[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56026.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c3qA.bssp"
#ERROR : Can't open dsspfile "1esqC.bssp"
#ERROR : Can't open dsspfile "1esjA.bssp"
#ERROR : Can't open dsspfile "1esqB.bssp"
#ERROR : Can't open dsspfile "1esqA.bssp"
#ERROR : Can't open dsspfile "1ekkA.bssp"
#ERROR : Can't open dsspfile "1ekqA.bssp"
#ERROR : Can't open dsspfile "1ekqB.bssp"
#ERROR : Can't open dsspfile "1v8aA.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"

## Summary of PDB Search
:278
    2e-34  34%  1c3qA  [c.72.1] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE)
    3e-33  35%  1esqC  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    4e-33  33%  1esjA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    4e-32  34%  1esqB  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    4e-32  34%  1esqA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    5e-32  33%  1ekkA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    3e-31  35%  1ekqA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    4e-31  35%  1ekqB  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    4e-27  34%  1v8aA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    3e-12  43%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
:278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
1c3qA           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1esqC           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1esjA           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1esqB           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1esqA           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1ekkA           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1ekqA           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1ekqB           MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1v8aA           --------ALKRVRERRPLVHNITNFVVMXXXXXXXXXXGASPVMAHAEEELEEMIRLADAVVINIGTLD
3dzvA           ---------------TAPLIQCITNEITC-ESANALLYIDAKPI-ADDPREFFQQTS---ALVLNLGHLS


                         .         .         *         .         .         .         .:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEXXXXXXXXXXTRGV
1c3qA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEAHTVGVTDWLIKGV
1esqC           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAE-------IAHTVGV
1esjA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEAHTVGVTDWLIKGV
1esqB           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGVTDIIRLA
1esqA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGVTDIIRLA
1ekkA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEAHTVGVTDWLIKGV
1ekqA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAE-------IAHTVGG
1ekqB           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAH-----------
1v8aA           SGWRRSMVKATEIANELGKPIVLDPVGAGATKFRTRVSLEILSR-GVDVLKGNFGEISALLXXXXXXXXA
3dzvA           QEREQSLLAASDYARQVNKLTVVDLVGYGASDIRNEVGEKLVHN-QPTVVKGNLSE--------------


                         +         .         .         .         .         *         .:210
query           DVCPGDAVTEDNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAYAVRNGSPLMGRITGAGCMLSCVC
1c3qA           DAGEGGG-------DIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVV
1esqC           TDWLGDII---------RLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGSLLTSVV
1esjA           DAGEGGG-------DIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGSLLTSVV
1esqB           QQAAQKLNT--------------------VIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGSLLTSVV
1esqA           QQAAQKLNT--------------------VIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGSLLTSVV
1ekkA           DAGEGGG-------DIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
1ekqA           DIIRLAQQAAQKL--------------NTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
1ekqB           TVGGGDII---------RLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
1v8aA           KKLTMNAAREFN----------------TTVAVTGAVDYVSDGRRTFAVYNGHELLGRVTGTGCMVAALT
3dzvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAFATANPXXXXXXXXXXXXGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELx
1c3qA           GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1esqC           GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1esjA           GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1esqB           GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1esqA           GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1ekkA           AFCAVENP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1ekqA           AFCAVENP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1ekqB           AFCAVENP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
1v8aA           GAFVAVTEPLKATTSALVTFGI-----XXXXXXXXXXXPGSFHVKLYDWLYRINENVIRTYAKVREV-
3dzvA           --------------------------------------------------------------------