[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56092.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2k3fA.bssp"
#ERROR : Can't open dsspfile "1mmsA.bssp"
#ERROR : Can't open dsspfile "2jq7A.bssp"
#ERROR : Can't open dsspfile "2zjpF.bssp"
#ERROR : Can't open dsspfile "1vorJ.bssp"
#ERROR : Can't open dsspfile "3bboK.bssp"
#ERROR : Can't open dsspfile "2jl6K.bssp"
#ERROR : Can't open dsspfile "3f1fK.bssp"
#ERROR : Can't open dsspfile "2nxnB.bssp"
#ERROR : Can't open dsspfile "2hguL.bssp"
#ERROR : Can't open dsspfile "1vs6I.bssp"
#ERROR : Can't open dsspfile "2gyaG.bssp"
#ERROR : Can't open dsspfile "3cjqB.bssp"
#ERROR : Can't open dsspfile "3cjtJ.bssp"
#ERROR : Can't open dsspfile "3cjtB.bssp"
#ERROR : Can't open dsspfile "3cjrB.bssp"
#ERROR : Can't open dsspfile "3cjtF.bssp"
#ERROR : Can't open dsspfile "1hc8A.bssp"
#ERROR : Can't open dsspfile "1aciA.bssp"
#ERROR : Can't open dsspfile "1y39A.bssp"
#ERROR : Can't open dsspfile "1hc8B.bssp"
#ERROR : Can't open dsspfile "3cjqE.bssp"
#ERROR : Can't open dsspfile "1y39B.bssp"
#ERROR : Can't open dsspfile "1qa6A.bssp"
#ERROR : Can't open dsspfile "1mmsB.bssp"
#ERROR : Can't open dsspfile "3dllF.bssp"
#ERROR : Can't open dsspfile "2zjrF.bssp"
#ERROR : Can't open dsspfile "3egvB.bssp"
#ERROR : Can't open dsspfile "3cjsB.bssp"
#ERROR : Can't open dsspfile "2qa4I.bssp"
#ERROR : Can't open dsspfile "3cjtH.bssp"
#ERROR : Can't open dsspfile "1s72I.bssp"
#ERROR : Can't open dsspfile "3cjsC.bssp"

## Summary of PDB Search
:166
    2e-35  51%  2k3fA  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    9e-35  52%  1mmsA  [d.47.1 - a.4.7] PROTEIN (RIBOSOMAL PROTEIN L11)
    9e-35  52%  2jq7A  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    1e-34  50%  2zjpF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    1e-34  50%  1vorJ  [i.1.1] 50S RIBOSOMAL PROTEIN L11
    8e-33  49%  3bboK  [x.x.x] RIBOSOMAL PROTEIN L11
    6e-30  45%  2jl6K  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    6e-30  45%  3f1fK  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-29  45%  2nxnB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-29  45%  2hguL  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-25  43%  1vs6I  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-25  43%  2gyaG  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-24  48%  3cjqB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    1e-23  46%  3cjtJ  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    1e-23  46%  3cjtB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-23  49%  3cjrB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    7e-23  45%  3cjtF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    3e-22  62%  1hc8A  [a.4.7] RIBOSOMAL PROTEIN L11
    3e-22  62%  1aciA  [x.x.x] L11 RIBOSOMAL PROTEIN
    6e-22  61%  1y39A  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    9e-21  63%  1hc8B  [a.4.7] RIBOSOMAL PROTEIN L11
    1e-20  48%  3cjqE  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-20  61%  1y39B  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    3e-20  64%  1qa6A  [a.4.7] RIBOSOMAL PROTEIN L11
    7e-18  55%  1mmsB  [a.4.7] PROTEIN (RIBOSOMAL PROTEIN L11)
    5e-17  54%  3dllF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    4e-15  55%  2zjrF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-13  63%  3egvB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    6e-12  42%  3cjsB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-11  36%  2qa4I  [x.x.x] 50S RIBOSOMAL PROTEIN L11P
    4e-11  41%  3cjtH  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-10  43%  1s72I  [a.4.7] 50S RIBOSOMAL PROTEIN L11P
    6e-10  40%  3cjsC  [x.x.x] 50S RIBOSOMAL PROTEIN L11
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKKQTGFIKLQIXXXXXXXXXXXXXXXXXXXVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
2k3fA           ---KKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
1mmsA           ---------IKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
2jq7A           ---------IKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
2zjpF           ---KKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFI
1vorJ           ---KKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFI
3bboK           ---KKVIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPGFVIPVEITVFDDKSFTFI
2jl6K           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3f1fK           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
2nxnB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
2hguL           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
1vs6I           ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSEKGLPIPVVITVYADRSFTFV
2gyaG           ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSEKGLPIPVVITVYADRSFTFV
3cjqB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
3cjtJ           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjtB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjrB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
3cjtF           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
1hc8A           -------------------------------------------------------------------TFI
1aciA           -------------------------------------------------------------------TFI
1y39A           -------------------------------------------------------------------TFI
1hc8B           ----------------------------------------------------------------------
3cjqE           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
1y39B           ----------------------------------------------------------------------
1qa6A           ----------------------------------------------------------------------
1mmsB           ----------------------------------------------------------------------
3dllF           ----------------------------------------------------------------------
2zjrF           ----------------------------------------------------------------------
3egvB           ----------------------------------NIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjsB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
2qa4I           ---------------------------------VDVQAVVQEINDQTAE-----VPVTVKYDDDGSFEIE
3cjtH           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
1s72I           ----------------------------------------------------------------------
3cjsC           ----KVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV


                         .         .         *         .         .         .         .:140
query           CKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
2k3fA           IKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV
1mmsA           IKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV
2jq7A           IKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV
2zjpF           TKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTV
1vorJ           TKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTV
3bboK           LKTPPASVLLLKASGAEKGSKDPQMEKVGKITIDQLRGIATEKLPDLNCTTIESAMRIIAGTAANMGIDI
2jl6K           TKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
3f1fK           TKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
2nxnB           TKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
2hguL           TKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
1vs6I           TKTPPAAVLLXXXXXXXXXXXXPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVV
2gyaG           TKTPPAAVLLXXXXXXXXXXXXPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVV
3cjqB           TKTPPASYLIR-------------------ITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
3cjtJ           TKTPPASYLIRKAAGLEKGAHKPGREKVG-------REIAKQKMP------LEAAARMIAGSARSMGVEV
3cjtB           TKTPPASYLIRKAAGLEKGAHKPGREKVG-------REIAKQKMP------LEAAARMIAGSARSMGVEV
3cjrB           TKTPPASYLIR-------------------ITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGV--
3cjtF           TKTPPASYLIRKAAGLEKGH-KPGREKVG---REQVLEIAKQKMP------LEAAARMIAGSARSMGVEV
1hc8A           TKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVV
1aciA           TKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVV
1y39A           TKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVV
1hc8B           -KTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVV
3cjqE           TKTPPASYLIR-------------------ITWEQVLEIAKQKMP------LEAAARMIAGSARSMGVEV
1y39B           -KTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVV
1qa6A           -KTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGI--
1mmsB           -KTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV
3dllF           -KTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTV
2zjrF           --------LIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTV
3egvB           TKTPPASYLI------------------------------------------------------------
3cjsB           TKTP------------------------------------------------------------------
2qa4I           VGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTS-----
3cjtH           TKT-------------------------------------------------------------------
1s72I           ---PPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTI
3cjsC           TK--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGxxxxxxxxxxxxxxxxxxxxxxxx
2k3fA           --------------------------
1mmsA           --------------------------
2jq7A           --------------------------
2zjpF           EG------------------------
1vorJ           EG------------------------
3bboK           D-------------------------
2jl6K           VG------------------------
3f1fK           VG------------------------
2nxnB           --------------------------
2hguL           --------------------------
1vs6I           E-------------------------
2gyaG           E-------------------------
3cjqB           VG------------------------
3cjtJ           VG------------------------
3cjtB           VG------------------------
3cjrB           --------------------------
3cjtF           VG------------------------
1hc8A           E-------------------------
1aciA           E-------------------------
1y39A           E-------------------------
1hc8B           E-------------------------
3cjqE           VG------------------------
1y39B           E-------------------------
1qa6A           --------------------------
1mmsB           --------------------------
3dllF           E-------------------------
2zjrF           EG------------------------
3egvB           --------------------------
3cjsB           --------------------------
2qa4I           --------------------------
3cjtH           --------------------------
1s72I           E-------------------------
3cjsC           --------------------------