[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55743.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1phpA.bssp"
#ERROR : Can't open dsspfile "1vpeA.bssp"
#ERROR : Can't open dsspfile "1vjdA.bssp"
#ERROR : Can't open dsspfile "1kf0A.bssp"
#ERROR : Can't open dsspfile "1v6sA.bssp"
#ERROR : Can't open dsspfile "2ie8A.bssp"
#ERROR : Can't open dsspfile "16pkA.bssp"
#ERROR : Can't open dsspfile "2zgvA.bssp"
#ERROR : Can't open dsspfile "3c3bA.bssp"
#ERROR : Can't open dsspfile "3c3aA.bssp"
#ERROR : Can't open dsspfile "2p9tA.bssp"
#ERROR : Can't open dsspfile "3c39A.bssp"
#ERROR : Can't open dsspfile "1hdiA.bssp"
#ERROR : Can't open dsspfile "3c3bB.bssp"
#ERROR : Can't open dsspfile "3c3aB.bssp"
#ERROR : Can't open dsspfile "3c39B.bssp"
#ERROR : Can't open dsspfile "2p9qA.bssp"
#ERROR : Can't open dsspfile "2p9qB.bssp"
#ERROR : Can't open dsspfile "3pgkA.bssp"
#ERROR : Can't open dsspfile "2paaB.bssp"
#ERROR : Can't open dsspfile "1qpgA.bssp"
#ERROR : Can't open dsspfile "1zmrA.bssp"
#ERROR : Can't open dsspfile "1ltkC.bssp"
#ERROR : Can't open dsspfile "1ltkB.bssp"
#ERROR : Can't open dsspfile "1ltkA.bssp"
#ERROR : Can't open dsspfile "1fw8A.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"

## Summary of PDB Search
:394
    e-119  55%  1phpA  [x.x.x] 3-PHOSPHOGLYCERATE KINASE
    e-100  49%  1vpeA  [x.x.x] PHOSPHOGLYCERATE KINASE
    7e-96  49%  1vjdA  [c.86.1] PHOSPHOGLYCERATE KINASE
    9e-96  49%  1kf0A  [c.86.1] PHOSPHOGLYCERATE KINASE
    4e-93  46%  1v6sA  [c.86.1] PHOSPHOGLYCERATE KINASE
    1e-92  46%  2ie8A  [x.x.x] PHOSPHOGLYCERATE KINASE
    3e-92  46%  16pkA  [c.86.1 (13pkA)] 3-PHOSPHOGLYCERATE KINASE
    1e-91  50%  2zgvA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-91  50%  3c3bA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-91  49%  3c3aA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-90  47%  2p9tA  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    3e-90  49%  3c39A  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    3e-90  47%  1hdiA  [c.86.1] PHOSPHOGLYCERATE KINASE
    3e-89  51%  3c3bB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    3e-89  51%  3c3aB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-88  51%  3c39B  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    8e-87  48%  2p9qA  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    7e-86  46%  2p9qB  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    9e-86  45%  3pgkA  [x.x.x] PHOSPHOGLYCERATE KINASE
    3e-85  46%  2paaB  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    2e-82  44%  1qpgA  [x.x.x] 3-PHOSPHOGLYCERATE KINASE
    8e-81  44%  1zmrA  [x.x.x] PHOSPHOGLYCERATE KINASE
    1e-75  44%  1ltkC  [c.86.1] PHOSPHOGLYCERATE KINASE
    1e-75  44%  1ltkB  [c.86.1] PHOSPHOGLYCERATE KINASE
    1e-75  44%  1ltkA  [c.86.1] PHOSPHOGLYCERATE KINASE
    6e-66  44%  1fw8A  [c.86.1] PHOSPHOGLYCERATE KINASE
    5e-50  34%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEIKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSHLGRPAGEGFE
1phpA           ----KTIRDVDVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVVE
1vpeA           --EKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSP
1vjdA           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAIPSIKFCLDNGAKVVLMSHLGRPDGIPMP
1kf0A           -----TLDKLNVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDDGAKVVLMSHLGRPDGSPMP
1v6sA           ---MRTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP--D
2ie8A           -----TLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP--D
16pkA           --EKKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGPGFQ
2zgvA           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c3bA           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c3aA           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
2p9tA           -----TLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPMP
3c39A           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
1hdiA           -----TLDKLNVKGKRVVMRVDFNVPMAAAQITNNARIKAAVPSIKFCLDDGAKVVLMSHLGRPDGSPMP
3c3bB           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c3aB           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c39B           -----TLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
2p9qA           -----TLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPMP
2p9qB           -----TLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPMP
3pgkA           -----SVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGRPNGER-N
2paaB           -----TLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPMP
1qpgA           -----SVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGQPNGER-N
1zmrA           --------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYN
1ltkC           -------DLKDIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLR-N
1ltkB           -------DLKDIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLR-N
1ltkA           -------DLKDIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLR-N
1fw8A           ---------------RVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGRPNGE---
2cunA           ------LEDFNFHNKTVFLRVDLNSPMKDGKIISDARFKAVLPTIRYLIESGAKVVIGTHQGKPYSEDYT


                         .         .         *         .         .         .         .:140
query           ESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLRFDKREKKNDPAFCEELAALG
1phpA           E-LRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAELA
1vpeA           E-FSLAPVAKRLSELLGKEVKFVPAVVGDXXXXXXXXXXXXXXXXXXNTRFHPGETKNDPELAKFWASLA
1vjdA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLENLRFHVEEEKADPAFRASLSKLG
1kf0A           DKYSLQPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLENLRFHVEEEKAEPAFRASLSKLG
1v6sA           PKYSLAPVGEALRAHLPEARFAPFPPGSXXXXXXXXXXXPGEVLLLENVRFEPGEEKNDPELSARYARLG
2ie8A           PRYSLAPVGEALRAHLPEARFAPFPPGSXXXXXXXXXXXPGEVLLLENVRFEPGEEKNDPELSARYARLG
16pkA           QKATLKPVAKRLSELLLRPVTFAPDCL--NAADVVSKMSPGDVVLLENVRFYKEEAKDREAMAKILASYG
2zgvA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEKAEPAFRASLSKLG
3c3bA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEKAEPAFRASLSKLG
3c3aA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEKAEPAFRASLSKLG
2p9tA           DKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACANPDNGSIILLENLRFHVXXXXXDPAFRASLSKLG
3c39A           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHXXXXXXXXXFRASLSKLG
1hdiA           DKYSLQPVAAELKSALGKAVLFLKDCVGPAVEKACADPAAGSVILLENLRFHVEEEAGEPAFRASLSALG
3c3bB           DKYSLEPVAVELKSLLGKDVLFLKDCVEKACANPAA----GSVILLENLRFHVEEEKAEPAFRASLSKLG
3c3aB           DKYSLEPVAVELKSLLGKDVLFLKDCVKACANPAA-----GSVILLENLRFHVEEEKAEPAFRASLSKLG
3c39B           DKYSLEPVAVELKSLLGKDVLFLKD---EKACANPAA---GSVILLENLRFHVEEEKAEPAFRASLSKLG
2p9qA           DKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACANPDNGSIILLENLRFHVXXXXXDPAFRASLSKLG
2p9qB           DKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACANPDNGSIILLENLRFHVXXXXXDPAFRASLSKLG
3pgkA           EKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHKASKEDVQKFRHELSSLA
2paaB           DKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACANPDNGSIILLENLRFHVXXXXXDPAFRASLSKLG
1qpgA           EKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHKASKEDVQKFRHELSSLA
1zmrA           EEFSLLPVVNYLKDKLSNPVRLVKDYL------DGVDVAEGELVVLENVRFNKGEKKDDETLSKKYAALC
1ltkC           EKYTLKPVAETLKGLLGEEVLFLNDCVGKEVEDKINAAKENSVILLENLRFHKANKEDVEKFQNDLTKLA
1ltkB           EKYTLKPVAETLKGLLGEEVLFLNDCVGKEVEDKINAAKENSVILLENLRFHKANKEDVEKFQNDLTKLA
1ltkA           EKYTLKPVAETLKGLLGEEVLFLNDCVGKEVEDKINAAKENSVILLENLRFHKANKEDVEKFQNDLTKLA
1fw8A           --YSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHKASKEDVQKFRHELSSLA
2cunA           ---TTEEHARVLSELLDQHVEYIEDIFGRYAREKIKELKSGEVAILENLRFSAEEVKNKPILVKKLSKVI


                         +         .         .         .         .         *         .:210
query           EAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATLSGMLEEPRRPFTAILGGSKVSDKIKVIDAL
1phpA           DLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKALSNPDRPFTAIIGGAKVKDKIGVIDNL
1vpeA           DIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNL
1vjdA           DVYVNDAFGTAHRAHSSMVGVN--LPKKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
1kf0A           DVYVNDAFGTAHRAHSSMVGVN--LPKKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
1v6sA           EAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVIESL
2ie8A           EAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVIESL
16pkA           DVYISDAFGTAHRDSATMTGIPKILGGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLLDNM
2zgvA           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c3bA           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c3aA           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
2p9tA           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLIKNM
3c39A           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
1hdiA           DVYVNDAFGTAHRAHSSMVGVN--LPKKAGFLMKKELNYFAAAAESPERPFLAILGGAKVADKIQLINNM
3c3bB           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c3aB           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c39B           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
2p9qA           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLIKNM
2p9qB           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLIKNM
3pgkA           DVYINDAFGTAHRAHSSMVGFD-LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNL
2paaB           DVYVNDAFGTAHRAHSSMVGVN--LPQKAGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLIKNM
1qpgA           DVYINDAFGTAHRAHSSMVGFD-LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNL
1zmrA           DVFVMDAFGTAHRAQASTHGIGKFADACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSL
1ltkC           DVFINDAFGTAHRAHSS---VGVKLNVKASGFLKKELEYFSKALENPQRPLLAILGGAKVSDKIQLIKNL
1ltkB           DVFINDAFGTAHRAHSS---VGVKLNVKASGFLKKELEYFSKALENPQRPLLAILGGAKVSDKIQLIKNL
1ltkA           DVFINDAFGTAHRAHSS---VGVKLNVKASGFLKKELEYFSKALENPQRPLLAILGGAKVSDKIQLIKNL
1fw8A           DVYINDAFGTAHRAHSSMVGFD-LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNL
2cunA           DYVVNDAFATAHRSQPSLVGFARIKPMIMGFLMEKEIEALMRAYYSKDSPKIYVLGGAKVEDSLKVVENV


                         .         .         .         +         .         .         .:280
query           MDKCDTLIIGGGMCFTFLLAQGKAVGTSLKEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAET
1phpA           LEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANT
1vpeA           MEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDXXXXXXXXXXXXXXXIVLPVDAVIAQKIEPGVEK
1vjdA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGSKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
1kf0A           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKNLMSKAEKNGVKITLPVDFVTADKFDEHAKT
1v6sA           LPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVET
2ie8A           LPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVET
16pkA           LQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAVDSP
2zgvA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c3bA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c3aA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
2p9tA           LDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKV
3c39A           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
1hdiA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEAGKKIVKNLMSKAAANGVKITLPVDFVTADKFDEQAKI
3c3bB           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c3aB           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c39B           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
2p9qA           LDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKV
2p9qB           LDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKV
3pgkA           LDKVDSIIIGGGMAFTFKVLENTEIGDSIFDKAVGPEIAKLMEKAKAKGVEVVLPVDFIIADAFSASANT
2paaB           LDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKV
1qpgA           LDKVDSIIIGGGMAFTFKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVXXXXXXXXXXXXNT
1zmrA           SKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTC-----NIPVPSDVRVATEFSETAPA
1ltkC           LDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAG-SKIVGEIEKAKAKNVQIFLPVDFKIADNFDNNANT
1ltkB           LDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAG-SKIVGEIEKAKAKNVQIFLPVDFKIADNFDNNANT
1ltkA           LDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAG-SKIVGEIEKAKAKNVQIFLPVDFKIADNFDNNANT
1fw8A           LDKVDSIIIGGGMAFTFKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVXXXXXXXXXXXXNT
2cunA           LERADLVLTGGLVANVFTLAKGFDLGRKMKKKDYVKHAEEIL---DEFYPYIRTPVD------FAVDYKG


                         .         *         .         .         .         .         +:350
query           LTVSVDGIPGDMMGLDIGPETAKLYADAVAQAKTVFWNGPMGVFEMKAFXXXXXXXXXXXXXXXXXXXII
1phpA           KVVPIDAIPADWSALDIGPKTRELYRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEALDTYSVI
1vpeA           KVVRIDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAIV
1vjdA           GQATVSGIPAGWMGLDCGPESSKKYSEAVARAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
1kf0A           GQATVSGIPAGWMGLDCGPESSKKYSEAVARAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
1v6sA           RVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEGAFTVV
2ie8A           RVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEGAFTVV
16pkA           LITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYTFAIAKAMGRGTHEHGLMSII
2zgvA           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
3c3bA           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCII
3c3aA           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
2p9tA           GQATIEGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFGTKALMDEVVKATSNGCVTII
3c39A           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCII
1hdiA           GQATVSGIPAGWMGLDCGPKSSAKYSEAVARAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
3c3bB           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCII
3c3aB           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
3c39B           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCII
2p9qA           GQATIEGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFGTKALMDEVVKATSNGCVTII
2p9qB           GQATIEGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKATSNGCVT
3pgkA           KTVTKEGIPAGWQGLDNGPESRKLFAATVAKATVILWNGPPGVFEFEKFGTKALLDEVVKSSAAGNTVII
2paaB           GQATIEGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKATSNGCV-
1qpgA           KTVTKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFGTKALLDEVVKSSAAGNTVII
1zmrA           TLKSVNDVKADEQILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNF-RKGTEIVANAIADSEAFSIA
1ltkC           KFVTEEGIP-DNWGLDAGPKSIENYKDVILTSKTVIWNGPQGVFEPNAKGSIECLNLVVEVTKKGAITIV
1ltkB           KFVTEEGIP-DNWGLDAGPKSIENYKDVILTSKTVIWNGPQGVFEPNAKGSIECLNLVVEVTKKGAITIV
1ltkA           KFVTEEGIP-DNWGLDAGPKSIENYKDVILTSKTVIWNGPQGVFEPNAKGSIECLNLVVEVTKKGAITIV
1fw8A           KTVTKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFGTKALLDEVVKSSAAGNTVII
2cunA           ERVEIDGLLHQYQIMDIGKRTAEKYREILMKARIIVANGPMGVFEREEF-AIGTVEVFKAIADSPAFSVL


                         .         .         .         .         *         .         .:420
query           GGGDSVAAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEALK
1phpA           GGGDSAAAVEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALE
1vpeA           GGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMR
1vjdA           GGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDAL-
1kf0A           GGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDAL-
1v6sA           GGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLE
2ie8A           GGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLE
16pkA           GGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVL-
2zgvA           GGEDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
3c3bA           IGGDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
3c3aA           GG---------WNTEDKVSHVSTGGGASLELLEGKVLPGVDAL-
2p9tA           GGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKILPGVEAL-
3c39A           IGGDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
1hdiA           GGGDTATCCAKWNTEDNVSHVSTGGGASLELLEGKVLPGVDAL-
3c3bB           IGGDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
3c3aB           GGEDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
3c39B           IGGDKV------------SHVSTGGGASLELLEGKVLPGVDAL-
2p9qA           GGEDKV------------SHVSTGGGASLELLEGKILPGVEAL-
2p9qB           IIGE-----------DKVSHVSTGGGASLELLEGKILPGVEAL-
3pgkA           GGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFL-
2paaB           ------------TIIGKVSHVSTGGGASLELLEGKILPGVEAL-
1qpgA           GGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFL-
1zmrA           GGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLE
1ltkC           GGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLAL-
1ltkB           GGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLAL-
1ltkA           GGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLAL-
1fw8A           GGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGV----
2cunA           GGGHSIASIQKY-XXXXXXXXXXXXXAMLSFFAGEELPVLRALQ