[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qpnA.bssp"
#ERROR : Can't open dsspfile "2b7nA.bssp"
#ERROR : Can't open dsspfile "1qapA.bssp"
#ERROR : Can't open dsspfile "2jbmD.bssp"
#ERROR : Can't open dsspfile "2jbmC.bssp"
#ERROR : Can't open dsspfile "2jbmB.bssp"
#ERROR : Can't open dsspfile "2jbmA.bssp"
#ERROR : Can't open dsspfile "1o4uA.bssp"
#ERROR : Can't open dsspfile "1o4uB.bssp"
#ERROR : Can't open dsspfile "1x1oB.bssp"
#ERROR : Can't open dsspfile "1x1oA.bssp"
#ERROR : Can't open dsspfile "3c2vA.bssp"
#ERROR : Can't open dsspfile "3c2oA.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3gnnB.bssp"
#ERROR : Can't open dsspfile "3gnnA.bssp"

## Summary of PDB Search
:280
    2e-24  33%  1qpnA  [d.41.2 - c.1.17] PROTEIN (QUINOLINATE PHOSPHORIBOSYL
    1e-21  29%  2b7nA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    7e-18  28%  1qapA  [d.41.2 - c.1.17] QUINOLINIC ACID PHOSPHORIBOSYLTRANSFERASE
    1e-16  27%  2jbmD  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-16  27%  2jbmC  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-16  27%  2jbmB  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-16  27%  2jbmA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    2e-16  27%  1o4uA  [d.41.2 - c.1.17] TYPE II QUINOLIC ACID
    5e-16  27%  1o4uB  [d.41.2 - c.1.17] TYPE II QUINOLIC ACID
    7e-16  28%  1x1oB  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    7e-16  28%  1x1oA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    4e-14  26%  3c2vA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    5e-13  26%  3c2oA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    5e-13  26%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-11  33%  3gnnB  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    3e-11  31%  3gnnA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
1qpnA           ----------------------------------------REAGVVAGLDVALEVLGTNGYRVLDRVEDG
2b7nA           ------TFLERALKEDLGHGDLFERVL---EKDFKATAFVRQEGVFSGEKYALELLEMTGIECVQTIKDK
1qapA           --------------------DITAQLLP-ADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTDDG
2jbmD           ---------DSWLREDCPGLNYAALVSGAG--PSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEG
2jbmC           ---------DSWLREDCPGLNYAALVSGAG--PSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEG
2jbmB           ---------DSWLREDCPGLNYAALVSGAG--PSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEG
2jbmA           ---------DSWLREDCPGLNYAALVSGAG--PSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEG
1o4uA           -----------FVKEDEGKLDLASFPLR-NTTAGAHLLLKTENVVASGIEVSRMFLEKMGLLSKFNVEDG
1o4uB           -----------FVKEDEGKLDLASFPLR-NTTAGAHLLLKTENVVASGIEVSRMFLEKMGLLSKFNVEDG
1x1oB           -----------WLREDLGQGDLTSLLVVPEDLEGEAVILAKEGGVLAGLWVAERVFALADTAFTPLVAEG
1x1oA           -----------WLREDLGQGDLTSLLVVPEDLEGEAVILAKEGGVLAGLWVAERVFALADTAFTPLVAEG
3c2vA           --------VTNWLSEDVPSFDFGGYV--VGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3c2oA           --------VTNWLSEDVPSFDFGGYV--VGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3c2eA           --------VTNWLSEDVPSFDFGGYV--VGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3gnnB           ---------DAAIARNV--ADALAEDVGSGDQPRRARVIVREDAVLCGVDAVVRAVDP-SIEVDWRHREG
3gnnA           --------------------------------PRRARVIVREDAVLCGVDAVVRAVDP-SIEVDWRHREG


                         .         .         *         .         .         .         .:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
1qpnA           ARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLSGIATATAAWVDAVRGT--KAKIRDTRKTLPGLRALQ
2b7nA           ERFKPKDALMEIRGDFSMLLKVERTLLNLLQHSSGIATLTSRFVEALNSHKVR--LLDTRKTRPLLRIFE
1qapA           DAIHANQTVFELQGPARVLLTGERTALNFVQTLSGVASEVRRYVGLL--AGTQTQLLDTRKTLPGLRTAL
2jbmD           SKLVPVARVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
2jbmC           SKLVPVARVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
2jbmB           SKLVPVARVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
2jbmA           SKLVPVARVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
1o4uA           EYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFSVATTTRRFAEKLK----HAKIAATRKILPGLGVLQ
1o4uB           EYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFSVATTTRRFAEKLK----HAKIAATRKILPGLGVLQ
1x1oB           ARVAEGTEVARVRGPLRGILAGERLALNLLQRLSGIATLTRAYVEAL--AGTKAQILDTRKTTPGLRALE
1x1oA           ARVAEGTEVARVRGPLRGILAGERLALNLLQRLSGIATLTRAYVEAL--AGTKAQILDTRKTTPGLRALE
3c2vA           SKNDSGKIVVKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3c2oA           SKNDSGKIVVKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3c2eA           SKNDSGKIVVKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3gnnB           DRMSADSTVCELRGPARALLTAERNALNFLQLLSGVASATRQYVD--RIADTRARILDTRKTLPGLRLAQ
3gnnA           DRMSADSTVCELRGPARALLTAERNALNFLQLLSGVASATRQYVD--RIADTRARILDTRKTLPGLRLAQ


                         +         .         .         .         .         *         .:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
1qpnA           KYAVRTGGGVNHRLGLGDAALIKDNHVAAAG---SVVDALRAVRNAAPDLPCEVEVDSEQLDAVLPEKPE
2b7nA           KYSVLNGGASNHRLGLDDALMLKDTHLRHVKDLKSFLTHAR--KNLPFTAKIEIECESEEAKNAMNAGAD
1qapA           KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHXXXXXXXXXXXXXXXXXAL--KAGAD
2jbmD           KYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG----VEKXXXXXXXXXXXXLKVEVECQEAVQAAEAGAD
2jbmC           KYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG----VEKXXXXXXXXXXXXLKVEVECQEAVQAAEAGAD
2jbmB           KYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG----VEKXXXXXXXXXXXXLKVEVECQEAVQAAEAGAD
2jbmA           KYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG----VEKXXXXXXXXXXXXLKVEVECQEAVQAAEAGAD
1o4uA           KIAVVHGGG--------DCVMIKDNHLKMYGSAERAVQEVRKIIPFTTKIEVEVE-NLEDALRAVEAGAD
1o4uB           KIAVVHGGG-------DGCVMIKDNHLKMYGSAERAVQEVRKIIPFTTKIEVEVE-NLEDALRAVEAGAD
1x1oB           KYAVRVGGGRNHRYGLFDGILLKENHXXXXXXXXXXXXXXXXXXPH-YXXXXXXXXXXXXXXXXXXXXXX
1x1oA           KYAVRVGGGRNHRYGLFDGILLKENHXXXXXXXXXXXXXXXXXXPH-YXXXXXXXXXXXXXXXXXXXXXX
3c2vA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCGFAV--KIEVECLSEEATEAIEAGAD
3c2oA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCGFAV--KIEVECLSEEATEAIEAGAD
3c2eA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCGFAV--KIEVECLSEEATEAIEAGAD
3gnnB           KYAVRVGG----------------------GAVQIEVETL------------------DQLRTALAHGAR
3gnnA           KYAVRVGG----------------------GANQGVGEALDAAFALNVPVQIEVET-LDQLRTALAHGAR


                         .         .         .         +         .         .         .:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMxxx
1qpnA           LILLDNFAVWQTQTAVQRRDSRAPTVMLESSGGLSLQTAATYAETGVDYLAVGATHSVRVLDIGLDM---
2b7nA           IVMCDNLSVLETKEIAAYRDAHYPFVLLEASGNISLESINAYAKSGVDAISVGALIQATFIDMHMKM---
1qapA           IIMLDNFNTDQMREAVKR---VNGQARLEVSGNVTAETLREFAETGVDFISVGATKHVRALDLSMR----
2jbmD           LVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPLDFSLKL---
2jbmC           LVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPLDFSLKL---
2jbmB           LVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPLDFSLKL---
2jbmA           LVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPLDFSLKL---
1o4uA           IVMLDNLSPEEVKDISRRIKDINPNVIVEVSGGITEENVSLYDFETVDVISSS-----------------
1o4uB           IVMLDNLSPEEVKDISRRIKDINPNVIVEVSGGITEENVSLYDFETVDVISSS-----------------
1x1oB           XXXXDNFP---LEALREAVRRVGGRVPLEASGNMTLERAKAAAEAGVDYVSVGATHSAKALDLSL-----
1x1oA           XXXXDNFP---LEALREAVRRVGGRVPLEASGNMTLERAKAAAEAGVDYVSVGATHSAKALDLSL-----
3c2vA           VIMLDN------------------HFLLECSGGLNLDN--LYLCDDIDIYSTSSIHQGTPIDFSLKL---
3c2oA           VIMLD-----------------------------------------------------------------
3c2eA           VIMLD-----------------------------------------------------------------
3gnnB           SVLLDNFTLDMMRDAV---RVTEGRAVLEVSGGVNFDTVRAIAETGVDRISIGA----------------
3gnnA           SVLLDNFTLDMMRDAV---RVTEGRAVLEVSGGVNFDTVRAIAETGVDRISIGA----------------