[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV55970.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2o5aA.bssp"
#ERROR : Can't open dsspfile "2o5aB.bssp"
#ERROR : Can't open dsspfile "2id1A.bssp"

## Summary of PDB Search
:142
    6e-13  37%  2o5aA  [x.x.x] BH1328 PROTEIN
    8e-13  37%  2o5aB  [x.x.x] BH1328 PROTEIN
    2e-06  27%  2id1A  [x.x.x] HYPOTHETICAL PROTEIN
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKA
2o5aA           --------SNQELLQLAVNAVDDKKAEQVVALNK----GISDFFLICHGNSEKQVQAIAHELKKVAQEQG
2o5aB           ---------NQELLQLAVNAVDDKKAEQVVALNK----GISDFFLICHGNSEKQVQAIAHELKKVAQEQG
2id1A           ----------QEISKLAIEALEDIKGKDIIELDTSKLTSLFQR-IVATGDSNRQVKALANSVQVKLK-EA


                         .         .         *         .         .         .         .:140
query           QMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDLxxxxxxxxxxxxxxxxxxxx
2o5aA           EIKRL--EGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLW---PTVEL--------------------
2o5aB           EIKRL--EGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLW---PTVEL--------------------
2id1A           GVDIVGSEGHESGEWXXXXXXXXXXXXX-PAVRDYYDIEALW----------------------------


                         +         .         .         .         .         *         .:210
query           xx
2o5aA           --
2o5aB           --
2id1A           --