFVVFVGPSGCGKSTLLRMIAGL-------------------------GVGMV
2d2fA           ---ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILELSDERARKGLFLA
2awoC           ---------------EGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVAL
2d2eA           ---ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILELSDERARKGLFLA
2bbsA           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI------
3gfoA           YSDTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI-DYSRKGIMESIGIV
2pcjA           ----EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV-DYTNEKELSKLGFV
3fvqB           -----VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNLRRLGYL
3fvqA           -----VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNLRRLGYL
1z47B           YGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK--RNVGLV
1z47A           YGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK--RNVGLV
1f3oA           YKGEEIIYALKNVIKEGEFVS-IGPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDLDDDELTKKIGFV
1xmiB           -----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI------
2onkA           ---------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPER--RGIGFV
3bk7A           --------------RKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKV-------------EW-------
2zu0C           VEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPEDRAGEIFMA
2d3wA           VEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPEDRAGEIFMA
2d3wB           VEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPEDRAGEIFMA
1v43A           FGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKD--RNISMV
2d62A           FGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYIEDNLVADPEKGVFVPPKEAV
2d3wD           VEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPEDRAGEIFMA
1oxvA           KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEVASNGKLIVPPEDRK----IGMV
1oxsC           KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEVASNGKLIVPPEDRK----IGMV
2d3wC           VEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPEDRAGEIFMA
1yqtA           --------------KKGEVIGIVGPNGIGKTTFVKLAG-VEEPTEGKI-------------EW-------
2nq2C           YQAENFLQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI--EVYQSIGFVPQFFSSPFAYS
1ji0A           YGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRGIALV
1l7vC           --------------RAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYL
2nq2D           Y---QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI--EVYQSIGFVPQFFSSPFAYS
1sgwA           Y-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEII
2qi9C           --------------RAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYL
2awnA           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1vplA           -GKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHESYLPEEAGA
2ix3A           YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA------NGQV--DGFPTQEECRTVYVEHIDGT
2iwhB           YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA------NGQV--DGFPTQEECRTVYVEHIDGT
2ihyA           -----ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK--PGYSAETVRQHIGFV
2ix8A           YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA-------NGQV--DGFPTQEECRTVYVEHIDGT
2iw3B           YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA-------NGQV--DGFPTQEECRTVYVEHIDGT
2iw3A           YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA-------NGQV--DGFPTQEECRTVYVEHIDGT
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEVASNGKLIVPPEDRK----IGMV
2ihyB           -----ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKGKVGYSAETVRQHIGFV
1xewY           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV
2awnD           WGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE--RGVGMV


                         .         .         .         .         *         .         .:1120
query           FQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIAR
2hydA           QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIAR
1pf4A           SQNVHLFNDTIANNIAYAAEGETREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIAR
3g60A           SQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIAR
3g5uA           SQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIAR
3b60A           SQNVHLFNDTVANNIAYAREEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXX
2ghiA           PQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIAR
2ff7A           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
2ffbA           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
3b5jA           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
1mt0A           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
2ffaA           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
2fgkA           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
1xefA           LQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIAR
1mv5D           SQDSAIMAGTIRENLTYGLEGDTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIAR
1mv5A           SQDSAIMAGTIRENLTYGLEGDTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIAR
2ghiB           PQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVG-NKMKLSGGERQRIAIAR
2ghiC           PQDTILFNETIKYNILYGKLDAT-EEVIKATKSAQLYDFIEALPKKWDTIVG----GMKLGERQRIAIAR
1z2rA           SQNVHLFNDTVANNIAYAREEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXX
2ghiD           PQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIV------LSGGERQRIAIAR
2ixfC           GQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALAR
2ixfA           GQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALAR
2ixeA           GQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALAR
1jj7A           GQEPQVFGRSLQENIAYGTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALAR
2ixfD           GQ--LLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALAR
2ixgA           GQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALAR
2ixeD           AVGPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEV-----QLSGGQRQAVALAR
2cbzA           --------DSLRENILFGCQ-LEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
2it1B           FQNWALYPHTVYKNIRKAPREEIDKKVREVAKMLHIDKLLNRYPW-----------QLSGGQQQRVAIAR
2it1A           FQNWALYPHTVYKNIRKAPREEIDKKVREVAKMLHIDKLLNRYPW-----------QLSGGQQQRVAIAR
3d31A           YQNYSLFPHNVKKNLEFGMRMKKIKDPKRVLDTARDLK-IEHL-------LDRNPLTLSGGEQQRVALAR
1q12A           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2pzgA           ------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
2pzeB           ------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
2pzeA           ------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
3fh6A           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2awoA           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2awnB           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2pzfA           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
2oukB           FQRFNLFPHTVLNNITLAKVRKWPREKAEAK----AMELLDKV--GLKDKAHAYPDSLSGGQAQRVAIAR
2oljA           FQRFNLFPHTVLNNITLAKVRKWPREKAEAK----AMELLDKV--GLKDKAHAYPDSLSGGQAQRVAIAR
2r6gB           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2r6gA           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
1g6hA           FQPQPLKEMTVLENLLIGEPGESEEEMVE--KAFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGR
1xmiE           ------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
1xmiC           ------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
1xmiA           ------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
2pzfB           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
2yz2B           FQEDQFFAERVFDEVAFAKNFYPDRDPVPLVKKA--MEFV---GLDFDSFKDRVPFFLSGGEKRRVAIAS
2yz2A           FQEDQFFAERVFDEVAFAKNFYPDRDPVPLVKKA--MEFV---GLDFDSFKDRVPFFLSGGEKRRVAIAS
1gajA           FQPQPLKEMTVLENLLIGNPGESEEEMVE--KAFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGR
1g9xA           FQPQPLKEMTVLENLLIGNPGESEEEMVE--KAFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGR
1r10A           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0zD           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0zC           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0zB           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0zA           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0xD           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0xC           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0xB           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0xA           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0wC           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0wB           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1r0wA           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1q3hD           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1q3hC           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1q3hB           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1q3hA           ------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1xf9D           ------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1xf9C           ------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1xf9B           ------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1xf9A           ------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1xfaA           ------MPGTIKENIIRG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
2yyzA           FQNYALYPHTVFENIAFARRISKDEVEKRVVEIARKLL--------IDNLLDRKPTQLSGGQQQRVALAR
2bboA           ------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLAR
1xmjA           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLAR
1l2tB           FQQFNLIPLTALENVELPRGAMSGEE--RRKRALECLKMAE-LEERF---ANHKPNQLSGGQQQRVAIAR
1l2tA           FQQFNLIPLTALENVELPRGAMSGEE--RRKRALECLKMAE-LEERF---ANHKPNQLSGGQQQRVAIAR
2bbtA           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLG--GITLSGGQRARISLAR
2bbsB           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLG--GITLSGGQRARISLAR
1xmiD           ------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--ITLSGGQRARISLAR
3dhwC           FQHFNLLSSTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDKHDSYPSNLSGGQKQRVAIAR
2pzgB           ------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG---ITLSGGQRARISLAR
1b0uA           FQHFNLWSHTVLENVMIQVLGLSKHDARERA-----LKYLAKV--GIDEAQGKYPVHLSGGQQQRVSIAR
2bbtB           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVLG---ITLSGGQRARISLAR
1g291           FQSYALYPHTVYDNIKVPRQ-EIDQRVREVAELLGLTELLNRKPR-----------ELSGGQRQRVALGR
2awnC           FQSYALYPHSVAENMSFGLKGAKKEQVAEVLQLAHLL---DRKPK-----------ALSGGQRQRVAIGR
2d2fA           FQPVEVPGVTIANFLRLALQAKLGREVGVATKVKKALELLDWDESYLSRYLNE---GFSGGEKKRNEILQ
2awoC           YPHL-----SVAENMSFGLKGAKKEQVAEVLQLAHLLD---RKPK-----------ALSGGQRQRVAIGR
2d2eA           FQYPVVPGVTIANFLRLALQAKLGREVGVATKVKKALELLDWDESYLSRYLNE-------GEKKRNEILQ
2bbsA           ------MPGTIKENII----GVSYDEYRSVIKACQLEEDISKFAEKDNIVL----ITLSGGQRARISLAR
3gfoA           FQDPQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALK-----RTGIEHLKDKPTHCLSFGQKKRVAIAG
2pcjA           FQELTALENVIVPMLKMGKPKKEAKE-----RGEYLLSEL-----GLGDKLSRKPYELSGGEQQRVAIAR
3fvqB           VQEGVLFPHTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-----TGISELAGRYPHELSGGXXXXXXXXX
3fvqA           VQEGVLFPHTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-----TGISELAGRYPHELSGGXXXXXXXXX
1z47B           FQNYALFQHTVYDNVSFGPKDEMDARVRELLRFMRLESYANRFPH-----------ELSGGXXXXXXXXX
1z47A           FQNYALFQHTVYDNVSFGPKDEMDARVRELLRFMRLESYANRFPH-----------ELSGGXXXXXXXXX
1f3oA           FQQFNLIPLTALENVELPLRGASGEE--RRKRALECLK--AELEERF---ANHKPNQLSGGQQQRVAIAR
1xmiB           ------MPGTIKENIIAG---VSYDEYRYRSVIKAC-----QLEEDISKIV----LTLSGGQRARISLAR
2onkA           PQDYALFPHSVYRNIAYGXXXXXXXXMAEKLGIAHLLD---RKP-----------ARLSGGERQRVALAR
3bk7A           -------DLTVAYKIKAEYEGTVYELLSKIDSSKLNSNFYKTKPLGIIDLYDRNVEDLSGGELQRVAIAA
2zu0C           FQYPVFFLQTALNAVRSGQETLDRFDFQDLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQ
2d3wA           FQYPVFFLQTALNAVRSGQETLDRFDFQDLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQ
2d3wB           FQYPVFFLQTALNAVRSGQETLDRFDFQDLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQ
1v43A           FQHMTVYEN-IAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYP-----------AQLSGGXXXXXXXXX
2d62A           FQSYALYPHTVYDNIALKLRKVPKQEIDKRVR--------EVAELGLTELLNRKPRELSGGQRQRVALGR
2d3wD           FQYPVFFLQTALNAVRSGQETLDRFDFQDLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQ
1oxvA           FQTWALYPNLTATNMKMSKEEIRKEEVAKILDIHHVLNHFPR--------------ELSGGQQQRVALAR
1oxsC           FQTWALYPNLTATNMKMSKEEIRKEEVAKILDIHHVLNHFPR--------------ELSGGQQQRVALAR
2d3wC           FQYPVFFLQTALNAVRSGQETLDRFDFQDLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQ
1yqtA           -------DLTVAYKIKADYEGTVYELLSKIDASKLNSNFYKTKPLGIIDLYDREVNELSGGELQRVAIAA
2nq2C           VLDIVLMGRSTHIN-TFAKPKSHDYQVAMQA-----LDYL-----NLTHLAKREFTSLSGGQRQLILIAR
1ji0A           PEGRRIFPETVYENL-----GAYNRKDKEGIK--RDLEWIFSLFPRLKERLKQLGGTLSGGE-QQLAIGR
1l7vC           SQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALAL----------DDKLGRSTNQLSGGEWQRVRLAA
2nq2D           VLDIVLMGRSTHIN-TFAKPKSHDYQVAMQA-----LDYL-----NLTHLAKREFTSLSGGQRQLILIAR
1sgwA           VPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKKKL------------GELSQGTIRRVQLAS
2qi9C           SQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALAL----------DDKLGRSTNQLSGGEWQRVRLAA
2awnA           FQSYAL----EVINQRVN-------QVAEV-----------------------------------LAIGR
2vf8B           --------------------------------------------------LGQPATELSGGEAQRIKLAT
2vf8A           --------------------------------------------------LGQPATELSGGEAQRIKLAT
2vf7C           --------------------------------------------------LGQPATELSGGEAQRIKLAT
2vf7B           --------------------------------------------------LGQPATELSGGEAQRIKLAT
2vf7A           --------------------------------------------------LGQPATELSGGEAQRIKLAT
1vplA           YRNMQ------------GIEYLRFVAGFYASSSSEIEEMVERATEGLGEKIKDRVSTYSKGMVRKLLIAR
2ix3A           HSDTSVLDFVFESGVGT-KEAIKDK----------LIEF------GFDEMIAMPISALSGGWKMKLALAR
2iwhB           HSDTSVLDFVFESGVGT-KEAIKDK----------LIEF------GFDEMIAMPISALSGGWKMKLALAR
2ihyA           SHSLLEKFQEGERVIDVVISGAIDDEIRNEAHQLLKLVGSAKAQQYI--------GYLSTGEKQRV-IAR
2ix8A           HSDTSVLDFVFESGVGT-KEAIKDK----------LIEF------GFTDEIAPISA-LSGGWK-KLALAR
2iw3B           HSDTSVLDFVFESGVGT-KEAIKDK----------LIEF------GFTDEIAPISA-LSGGWK-KLALAR
2iw3A           HSDTSVLDFVFESGVGT-KEAIKDK----------LIEF------GFTDEIAPISA-LSGGWK-KLALAR
2r6fB           --------------LEVTYKGKNIAEVLDTVEDA--LDFFASIPKGLGYKLGQPATTLSGGEAQRVKLAA
2r6fA           --------------LEVTYKGKNIAEVLDTVEDA--LDFFASIPKGLGYKLGQPATTLSGGEAQRVKLAA
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1oxxK           FQTWALYPNLTATNMKMSKEEIRKEEVAKILDIHHVLNHFPR--------------ELSGXXXXXXXXXX
2ihyB           FQEGERVIDVVISGASIGVYQDIDDEIRNEAHQLLKLVGSAKAQQYI--------GYLSTGEKQRV-IAR
1xewY           ---------------------------------------IEAKPAGKDVKRIE---AMSGGEKALTALAF
2pjzA           ----------------------------------------------------------------------
1xexB           ---------------------------------------IEAKPAGKDVKRIE---AMSGGEKALTALAF
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1xmiB           -------