[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56234.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xjsA.bssp"
#ERROR : Can't open dsspfile "2qq4I.bssp"
#ERROR : Can't open dsspfile "2qq4F.bssp"
#ERROR : Can't open dsspfile "2qq4B.bssp"
#ERROR : Can't open dsspfile "2qq4A.bssp"
#ERROR : Can't open dsspfile "1su0B.bssp"
#ERROR : Can't open dsspfile "2z7eA.bssp"
#ERROR : Can't open dsspfile "2z7eC.bssp"
#ERROR : Can't open dsspfile "2z7eB.bssp"
#ERROR : Can't open dsspfile "1q48A.bssp"
#ERROR : Can't open dsspfile "1wfzA.bssp"
#ERROR : Can't open dsspfile "3e1hA.bssp"

## Summary of PDB Search
:144
    6e-21  33%  1xjsA  [d.224.1] NIFU-LIKE PROTEIN
    2e-20  38%  2qq4I  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    2e-20  38%  2qq4F  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    2e-20  38%  2qq4B  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    2e-20  38%  2qq4A  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    1e-19  31%  1su0B  [d.224.1] NIFU LIKE PROTEIN ISCU
    5e-05  23%  2z7eA  [x.x.x] NIFU-LIKE PROTEIN
    6e-05  23%  2z7eC  [x.x.x] NIFU-LIKE PROTEIN
    6e-05  23%  2z7eB  [x.x.x] NIFU-LIKE PROTEIN
    1e-04  32%  1q48A  [d.224.1] NIFU-LIKE PROTEIN
    3e-04  34%  1wfzA  [d.224.1] NITROGEN FIXATION CLUSTER-LIKE
    9e-04  33%  3e1hA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
:144

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHGCAVSQAAADM
1xjsA           --TLYRQVIMDHYKNPRNKGVLNDSIVV-DMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASM
2qq4I           ---LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASL
2qq4F           ---LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASL
2qq4B           ---LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASL
2qq4A           ---LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASL
1su0B           ---LYMAVVADHSKRPHHHGQLDGVEAVQLN-NPTCGDVISLTVKFDEDKIEDIAFAGNGCTISTASSSM
2z7eA           MSFEYNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNNDVIEDVRFKTFGCGSAIAVSSM
2z7eC           ----YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNNDVIEDVRFKTFGCGSAIAVSSM
2z7eB           ----YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNNDVIEDVRFKTFGCGSAIAVSSM
1q48A           ---------------------------------PACGDVMQLQIKVDDNGIEDAKFKTYGCGSAIASSSL
1wfzA           ---------------------------------PACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSL
3e1hA           -------AMAEARLVPAQITHMVSTTCT-DSANPGYDHYVAKELGL-SDRLEKVLLHGIGCSGGLAALRT


                         .         .         *         .         .         .         .:140
query           MADLVTGETVGEARRLSGLYLDMIKGRPXXXXXXXXXXXXXXXXSIARMPARVKCAELAWRTLEKLLxxx
1xjsA           MTQAIKGKDIETALSMSKIFSDMMQGK--EYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEK-----
2qq4I           MTEAVKGKKVAEALELSRKFQAMVEGAP----PDPTLGDLLALQGVAKLPARVKCATLAWHALEEAL---
2qq4F           MTEAVKGKKVAEALELSRKFQAMVEGAP----PDPTLGDLLALQGVAKLPARVKCATLAWHALEEAL---
2qq4B           MTEAVKGKKVAEALELSRKFQAMVEGAP----PDPTLGDLLALQGVAKLPARVKCATLAWHALEEAL---
2qq4A           MTEAVKGKKVAEALELSRKFQAMVEGAP----PDPTLGDLLALQGVAKLPARVKCATLAWHALEEAL---
1su0B           MTDAVIGKSKEEALALADIFSEMVQGQ--ENPAQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAI---
2z7eA           LTEMVKGKPIQYALNLT-----------------------------------------------------
2z7eC           LTEMVKGKPIQYALNLT-----------------------------------------------------
2z7eB           LTEMVKGKPIQYALNLT-----------------------------------------------------
1q48A           ITEWVKGKSLEEA---------------------------------------------------------
1wfzA           ATEWVKGKTVEEA---------------------------------------------------------
3e1hA           AANLCLGHTAGKPARILVLALEV-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxx
1xjsA           ----
2qq4I           ----
2qq4F           ----
2qq4B           ----
2qq4A           ----
1su0B           ----
2z7eA           ----
2z7eC           ----
2z7eB           ----
1q48A           ----
1wfzA           ----
3e1hA           ----