[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56230.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"

## Summary of PDB Search
:264
    3e-46  47%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-40  46%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-35  36%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-35  36%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-33  36%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-32  35%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-32  36%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-10  38%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-10  38%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-09  38%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-09  39%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-08  40%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-08  40%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-07  40%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-07  41%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-07  41%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    5e-06  32%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    5e-06  25%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    5e-06  25%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    8e-06  35%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    8e-06  35%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-05  44%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    2e-05  33%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-05  25%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-05  25%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-05  38%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-05  32%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    2e-05  32%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    2e-05  34%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    3e-05  36%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-05  36%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    3e-05  36%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-05  36%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-05  36%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-05  36%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-05  32%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    7e-05  34%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  34%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  34%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  34%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  34%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  34%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-05  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-05  28%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-05  35%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-05  28%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-05  28%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-05  28%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT
    9e-05  28%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-05  28%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-05  28%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-04  31%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    2e-04  29%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-04  33%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  34%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-04  35%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-04  38%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-04  35%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-04  38%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-04  25%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-04  44%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    0.001  32%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    0.001  32%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    0.001  32%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    0.001  32%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
2d2fA           -------SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILL
2d2eA           -------SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILL
2zu0C           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
2d3wA           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
2d3wD           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
2d3wC           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
2d3wB           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
1gajA           --------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITG--FLKADEGRVYF
1g6hA           --------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITG--FLKADEGRVYF
1g9xA           --------------------EFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITG--FLKADEGRVYF
3d31A           ------------------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAG--FHVPDSGRILL
2it1B           ------------------------LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAG--IYKPTSGKIYF
2it1A           ------------------------LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAG--IYKPTSGKIYF
2hydA           -------------------NEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLI--PRFYDVTSGQILI
3fvqB           ---------LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAG--FEQPDSGEISL
3fvqA           ---------LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAG--FEQPDSGEISL
1pf4A           --VDVKDVTFTYQG-----KEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLF--TRFYDVDSGSICL
1mv5D           -------------------DSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLL--ERFYQPTAGEITI
1mv5A           -------------------DSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLL--ERFYQPTAGEITI
1z2rA           --------------------EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLI--TRFYDIDEGHILM
3b60A           --------------------EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLI--TRFYDIDEGHILM
2onkA           --------------------------------------VLLGPTGAGKSVFLELIAG--IVKPDRGEVRL
1ji0A           ------DIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAG--LVRAQKGKIIF
3g60A           ----------------------PVLQGLSLEVKKGQTLALVGSSGCGKSTV--VQLLERFYDPMAGSVFL
3g5uA           ----------------------PVLQGLSLEVKKGQTLALVGSSGCGKSTV--VQLLERFYDPMAGSVFL
3dhwC           ------------------------LNNVSLHVPAGQIYGVIGASGAGKSTLIRCV--NLLERPTEGSVLV
1z47B           ---------------------------VSFQIREGEMVGLLGPSGSGKTTILRLIAG--LERPTKGDVWI
1z47A           ---------------------------VSFQIREGEMVGLLGPSGSGKTTILRLIAG--LERPTKGDVWI
1jj7A           -----------------------VLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQN--LYQPTGGQLLL
1xefA           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
1mt0A           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
2fgkA           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
2ffbA           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
2ffaA           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
2ff7A           -------------------DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLI--QRFYIPENGQVLI
1v43A           ------------------------VNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAG--LEEPTEGRIYF
2ixgA           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
2ixfD           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
2ixfC           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
2ixfA           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
2ixeD           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
2ixeA           -----------------------VLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQN--LYQPTGGKVLL
3b5jA           -------------------DSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLI--QRFYIPENGQVLI
2awnA           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
1xmjA           --------------------ETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2r6gB           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
2r6gA           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
1q12A           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
3fh6A           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
2awoA           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
2awnB           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--LETITSGDLFI
2pjzA           ------------------------LENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPY---SGNIFI
2pzfA           -SLTTTE--VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2bbtB           -------------------NNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
1xmiE           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
1xmiD           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
1xmiC           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
1xmiB           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
1xmiA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2pzgB           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2pzgA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2pzfB           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2pzeB           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2pzeA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2bbtA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2bbsA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2bboA           ---------------------TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
2awoD           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------
2awoC           ---------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------
2awnD           -----------LQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------
2awnC           ---------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------
2yyzA           ---------------------------VSFEVKDGEFVALLGPSGCGKTTT--LLMLAGIYKPTSGEIYF
1sgwA           -------SKLEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTL-------------------
2yz2B           --------------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAG--LIEPTSGDVLY
2yz2A           --------------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAG--LIEPTSGDVLY
1l2tB           ------------------------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNII--GCLDKPTEGEVYI
1l2tA           ------------------------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNII--GCLDKPTEGEVYI


                         .         .         *         .         .         .         .:140
query           DGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDMDPS
2d2fA           DGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDES
2d2eA           DGENILELSPDERARKGLFLAFQYPV-VPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDES
2zu0C           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
2d3wA           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
2d3wD           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
2d3wC           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
2d3wB           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
1gajA           ENKDITNKEPAELYHYGIVRTFQTP---------------------------------------------
1g6hA           ENKDITNKEPAELYHYGIVRTFQTP---------------------------------------------
1g9xA           ENKDITNKEPAELYHYGIVRTFQTP---------------------------------------------
3d31A           DGKDVTDLSPEKHDIAFVYQNY------------------------------------------------
2it1B           DEKDVTELPPKDRN--------------------------------------------------------
2it1A           DEKDVTELPPKDRN--------------------------------------------------------
2hydA           DGHNIKDLTGSLRNQIGL----------------------------------------------------
3fvqB           SGKTI-----------------------------------------------------------------
3fvqA           SGKTI-----------------------------------------------------------------
1pf4A           DGHDVRD---------------------------------------------------------------
1mv5D           DGQPIDNISLENRSQIG-FVSQDSAIMAGTINLTYGLEGDYTDEDLWQVLDLAFRSFVENMPDQLNTEVG
1mv5A           DGQPIDNISLENRSQIG-FVSQDSAIMAGTINLTYGLEGDYTDEDLWQVLDLAFRSFVENMPDQLNTEVG
1z2rA           DGHDLRE---------------------------------------------------------------
3b60A           DGHDLRE---------------------------------------------------------------
2onkA           NGADITPLPPERR---------------------------------------------------------
1ji0A           NGQDITN---------------------------------------------------------------
3g60A           DGKEIKQLNV-QWLRAQLGIVSQEP-----ILFDCSIAENIAYGDNEEIVRAAKEANIHQFIDSLPDKYN
3g5uA           DGKEIKQLNV-QWLRAQLGIVSQEP-----ILFDCSIAENIAYGDNEEIVRAAKEANIHQFIDSLPDKYN
3dhwC           DGQELTTLSESELTKA------------------------------------------------------
1z47B           GGKRVTDLPPQKRNVGLVFQNY------------------------------------------------
1z47A           GGKRVTDLPPQKRNVGLVFQNY------------------------------------------------
1jj7A           DGKPL-----------------------------------------------------------------
1xefA           DGHDLALADPNLRRQVGVVL--------------------------------------------------
1mt0A           DGHDLALADPNLRRQVGVVL--------------------------------------------------
2fgkA           DGHDLALADPNLRRQVGVVL--------------------------------------------------
2ffbA           DGHDLALADPNLRRQVGVVL--------------------------------------------------
2ffaA           DGHDLALADPNLRRQVGVVL--------------------------------------------------
2ff7A           DGHDLALADPNLRRQVGVVL--------------------------------------------------
1v43A           GDRDVTYLPPKDRNISMVF---------------------------------------------------
2ixgA           DGEPL-----------------------------------------------------------------
2ixfD           DGEPL-----------------------------------------------------------------
2ixfC           DGEPL-----------------------------------------------------------------
2ixfA           DGEPL-----------------------------------------------------------------
2ixeD           DGEPL-----------------------------------------------------------------
2ixeA           DGEPL-----------------------------------------------------------------
3b5jA           DGHDLALADPNLRRQVGVVL--------------------------------------------------
2awnA           GEKRMNDTPPAERGVGMVFQSYALEV--------------------------------------------
1xmjA           SGR-------------------------------------------------------------------
2r6gB           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
2r6gA           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
1q12A           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
3fh6A           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
2awoA           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
2awnB           GEKRMNDTPPAERGVGMVFQSY------------------------------------------------
2pjzA           NGMEVRKIRNYIRYSTNLPEAYEIGVELKGLDRDLFLEMLKALKLGEEILRRKLYK--------------
2pzfA           SGR-------------------------------------------------------------------
2bbtB           SGR-------------------------------------------------------------------
1xmiE           SGR-------------------------------------------------------------------
1xmiD           SGR-------------------------------------------------------------------
1xmiC           SGR-------------------------------------------------------------------
1xmiB           SGR-------------------------------------------------------------------
1xmiA           SGR-------------------------------------------------------------------
2pzgB           SGR-------------------------------------------------------------------
2pzgA           SGR-------------------------------------------------------------------
2pzfB           SGR-------------------------------------------------------------------
2pzeB           SGR-------------------------------------------------------------------
2pzeA           SGR-------------------------------------------------------------------
2bbtA           SGR-------------------------------------------------------------------
2bbsA           SGR-------------------------------------------------------------------
2bboA           SGR-------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           DDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFLRARRISKD-------EVEKRVVEIARKLLID-N
1sgwA           ----------------------------------------------------------------------
2yz2B           DG----ERKKGYEIRRNIGIAFQYP---------------------------------------------
2yz2A           DG----ERKKGYEIRRNIGIAFQYP---------------------------------------------
1l2tB           DNIKTNDLDDDELTK-------------------------------------------------------
1l2tA           DNIKTNDLDDDELTK-------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLDRELGVGFSGGXXXXXXXXXXXXXXXXXXXXXXTDSGLDVDALGVVSRGIDAYRRATGGALVVITHNT
2d2fA           YLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGAL-VITHYQ
2d2eA           YLSRYL----NEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGAL-VITHYQ
2zu0C           LLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGK-RSFIIVTHYQ
2d3wA           LLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGK-RSFIIVTHYQ
2d3wD           LLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESD-GLDIDALKVVADGVNSLRDGK-RSFIIVTHYQ
2d3wC           LLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESD---DIDALKVVADGVNSLRDGK-RSFIIVTHYQ
2d3wB           LLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDS-LDIDALKVVADGVNSLRDGK-RSFIIVTH-Y
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
1mv5D           ----ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK--GRTTLVIAH--
1mv5A           ----ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK--GRTTLVIAH--
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
3g60A           TRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKARE--GRTCIVIAHRL
3g5uA           TRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKARE--GRTCIVIAHRL
3dhwC           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           LLDRK-PTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHD-
1sgwA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RILEXXXXXXXXXXXXXXXXAEGDSSLIESIxxxxxxxxxxxxxxxxxxxxxxx
2d2fA           RIL---------------------------------------------------
2d2eA           RIL---------------------------------------------------
2zu0C           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQL-----------------------
2d3wA           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQL-----------------------
2d3wD           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQL-----------------------
2d3wC           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQL-----------------------
2d3wB           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQL-----------------------
1gajA           ------------------------------------------------------
1g6hA           ------------------------------------------------------
1g9xA           ------------------------------------------------------
3d31A           ------------------------------------------------------
2it1B           ------------------------------------------------------
2it1A           ------------------------------------------------------
2hydA           ------------------------------------------------------
3fvqB           ------------------------------------------------------
3fvqA           ------------------------------------------------------
1pf4A           ------------------------------------------------------
1mv5D           ------------------------------------------------------
1mv5A           ------------------------------------------------------
1z2rA           ------------------------------------------------------
3b60A           ------------------------------------------------------
2onkA           ------------------------------------------------------
1ji0A           ------------------------------------------------------
3g60A           STIQ--------------------------------------------------
3g5uA           STIQ--------------------------------------------------
3dhwC           ------------------------------------------------------
1z47B           ------------------------------------------------------
1z47A           ------------------------------------------------------
1jj7A           ------------------------------------------------------
1xefA           ------------------------------------------------------
1mt0A           ------------------------------------------------------
2fgkA           ------------------------------------------------------
2ffbA           ------------------------------------------------------
2ffaA           ------------------------------------------------------
2ff7A           ------------------------------------------------------
1v43A           ------------------------------------------------------
2ixgA           ------------------------------------------------------
2ixfD           ------------------------------------------------------
2ixfC           ------------------------------------------------------
2ixfA           ------------------------------------------------------
2ixeD           ------------------------------------------------------
2ixeA           ------------------------------------------------------
3b5jA           ------------------------------------------------------
2awnA           ------------------------------------------------------
1xmjA           ------------------------------------------------------
2r6gB           ------------------------------------------------------
2r6gA           ------------------------------------------------------
1q12A           ------------------------------------------------------
3fh6A           ------------------------------------------------------
2awoA           ------------------------------------------------------
2awnB           ------------------------------------------------------
2pjzA           ------------------------------------------------------
2pzfA           ------------------------------------------------------
2bbtB           ------------------------------------------------------
1xmiE           ------------------------------------------------------
1xmiD           ------------------------------------------------------
1xmiC           ------------------------------------------------------
1xmiB           ------------------------------------------------------
1xmiA           ------------------------------------------------------
2pzgB           ------------------------------------------------------
2pzgA           ------------------------------------------------------
2pzfB           ------------------------------------------------------
2pzeB           ------------------------------------------------------
2pzeA           ------------------------------------------------------
2bbtA           ------------------------------------------------------
2bbsA           ------------------------------------------------------
2bboA           ------------------------------------------------------
2awoD           ------------------------------------------------------
2awoC           ------------------------------------------------------
2awnD           ------------------------------------------------------
2awnC           ------------------------------------------------------
2yyzA           ------------------------------------------------------
1sgwA           ------------------------------------------------------
2yz2B           ------------------------------------------------------
2yz2A           ------------------------------------------------------
1l2tB           ------------------------------------------------------
1l2tA           ------------------------------------------------------