[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55587.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "1ubgA.bssp"
#ERROR : Can't open dsspfile "2oe2A.bssp"
#ERROR : Can't open dsspfile "2oepA.bssp"
#ERROR : Can't open dsspfile "2ofoA.bssp"
#ERROR : Can't open dsspfile "1mo4A.bssp"
#ERROR : Can't open dsspfile "2zrnA.bssp"
#ERROR : Can't open dsspfile "2zriA.bssp"
#ERROR : Can't open dsspfile "2zroA.bssp"
#ERROR : Can't open dsspfile "2oesA.bssp"
#ERROR : Can't open dsspfile "2zr0A.bssp"
#ERROR : Can't open dsspfile "1u98A.bssp"
#ERROR : Can't open dsspfile "2zrfA.bssp"
#ERROR : Can't open dsspfile "2zrdA.bssp"
#ERROR : Can't open dsspfile "1mo5A.bssp"
#ERROR : Can't open dsspfile "2zrcA.bssp"
#ERROR : Can't open dsspfile "2zrhA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2zrmA.bssp"
#ERROR : Can't open dsspfile "2zreA.bssp"
#ERROR : Can't open dsspfile "2zrkA.bssp"
#ERROR : Can't open dsspfile "1u94A.bssp"
#ERROR : Can't open dsspfile "2zraA.bssp"
#ERROR : Can't open dsspfile "2odnA.bssp"
#ERROR : Can't open dsspfile "1u99A.bssp"
#ERROR : Can't open dsspfile "2rebA.bssp"
#ERROR : Can't open dsspfile "1mo3A.bssp"
#ERROR : Can't open dsspfile "2zrbA.bssp"
#ERROR : Can't open dsspfile "1g18A.bssp"
#ERROR : Can't open dsspfile "2zr7A.bssp"
#ERROR : Can't open dsspfile "1g19A.bssp"
#ERROR : Can't open dsspfile "2zrjA.bssp"
#ERROR : Can't open dsspfile "2zrlA.bssp"
#ERROR : Can't open dsspfile "2zr9A.bssp"
#ERROR : Can't open dsspfile "1mo6A.bssp"
#ERROR : Can't open dsspfile "1ubfA.bssp"
#ERROR : Can't open dsspfile "2g88A.bssp"
#ERROR : Can't open dsspfile "1xmsA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2odwA.bssp"
#ERROR : Can't open dsspfile "2zrgA.bssp"
#ERROR : Can't open dsspfile "1ubcA.bssp"
#ERROR : Can't open dsspfile "2zrpA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1xmvA.bssp"
#ERROR : Can't open dsspfile "1xp8A.bssp"
#ERROR : Can't open dsspfile "1aa3A.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1v5wA.bssp"
#ERROR : Can't open dsspfile "2zjbA.bssp"
#ERROR : Can't open dsspfile "2zudB.bssp"
#ERROR : Can't open dsspfile "2zudA.bssp"
#ERROR : Can't open dsspfile "2zucB.bssp"
#ERROR : Can't open dsspfile "2zucA.bssp"
#ERROR : Can't open dsspfile "2zubA.bssp"
#ERROR : Can't open dsspfile "2z43C.bssp"
#ERROR : Can't open dsspfile "2z43B.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2z43A.bssp"
#ERROR : Can't open dsspfile "1szpF.bssp"
#ERROR : Can't open dsspfile "1szpE.bssp"
#ERROR : Can't open dsspfile "1szpD.bssp"
#ERROR : Can't open dsspfile "1szpB.bssp"
#ERROR : Can't open dsspfile "1szpA.bssp"
#ERROR : Can't open dsspfile "2w0mA.bssp"
#ERROR : Can't open dsspfile "1pznG.bssp"
#ERROR : Can't open dsspfile "1pznB.bssp"
#ERROR : Can't open dsspfile "1pznA.bssp"

## Summary of PDB Search
:352
    6e-96  59%  3cmxA  [x.x.x] PROTEIN RECA
    6e-96  59%  3cmwC  [x.x.x] PROTEIN RECA
    6e-96  59%  3cmwA  [x.x.x] PROTEIN RECA
    6e-96  59%  3cmuA  [x.x.x] PROTEIN RECA
    6e-96  59%  3cmtD  [x.x.x] PROTEIN RECA
    5e-94  60%  3cmvA  [x.x.x] PROTEIN RECA
    3e-93  56%  1ubgA  [c.37.1 - d.48.1] RECA
    3e-93  56%  2oe2A  [x.x.x] PROTEIN RECA
    3e-91  56%  2oepA  [x.x.x] PROTEIN RECA
    2e-90  57%  2ofoA  [x.x.x] PROTEIN RECA
    1e-88  52%  1mo4A  [c.37.1 - d.48.1] RECA
    8e-86  55%  2zrnA  [x.x.x] PROTEIN RECA
    4e-85  55%  2zriA  [x.x.x] PROTEIN RECA
    5e-85  56%  2zroA  [x.x.x] PROTEIN RECA
    5e-85  55%  2oesA  [x.x.x] PROTEIN RECA
    9e-85  55%  2zr0A  [x.x.x] PROTEIN RECA
    1e-83  57%  1u98A  [c.37.1 - d.48.1] RECA PROTEIN
    2e-83  55%  2zrfA  [x.x.x] PROTEIN RECA
    3e-83  55%  2zrdA  [x.x.x] PROTEIN RECA
    3e-83  51%  1mo5A  [c.37.1 - d.48.1] RECA
    8e-83  55%  2zrcA  [x.x.x] PROTEIN RECA
    1e-82  55%  2zrhA  [x.x.x] PROTEIN RECA
    2e-82  59%  3cmvH  [x.x.x] PROTEIN RECA
    2e-82  59%  3cmvC  [x.x.x] PROTEIN RECA
    3e-82  55%  2zrmA  [x.x.x] PROTEIN RECA
    1e-81  55%  2zreA  [x.x.x] PROTEIN RECA
    2e-81  55%  2zrkA  [x.x.x] PROTEIN RECA
    6e-81  58%  1u94A  [c.37.1 - d.48.1] RECA PROTEIN
    2e-80  54%  2zraA  [x.x.x] PROTEIN RECA
    4e-80  54%  2odnA  [x.x.x] PROTEIN RECA
    2e-79  58%  1u99A  [c.37.1 - d.48.1] RECA PROTEIN
    2e-79  57%  2rebA  [x.x.x] REC A
    2e-79  51%  1mo3A  [c.37.1 - d.48.1] RECA
    9e-79  54%  2zrbA  [x.x.x] PROTEIN RECA
    9e-79  51%  1g18A  [c.37.1 - d.48.1] RECA PROTEIN
    2e-78  54%  2zr7A  [x.x.x] PROTEIN RECA
    2e-78  51%  1g19A  [c.37.1 - d.48.1] RECA PROTEIN
    2e-78  55%  2zrjA  [x.x.x] PROTEIN RECA
    8e-78  54%  2zrlA  [x.x.x] PROTEIN RECA
    8e-78  55%  2zr9A  [x.x.x] PROTEIN RECA
    8e-78  51%  1mo6A  [c.37.1 - d.48.1] RECA
    1e-77  55%  1ubfA  [c.37.1 - d.48.1] RECA
    4e-77  52%  2g88A  [x.x.x] PROTEIN RECA
    5e-77  57%  1xmsA  [c.37.1 - d.48.1] RECA PROTEIN
    5e-77  58%  3cmvG  [x.x.x] PROTEIN RECA
    5e-77  58%  3cmvE  [x.x.x] PROTEIN RECA
    7e-77  55%  2odwA  [x.x.x] PROTEIN RECA
    2e-76  55%  2zrgA  [x.x.x] PROTEIN RECA
    2e-76  54%  1ubcA  [c.37.1 - d.48.1] RECA
    3e-76  55%  2zrpA  [x.x.x] PROTEIN RECA
    3e-76  58%  3cmvB  [x.x.x] PROTEIN RECA
    2e-73  57%  1xmvA  [c.37.1 - d.48.1] RECA PROTEIN
    2e-70  58%  1xp8A  [c.37.1 - d.48.1] RECA PROTEIN
    6e-11  46%  1aa3A  [x.x.x] RECA
    8e-08  47%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-06  39%  1v5wA  [c.37.1] MEIOTIC RECOMBINATION PROTEIN DMC1/LIM15 HOMOLOG
    2e-06  39%  2zjbA  [x.x.x] MEIOTIC RECOMBINATION PROTEIN DMC1/LIM15 HOMOLOG
    1e-05  33%  2zudB  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2zudA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2zucB  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2zucA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2zubA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2z43C  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2z43B  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05  33%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-05  36%  2z43A  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-05  43%  1szpF  [a.60.4 - c.37.1] DNA REPAIR PROTEIN RAD51
    4e-05  43%  1szpE  [a.60.4 - c.37.1] DNA REPAIR PROTEIN RAD51
    4e-05  43%  1szpD  [a.60.4 - c.37.1] DNA REPAIR PROTEIN RAD51
    4e-05  43%  1szpB  [a.60.4 - c.37.1] DNA REPAIR PROTEIN RAD51
    4e-05  43%  1szpA  [a.60.4 - c.37.1] DNA REPAIR PROTEIN RAD51
    3e-04  30%  2w0mA  [x.x.x] SSO2452
    4e-04  45%  1pznG  [c.37.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51
    4e-04  45%  1pznB  [c.37.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51
    4e-04  45%  1pznA  [a.60.4 - c.37.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51
:352

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
3cmxA           IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmwC           IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmwA           IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmuA           IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmtD           IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvA           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
1ubgA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2oe2A           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2oepA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2ofoA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1mo4A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
2zrnA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zriA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zroA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2oesA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zr0A           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1u98A           -DENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2zrfA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrdA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1mo5A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
2zrcA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrhA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
3cmvH           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvC           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2zrmA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zreA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrkA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1u94A           ----KQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2zraA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2odnA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1u99A           ----KQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2rebA           -DENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
1mo3A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
2zrbA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1g18A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
2zr7A           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1g19A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
2zrjA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrlA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zr9A           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1mo6A           ---DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
1ubfA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2g88A           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1xmsA           -DENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvG           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvE           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2odwA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrgA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
1ubcA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
2zrpA           ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
3cmvB           --------------QIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
1xmvA           -DENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
1xp8A           --KERSKAIETAMSQIEKAFGKGSIMKLGAESK-LDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESG
1aa3A           ----------------------------------------------------------------------
2cvfA           --------------------------------------MLSTGTKSLDSLLG-GGFAPGVLTQVYGPYAS
1v5wA           ---------------------------------------ITTGSQEFDKLLG-GGIESMAITEAFGEFRT
2zjbA           ---------------------------------------ITTGSQEFDKLLG-GGIESMAITEAFGEFRT
2zudB           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2zudA           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2zucB           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2zucA           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2zubA           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2z43C           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2z43B           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2dflA           ------KIIKEARDALDIRFKTALEVK----KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
2z43A           ----------------------------------MNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGS
1szpF           ---------------------------------------LTTGSKNLDTLLG-GGVETGSITELFGEFRT
1szpE           ---------------------------------------LTTGSKNLDTLLG-GGVETGSITELFGEFRT
1szpD           ---------------------------------------LTTGSKNLDTLLG-GGVETGSITELFGEFRT
1szpB           ---------------------------------------LTTGSKNLDTLLG-GGVETGSITELFGEFRT
1szpA           ---------------------------------------LTTGSKNLDTLLG-GGVETGSITELFGEFRT
2w0mA           ---------------------------------------LSTGILDFDKLIQ-GGIPQGFFIALTGEPGT
1pznG           ------------------------------------------------------------ITEVFGEFGS
1pznB           ------------------------------------------------------------ITEVFGEFGS
1pznA           ------------------------------------------------------------ITEVFGEFGS


                         .         .         *         .         .         .         .:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXX
3cmxA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmwC           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmwA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmuA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmtD           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmvA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
1ubgA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2oe2A           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2oepA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2ofoA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1mo4A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
2zrnA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zriA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zroA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2oesA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zr0A           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1u98A           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
2zrfA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrdA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1mo5A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
2zrcA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrhA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
3cmvH           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmvC           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
2zrmA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zreA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrkA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1u94A           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
2zraA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2odnA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1u99A           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
2rebA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
1mo3A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
2zrbA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1g18A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
2zr7A           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1g19A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
2zrjA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrlA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zr9A           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1mo6A           GKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
1ubfA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2g88A           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1xmsA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmvG           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
3cmvE           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
2odwA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrgA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
1ubcA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
2zrpA           GKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDI
3cmvB           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
1xmvA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGXXXX
1xp8A           GKTTLALAIVAQAQKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIXX
1aa3A           ----------------------------------------------------------------------
2cvfA           GKTTLALQ---TGLLSGKKVAYVDTEGGFSP---------------------------------------
1v5wA           GKTQLSHTLCVTAQLPGGKIIFIDTENTFRPDIADRFNVDLDNVLYARAYTSEHQMELLD----------
2zjbA           GKTQLSHTLCVTAQLPGGKIIFIDTENTFRPDIADRFNVDLDNVLYARAYTSEHQVELLD----------
2zudB           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2zudA           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2zucB           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2zucA           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2zubA           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2z43C           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2z43B           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2dflA           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
2z43A           GKTQLCHQLSVNVQGLSGKAVYIDTEGTFRENMAKALGLDIDNVM-------------------------
1szpF           GKSTLAVQIPLDIGGGEGKCLYIDTEGTFRPVIAQRFGLDPDDAL-------------------------
1szpE           GKSTLAVQIPLDIGGGEGKCLYIDTEGTFRPVIAQRFGLDPDDAL-------------------------
1szpD           GKSTLAVQIPLDIGGGEGKCLYIDTEGTFRPVIAQRFGLDPDDAL-------------------------
1szpB           GKSTLAVQIPLDIGGGEGKCLYIDTEGTFRPVIAQRFGLDPDDAL-------------------------
1szpA           GKSTLAVQIPLDIGGGEGKCLYIDTEGTFRPVIAQRFGLDPDDAL-------------------------
2w0mA           GKTIFSLHFIAKGLRDGDPCIYVTTEESRDSIQAKQFNWDFEEYI-------EKKLIIIDALM-------
1pznG           GKTQLAVQLPPEEGGLNGSVIWIDTENTFRPEIAQNRGLDPDEVL-------------------------
1pznB           GKTQLAVQLPPEEGGLNGSVIWIDTENTFRPEIAQNRGLDPDEVL-------------------------
1pznA           GKTQLAVQLPPEEGGLNGSVIWIDTENTFRPEIAQNRGLDPDEVL-------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
3cmxA           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmwC           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmwA           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmuA           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmtD           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmvA           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
1ubgA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTT
2oe2A           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTT
2oepA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQL-EKIGVMFGSPETTT
2ofoA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTT
1mo4A           VVIDSVAALVPRAELEGH-----VGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTT
2zrnA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREK---------TTT
2zriA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINALREK---------TTT
2zroA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIG------ETTT
2oesA           IVIDSVAALVPRAEIEGEMG-SHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKI-------ETTT
2zr0A           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINELR----------ETTT
1u98A           XXXXXXXXLTPKAEIEG--GDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQ-------------TTT
2zrfA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLR----------ETTT
2zrdA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRE--------PETTT
1mo5A           VVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQL------------TTT
2zrcA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLR--------SPETTT
2zrhA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINALR--------SPETTT
3cmvH           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQ----------------
3cmvC           XXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQ----------------
2zrmA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLR----------ETTT
2zreA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLR----------ETTT
2zrkA           IVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINALR----------ETTT
1u94A           XXXXXXXXLTPKAEIEGE------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ--------------TT
2zraA           IVIDSVAALVPRAEIEGEMGH--VGLQARLMSQALRKMTGALNNSGTTAIFINELR-------------T
2odnA           IVIDSVAALVPRAEIEGE--DSHVGLQARLMSQALRKMTGALNNSGTTAIFINQ--------------TT
1u99A           XXXXXXXXLTPKAEIE--------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ--------------TT
2rebA           XXXXXXXXLTPKAEIE--------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ---------------T
1mo3A           VVIDSVAALVPRAELEGEMH---VGLQARLMSQALRKMTGALNNSGTTAIFINQLR-------------T
2zrbA           IVIDSVAALVPRAEIEGE-----VGLQARLMSQALRKMTGALNNSGTTAIFINEL--------------T
1g18A           VVIDSVAALVPRAELEGEMH---VGLQARLMSQALRKMTGALNNSGTTAIFINQL--------------T
2zr7A           IVIDSVAALVPRAEIEG----SHVGLQARLMSQALRKMTGALNNSGTTAIFINQL--------------T
1g19A           VVIDSVAALVPRAELEGE----HVGLQARLMSQALRKMTGALNNSGTTAIFINQL--------------T
2zrjA           IVIDSVAALVPRAEIEGEMH---VGLQARLMSQALRKMTGALNNSGTTAIFINALRE----------TTT
2zrlA           IVIDSVAALVPRAEIEGE------GLQARLMSQALRKMTGALNNSGTTAIFINAL--------------T
2zr9A           IVIDSVAALVPRAEIEGE----HVGLQARLMSQALRKMTGALNNSGTTAIFINELR-----------TTT
1mo6A           VVIDSVAALVPRAELE-------VGLQARLMSQALRKMTGALNNSGTTAIFINQL-------------TT
1ubfA           IVIDSVAALVPRAEIEG-------GLQARLMSQALRKMTGALNNSGTTAIFINQLREKI----------T
2g88A           IVIDSVAALVPRAEIEG------VGLQARLMSQALRKMTGALNNSGTTAIFINQLR------------TT
1xmsA           XXXXXXXXLTPKAEIEA----------ARMMSQAMRKLAGNLKQSNTLLIFINQI---------------
3cmvG           XXXXXXXXLTPKAEIE--------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ----------------
3cmvE           XXXXXXXXLTPKAEIE--------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ----------------
2odwA           IVIDSVAALVPRAEIEG------VGLQARLMSQALRKMTGALNNSGTTAIFINQLRE------------T
2zrgA           IVIDSVAALVPRAEIEGH-----VGLQARLMSQALRKMTGALNNSGTTAIFINNLRE------------T
1ubcA           IVIDSVAALVPRAEIEG--------LQARLMSQALRKMTGALNNSGTTAIFINQ---------------T
2zrpA           IVIDSVAALVPRAEIEGH-----VGLQARLMSQALRKMTGALNNSGTTAIFINQLR-------------T
3cmvB           XXXXXXXXLTPKAEI---------GLAARMMSQAMRKLAGNLKQSNTLLIFINQ----------------
1xmvA           XXXXXXXXLTPKAEIE---------------SQAMRKLAGNLKQSNTLLIFINQ----------------
1xp8A           XXXXXXXXLTPRAEIP--------GLQARLMSQALRKLTAILSKTGTAAIFINQV---------------
1aa3A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1v5wA           ----------------------------------------------------------------------
2zjbA           ----------------------------------------------------------------------
2zudB           ----------------------------------------------------------------------
2zudA           ----------------------------------------------------------------------
2zucB           ----------------------------------------------------------------------
2zucA           ----------------------------------------------------------------------
2zubA           ----------------------------------------------------------------------
2z43C           ----------------------------------------------------------------------
2z43B           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2z43A           ----------------------------------------------------------------------
1szpF           ----------------------------------------------------------------------
1szpE           ----------------------------------------------------------------------
1szpD           ----------------------------------------------------------------------
1szpB           ----------------------------------------------------------------------
1szpA           ----------------------------------------------------------------------
2w0mA           ----------------------------------------------------------------------
1pznG           ----------------------------------------------------------------------
1pznB           ----------------------------------------------------------------------
1pznA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVE
3cmxA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmwC           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmwA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmuA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmtD           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
1ubgA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2oe2A           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2oepA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2ofoA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1mo4A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
2zrnA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zriA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zroA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2oesA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zr0A           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1u98A           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2zrfA           GGKALKFYASVRLDVRRIETL----DAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrdA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1mo5A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
2zrcA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrhA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
3cmvH           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvC           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2zrmA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zreA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrkA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1u94A           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2zraA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2odnA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1u99A           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2rebA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
1mo3A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
2zrbA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1g18A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
2zr7A           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1g19A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
2zrjA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrlA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zr9A           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1mo6A           GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVD
1ubfA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2g88A           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1xmsA           -GNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvG           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvE           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2odwA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrgA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
1ubcA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
2zrpA           GGKALKFYASVRLDVRRIETLKDGTDAVGNRTRXXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVE
3cmvB           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
1xmvA           --NALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
1xp8A           GGRALKFYASVRLDVRKIGQ-----PXXXXXXXXXXXXXXXXXPFKEVELALVYGKGFDQLSDLVGLAAD
1aa3A           -------------------------------------------------------------GELVDLGVK
2cvfA           ----------------------------------------------------------------------
1v5wA           ----------------------------------------------------------------------
2zjbA           ----------------------------------------------------------------------
2zudB           ----------------------------------------------------------------------
2zudA           ----------------------------------------------------------------------
2zucB           ----------------------------------------------------------------------
2zucA           ----------------------------------------------------------------------
2zubA           ----------------------------------------------------------------------
2z43C           ----------------------------------------------------------------------
2z43B           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2z43A           ----------------------------------------------------------------------
1szpF           ----------------------------------------------------------------------
1szpE           ----------------------------------------------------------------------
1szpD           ----------------------------------------------------------------------
1szpB           ----------------------------------------------------------------------
1szpA           ----------------------------------------------------------------------
2w0mA           ----------------------------------------------------------------------
1pznG           ----------------------------------------------------------------------
1pznB           ----------------------------------------------------------------------
1pznA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPxxxxxx
3cmxA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmwC           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmwA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmuA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmtD           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
1ubgA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2oe2A           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2oepA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2ofoA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
1mo4A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
2zrnA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zriA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zroA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2oesA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zr0A           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
1u98A           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2zrfA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zrdA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
1mo5A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
2zrcA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2zrhA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
3cmvH           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvC           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2zrmA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2zreA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2zrkA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
1u94A           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2zraA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2odnA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
1u99A           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2rebA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
1mo3A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
2zrbA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
1g18A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
2zr7A           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
1g19A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
2zrjA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2zrlA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zr9A           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
1mo6A           QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
1ubfA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2g88A           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANXXXXXXXXXLGIGAVV--TAEADDVLP------
1xmsA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvG           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvE           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2odwA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
2zrgA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
1ubcA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKE-------------------------
2zrpA           HGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDV-----------------------------------
3cmvB           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
1xmvA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
1xp8A           MDIIKKAGSFYSYGDERIGQGKEKTIAYIAERPEMEQEIRDRV---------------------------
1aa3A           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2cvfA           ----------------------------------------------------------------------
1v5wA           ----------------------------------------------------------------------
2zjbA           ----------------------------------------------------------------------
2zudB           ----------------------------------------------------------------------
2zudA           ----------------------------------------------------------------------
2zucB           ----------------------------------------------------------------------
2zucA           ----------------------------------------------------------------------
2zubA           ----------------------------------------------------------------------
2z43C           ----------------------------------------------------------------------
2z43B           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2z43A           ----------------------------------------------------------------------
1szpF           ----------------------------------------------------------------------
1szpE           ----------------------------------------------------------------------
1szpD           ----------------------------------------------------------------------
1szpB           ----------------------------------------------------------------------
1szpA           ----------------------------------------------------------------------
2w0mA           ----------------------------------------------------------------------
1pznG           ----------------------------------------------------------------------
1pznB           ----------------------------------------------------------------------
1pznA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xx
3cmxA           --
3cmwC           --
3cmwA           --
3cmuA           --
3cmtD           --
3cmvA           --
1ubgA           --
2oe2A           --
2oepA           --
2ofoA           --
1mo4A           --
2zrnA           --
2zriA           --
2zroA           --
2oesA           --
2zr0A           --
1u98A           --
2zrfA           --
2zrdA           --
1mo5A           --
2zrcA           --
2zrhA           --
3cmvH           --
3cmvC           --
2zrmA           --
2zreA           --
2zrkA           --
1u94A           --
2zraA           --
2odnA           --
1u99A           --
2rebA           --
1mo3A           --
2zrbA           --
1g18A           --
2zr7A           --
1g19A           --
2zrjA           --
2zrlA           --
2zr9A           --
1mo6A           --
1ubfA           --
2g88A           --
1xmsA           --
3cmvG           --
3cmvE           --
2odwA           --
2zrgA           --
1ubcA           --
2zrpA           --
3cmvB           --
1xmvA           --
1xp8A           --
1aa3A           --
2cvfA           --
1v5wA           --
2zjbA           --
2zudB           --
2zudA           --
2zucB           --
2zucA           --
2zubA           --
2z43C           --
2z43B           --
2dflA           --
2z43A           --
1szpF           --
1szpE           --
1szpD           --
1szpB           --
1szpA           --
2w0mA           --
1pznG           --
1pznB           --
1pznA           --