[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56840.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aj0A.bssp"
#ERROR : Can't open dsspfile "1twsA.bssp"
#ERROR : Can't open dsspfile "1tx2A.bssp"
#ERROR : Can't open dsspfile "1twwA.bssp"
#ERROR : Can't open dsspfile "1ad1A.bssp"
#ERROR : Can't open dsspfile "1twsB.bssp"
#ERROR : Can't open dsspfile "1tx0A.bssp"
#ERROR : Can't open dsspfile "1twzB.bssp"
#ERROR : Can't open dsspfile "1tx2B.bssp"
#ERROR : Can't open dsspfile "1twwB.bssp"
#ERROR : Can't open dsspfile "2dzaB.bssp"
#ERROR : Can't open dsspfile "1ad4A.bssp"
#ERROR : Can't open dsspfile "1q26B.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "2dzbA.bssp"
#ERROR : Can't open dsspfile "1ad4B.bssp"
#ERROR : Can't open dsspfile "2dqwA.bssp"
#ERROR : Can't open dsspfile "2dzaA.bssp"
#ERROR : Can't open dsspfile "1eyeA.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "2bmbA.bssp"
#ERROR : Can't open dsspfile "1tmjA.bssp"
#ERROR : Can't open dsspfile "1f9yA.bssp"
#ERROR : Can't open dsspfile "1cbkA.bssp"
#ERROR : Can't open dsspfile "1hq2A.bssp"
#ERROR : Can't open dsspfile "1f9hA.bssp"
#ERROR : Can't open dsspfile "2qx0A.bssp"
#ERROR : Can't open dsspfile "2vefA.bssp"
#ERROR : Can't open dsspfile "1rtzA.bssp"
#ERROR : Can't open dsspfile "2vefB.bssp"
#ERROR : Can't open dsspfile "1ru2A.bssp"
#ERROR : Can't open dsspfile "1ru1A.bssp"
#ERROR : Can't open dsspfile "2cg8D.bssp"
#ERROR : Can't open dsspfile "2cg8B.bssp"
#ERROR : Can't open dsspfile "2vp8B.bssp"
#ERROR : Can't open dsspfile "2vp8A.bssp"
#ERROR : Can't open dsspfile "2cg8A.bssp"
#ERROR : Can't open dsspfile "2cg8C.bssp"

## Summary of PDB Search
:435
    9e-63  48%  1aj0A  [x.x.x] DIHYDROPTEROATE SYNTHASE
    4e-53  45%  1twsA  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    9e-49  44%  1tx2A  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    3e-48  45%  1twwA  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    8e-48  43%  1ad1A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    2e-47  44%  1twsB  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    3e-47  44%  1tx0A  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    3e-44  44%  1twzB  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    2e-43  43%  1tx2B  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    8e-43  43%  1twwB  [c.1.21] DHPS, DIHYDROPTEROATE SYNTHASE
    6e-41  44%  2dzaB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-39  42%  1ad4A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    4e-39  42%  1q26B  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-37  42%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    9e-36  42%  2dzbA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-35  41%  1ad4B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    3e-35  42%  2dqwA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-33  42%  2dzaA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-32  39%  1eyeA  [c.1.21] DIHYDROPTEROATE SYNTHASE I
    4e-31  41%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-30  40%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    5e-28  39%  2bmbA  [x.x.x] FOLIC ACID SYNTHESIS PROTEIN FOL1
    2e-21  42%  1tmjA  [x.x.x] 2-AMINO-4-HYDROXY-6-
    4e-21  42%  1f9yA  [d.58.30] PROTEIN (6-HYDROXYMETHYL-7,8-DIHYDROPTERIN
    1e-20  39%  1cbkA  [d.58.30] PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-
    2e-20  42%  1hq2A  [d.58.30] 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN
    2e-20  42%  1f9hA  [d.58.30] 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN
    3e-20  43%  2qx0A  [x.x.x] 7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-
    7e-20  32%  2vefA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-19  41%  1rtzA  [d.58.30] 2-AMINO-4-HYDROXY-6-
    8e-19  33%  2vefB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    1e-17  44%  1ru2A  [d.58.30] 2-AMINO-4-HYDROXY-6-
    8e-16  43%  1ru1A  [d.58.30] 2-AMINO-4-HYDROXY-6-
    5e-12  47%  2cg8D  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    5e-11  45%  2cg8B  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    4e-10  30%  2vp8B  [x.x.x] DIHYDROPTEROATE SYNTHASE 2
    5e-10  30%  2vp8A  [x.x.x] DIHYDROPTEROATE SYNTHASE 2
    5e-10  45%  2cg8A  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    9e-10  44%  2cg8C  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
1aj0A           ----------DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS
1twsA           ---RCGEYTLNNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVS
1tx2A           ---RCGEYTLNNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGES----FAKVS
1twwA           ---RCGEYTLNNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGES-------VS
1ad1A           ----------------IMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
1twsB           ---RCGEYTLNNEKTLIMGILN------SDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVS
1tx0A           ---RCGEYTLNNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGK--------VS
1twzB           ---RCGEYTLNNEKTLIMGILNVTPD----GGSYNEVDAAVRHAKEMRDEGAHIIDIGGES-------VS
1tx2B           ---RCGEYTLNNEKTLIMGILNVTP---SDGGSYNEVDAAVRHAKEMRDEGAHIIDIGG---------VS
1twwB           ---RCGEYTLNNEKTLIMGILNVTP-----GGSYNEVDAAVRHAKEMRDEGAHIIDIGGE--------VS
2dzaB           -------------------------------------DSALERAREMVAEGADILDLGAESTRP---PVP
1ad4A           ----------------IMGILNVNVES------------AVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
1q26B           ---RCGEYTLNNEKTLIMGIL---------GGSYNEVDAAVRHAKEMRDEGAHIIDIGG---------VS
1ad1B           ----------------IMGILNVTPN----------VESAVTRVKAMMDEGADIIDVGGVSTM-----IT
2dzbA           ---------------------------------------ALERAREMVAEGADILDLGAES---------
1ad4B           ----------------IMGILNVT-----------NVESAVTRVKAMMDEGADIIDVGG-------VMIT
2dqwA           ---------------------------------------ALERAREMVAEGADILDLGAE----------
2dzaA           ---------------------------------------ALERAREMVAEGADILDLGAES---------
1eyeA           ----------------VMGVLNVTDDSFSDGGCYLDLDDXXXXXXXXXXXXXXXXXXXXET---------
2dzbB           -------------------------------------ERALERAREMVAEGADILDLGAEST-------P
2dqwB           -------------------------------------ERALERAREMVAEGADILDLGAESP--------
2bmbA           ----------------IMAIFNATPDSFSDGGEHFAIESQLNDIIKLCKDASVIIDVGGCSTRPNSIQAS
1tmjA           ----------------------------------------------------------------------
1f9yA           ----------------------------------------------------------------------
1cbkA           ----------------------------------------------------------------------
1hq2A           ----------------------------------------------------------------------
1f9hA           ----------------------------------------------------------------------
2qx0A           ----------------------------------------------------------------------
2vefA           ---------------VICGIINVTPFAL---------EQALQQARKLIAEGASMLDIGGESSY-----VE
1rtzA           ----------------------------------------------------------------------
2vefB           ---------------VICGIINVT------------LEQALQQARKLIAEGASMLDIGGESY------VE
1ru2A           ----------------------------------------------------------------------
1ru1A           ----------------------------------------------------------------------
2cg8D           ----------------------------------------------------------------------
2cg8B           ----------------------------------------------------------------------
2vp8B           ----------------------------------------------------------------------
2vp8A           ----------------------------------------------------------------------
2cg8A           ----------------------------------------------------------------------
2cg8C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
1aj0A           VEEELQRVIPVVEAIAQREVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHM
1twsA           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1tx2A           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1twwA           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1ad1A           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
1twsB           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1tx0A           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1twzB           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1tx2B           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1twwB           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
2dzaB           VEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
1ad4A           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
1q26B           VEEEIKRVVPMIQAVSKEKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKEPKIAEVAAHYDVPIILMHN
1ad1B           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
2dzbA           -EEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
1ad4B           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
2dqwA           -EEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
2dzaA           -------LLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
1eyeA           -----SRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRDPAMGPLLAEADVPWVLMHW
2dzbB           VEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMV--------ALAARHX
2dqwB           VEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMV--------ALAARHX
2bmbA           EEEEIRRSIPLIKALPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGFDSNMFAVIAENPEICYILSHT
1tmjA           ----------------------------------------------------------------------
1f9yA           ----------------------------------------------------------------------
1cbkA           ----------------------------------------------------------------------
1hq2A           ----------------------------------------------------------------------
1f9hA           ----------------------------------------------------------------------
2qx0A           ----------------------------------------------------------------------
2vefA           IEEEIQRVVPVIKAIKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMDEKMPHVVAEARAQVVVMAR
1rtzA           ----------------------------------------------------------------------
2vefB           IEEEIQRVVPVIKAIKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMDEKMPHVVAEARAQVVVMAR
1ru2A           ----------------------------------------------------------------------
1ru1A           ----------------------------------------------------------------------
2cg8D           ----------------------------------------------------------------------
2cg8B           ----------------------------------------------------------------------
2vp8B           ---EITRLVPFIEWLAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGAGLVCAHT
2vp8A           ---EITRLVPFIEWLAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGAGLVCAHT
2cg8A           ----------------------------------------------------------------------
2cg8C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
1aj0A           QGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFN
1twsA           RDN-------MNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1tx2A           RDN-------MNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1twwA           RDN-------MNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1ad1A           ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
1twsB           RDN-------MNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1tx0A           RDNMN-------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1twzB           RDNMN-------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1tx2B           RDNMN-------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1twwB           RDNMN-------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
2dzaB           PPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
1ad4A           ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
1q26B           RDNMN-------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLG
1ad1B           ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
2dzbA           PPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGVP--QVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
1ad4B           ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
2dqwA           PPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGVP--QVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
2dzaA           PPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGVP--QVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
1eyeA           RAVSADTPHVPRYGNVVAEVRXXXXXXXXXXXXXXXXXXRLVLDPGLGFAKTAQHNWAILHALPELVATG
2dzbB           XXXXXXXXXXXRYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
2dqwB           XXXXXXXXXXXRYRDVVAEVKAFLEAQARRALSAGVP--QVVLDPGFGFGKXXXXXXXXXXXXDEIVALG
2bmbA           RGDISTMNRLAHYENLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRNSQVYVNLN
1tmjA           ----------------------------------------------------------------------
1f9yA           ----------------------------------------------------------------------
1cbkA           ----------------------------------------------------------------------
1hq2A           ----------------------------------------------------------------------
1f9hA           ----------------------------------------------------------------------
2qx0A           ----------------------------------------------------------------------
2vefA           PQHPSSL-IFPHFGFAFTELADFXXXXXXXXXXXGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXG
1rtzA           ----------------------------------------------------------------------
2vefB           PQHPSSLPHFGFTEEELADMXXXXXXXXXXXXXXGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXG
1ru2A           ----------------------------------------------------------------------
1ru1A           ----------------------------------------------------------------------
2cg8D           ----------------------------------------------------------------------
2cg8B           ----------------------------------------------------------------------
2vp8B           YGTTTR--------GVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHDFGKNTFHGLLLLRHVADLVMTG
2vp8A           YGTTTR--------GVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHDFGKNTFHGLLLLRHVADLVMTG
2cg8A           ----------------------------------------------------------------------
2cg8C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCN
1aj0A           LPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAM--------------
1twsA           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1tx2A           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1twwA           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1ad1A           YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
1twsB           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1tx0A           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1twzB           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1tx2B           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1twwB           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
2dzaB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
1ad4A           YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
1q26B           YPVLLGTSRKSFIG--HVLDLPEERLEGTGATVCLGIEKGCEFVRVHDV---------------------
1ad1B           YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
2dzbA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
1ad4B           YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
2dqwA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
2dzaA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
1eyeA           IPVLVGASRKRFLGALLGVMRPTGRDTATAVISALAALHGAWGVRVHDVRASVDAIK-------------
2dzbB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
2dqwB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
2bmbA           MPVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHDV---------------------
1tmjA           --------------------------------------------------------------AYIAIGSN
1f9yA           --------------------------------------------------------------AYIAIGSN
1cbkA           ----------------------------------------------------------------------
1hq2A           --------------------------------------------------------------AYIAIGSN
1f9hA           --------------------------------------------------------------AYIAIGSN
2qx0A           ----------------------------------------------------------IRVYIALGSNLA
2vefA           YPIFLGVSRKRFVGFEVNPETELGRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE-------------
1rtzA           --------------------------------------------------------------AYIAIGSN
2vefB           YPIFLGVSRKRFVGFEVNPETELGRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE-------------
1ru2A           --------------------------------------------------------------AYIAIGSN
1ru1A           --------------------------------------------------------------AYIAIGSN
2cg8D           ----------------------------------------------------------------------
2cg8B           ----------------------------------------------------------------------
2vp8B           WPVLMALSNE--------------RLEXXXXXXXXXXXXXXRMFRVHEVAATVASIQGVRP---------
2vp8A           WPVLMALSRL----------------EXXXXXXXXXXXXXXRMFRVHEVAATVASIQGVRP---------
2cg8A           ----------------------------------------------------------------------
2cg8C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
1aj0A           ----------------------------------------------------------------------
1twsA           ----------------------------------------------------------------------
1tx2A           ----------------------------------------------------------------------
1twwA           ----------------------------------------------------------------------
1ad1A           ----------------------------------------------------------------------
1twsB           ----------------------------------------------------------------------
1tx0A           ----------------------------------------------------------------------
1twzB           ----------------------------------------------------------------------
1tx2B           ----------------------------------------------------------------------
1twwB           ----------------------------------------------------------------------
2dzaB           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1q26B           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
2dzbA           ----------------------------------------------------------------------
1ad4B           ----------------------------------------------------------------------
2dqwA           ----------------------------------------------------------------------
2dzaA           ----------------------------------------------------------------------
1eyeA           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
2bmbA           ----------------------------------NISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELL
1tmjA           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
1f9yA           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
1cbkA           -------GSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLL
1hq2A           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
1f9hA           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
2qx0A           MPL------------QQVSAAREALAHLPRSRLV-ASPLYRTKPLGPQDQPDFLNAVVALDTSLPPEQLL
2vefA           ----------------------------------------------------------------------
1rtzA           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
2vefB           ----------------------------------------------------------------------
1ru2A           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPPDYL------NAAVALETSLAPEELL
1ru1A           L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPPDYL------NAAVALETSLAPEELL
2cg8D           ---------------------------------------------------SFANQVVEVETWLPAQDLL
2cg8B           -----------------------------------------------LATDSFANQVVEVETWLPAQDLL
2vp8B           ----------------------------------------------------------------------
2vp8A           ----------------------------------------------------------------------
2cg8A           ---------------------------------------------------SFANQVVEVETWLPAQDLL
2cg8C           ---------------------------------------------------SFANQVVEVETWLPAQDLL


                         .         .         .         .         *         .         .:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANxx
1aj0A           ----------------------------------------------------------------------
1twsA           ----------------------------------------------------------------------
1tx2A           ----------------------------------------------------------------------
1twwA           ----------------------------------------------------------------------
1ad1A           ----------------------------------------------------------------------
1twsB           ----------------------------------------------------------------------
1tx0A           ----------------------------------------------------------------------
1twzB           ----------------------------------------------------------------------
1tx2B           ----------------------------------------------------------------------
1twwB           ----------------------------------------------------------------------
2dzaB           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1q26B           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
2dzbA           ----------------------------------------------------------------------
1ad4B           ----------------------------------------------------------------------
2dqwA           ----------------------------------------------------------------------
2dzaA           ----------------------------------------------------------------------
1eyeA           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
2bmbA           --------KLCKKIEYEELQRTIDLDIVMFEDIIVNEPDLNIPHPRMLERTFVLEPLCELIPVHL-----
1tmjA           NHTQRIELQQGRVRKARAGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
1f9yA           NHTQRIELQQGRVRKARWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
1cbkA           DELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPN--
1hq2A           NHTQRIELQQGAVRKARWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
1f9hA           NHTQRIELQQGRVRKARWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
2qx0A           DHTQAIERNQGRVREQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLKAREFMLYPLADIAP--------
2vefA           ----------------------------------------------------------------------
1rtzA           NHTQRIE-----LQQGRGGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
2vefB           ----------------------------------------------------------------------
1ru2A           NHTQRIELQQGR-----GGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
1ru1A           NHTQRIELQQGR--------RTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
2cg8D           ETLLAIESELGR------GPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------
2cg8B           ETLLAIESELGR--------RLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------
2vp8B           ----------------------------------------------------------------------
2vp8A           ----------------------------------------------------------------------
2cg8A           ETLLAIESELGRI----------DLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------
2cg8C           ETLLAIESELGRL---------IDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxx
1aj0A           ---------------
1twsA           ---------------
1tx2A           ---------------
1twwA           ---------------
1ad1A           ---------------
1twsB           ---------------
1tx0A           ---------------
1twzB           ---------------
1tx2B           ---------------
1twwB           ---------------
2dzaB           ---------------
1ad4A           ---------------
1q26B           ---------------
1ad1B           ---------------
2dzbA           ---------------
1ad4B           ---------------
2dqwA           ---------------
2dzaA           ---------------
1eyeA           ---------------
2dzbB           ---------------
2dqwB           ---------------
2bmbA           ---------------
1tmjA           ---------------
1f9yA           ---------------
1cbkA           ---------------
1hq2A           ---------------
1f9hA           ---------------
2qx0A           ---------------
2vefA           ---------------
1rtzA           ---------------
2vefB           ---------------
1ru2A           ---------------
1ru1A           ---------------
2cg8D           ---------------
2cg8B           ---------------
2vp8B           ---------------
2vp8A           ---------------
2cg8A           ---------------
2cg8C           ---------------