[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for elen0:ACV56973.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vpyB.bssp"
#ERROR : Can't open dsspfile "1kqfB.bssp"
#ERROR : Can't open dsspfile "2ivfB.bssp"
#ERROR : Can't open dsspfile "1y4zB.bssp"
#ERROR : Can't open dsspfile "1siwB.bssp"
#ERROR : Can't open dsspfile "1r27B.bssp"
#ERROR : Can't open dsspfile "1q16B.bssp"
#ERROR : Can't open dsspfile "1ti2B.bssp"
#ERROR : Can't open dsspfile "1h0hB.bssp"
#ERROR : Can't open dsspfile "1bc6A.bssp"
#ERROR : Can't open dsspfile "1frkA.bssp"
#ERROR : Can't open dsspfile "1f5cA.bssp"
#ERROR : Can't open dsspfile "1bqxA.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"
#ERROR : Can't open dsspfile "1frmA.bssp"
#ERROR : Can't open dsspfile "2fd2A.bssp"
#ERROR : Can't open dsspfile "1frhA.bssp"
#ERROR : Can't open dsspfile "3eunA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1g6bA.bssp"
#ERROR : Can't open dsspfile "3exyA.bssp"
#ERROR : Can't open dsspfile "1hfeL.bssp"
#ERROR : Can't open dsspfile "1frjA.bssp"
#ERROR : Can't open dsspfile "5fd1A.bssp"
#ERROR : Can't open dsspfile "1f5bA.bssp"
#ERROR : Can't open dsspfile "1e08A.bssp"
#ERROR : Can't open dsspfile "1frlA.bssp"
#ERROR : Can't open dsspfile "3c7bB.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1pc5A.bssp"
#ERROR : Can't open dsspfile "1gaoA.bssp"
#ERROR : Can't open dsspfile "1friA.bssp"
#ERROR : Can't open dsspfile "1fddA.bssp"

## Summary of PDB Search
:219
    2e-24  40%  2vpyB  [x.x.x] NRFC PROTEIN
    3e-23  36%  1kqfB  [d.58.1 - f.23.22] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE,
    2e-22  42%  2ivfB  [x.x.x] ETHYLBENZENE DEHYDROGENASE BETA-SUBUNIT
    4e-20  38%  1y4zB  [x.x.x] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    4e-20  38%  1siwB  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    4e-20  38%  1r27B  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    4e-20  38%  1q16B  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    4e-19  33%  1ti2B  [d.58.1 - b.3.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT
    2e-15  37%  1h0hB  [d.58.1] FORMATE DEHYDROGENASE (SMALL SUBUNIT)
    2e-05  33%  1bc6A  [x.x.x] 7-FE FERREDOXIN
    5e-05  37%  1frkA  [x.x.x] FERREDOXIN
    5e-05  35%  1f5cA  [d.58.1] FERREDOXIN 1
    5e-05  33%  1bqxA  [d.58.1] PROTEIN (FERREDOXIN)
    9e-05  40%  1h98A  [d.58.1] FERREDOXIN
    9e-05  35%  1frmA  [x.x.x] FERREDOXIN
    1e-04  35%  2fd2A  [x.x.x] FERREDOXIN
    2e-04  31%  1frhA  [x.x.x] FERREDOXIN
    2e-04  36%  3eunA  [x.x.x] FERREDOXIN
    2e-04  35%  1d3wA  [d.58.1] FERREDOXIN 1
    2e-04  36%  1bluA  [x.x.x] FERREDOXIN
    3e-04  33%  1g6bA  [d.58.1] 7FE FERREDOXIN I
    3e-04  36%  3exyA  [x.x.x] FERREDOXIN
    4e-04  42%  1hfeL  [d.58.1 - c.96.1] PROTEIN (FE-ONLY HYDROGENASE
    4e-04  33%  1frjA  [x.x.x] FERREDOXIN
    4e-04  33%  5fd1A  [d.58.1 (6fdrA)] FERREDOXIN
    4e-04  33%  1f5bA  [d.58.1] FERREDOXIN 1
    4e-04  42%  1e08A  [i.4.1] [FE]-HYDROGENASE (LARGE SUBUNIT)
    5e-04  33%  1frlA  [x.x.x] FERREDOXIN
    5e-04  44%  3c7bB  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    5e-04  33%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    5e-04  33%  1a6lA  [x.x.x] FERREDOXIN
    6e-04  31%  1pc5A  [d.58.1] FERREDOXIN I
    6e-04  33%  1gaoA  [d.58.1] FERREDOXIN I
    6e-04  33%  1friA  [x.x.x] FERREDOXIN
    6e-04  33%  1fddA  [x.x.x] FERREDOXIN
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
2vpyB           MPRYAMAIDLSLXXXXXXXXXXXKMENEVPPGVFWIREREVGE---------YPNLVVEFRPEQCLHCEN
1kqfB           -AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMKLEWLIRKDGCMHCED
2ivfB           ------------------------------------------------GGGKWPNPFFFYLARMCNHCTN
1y4zB           ----------------------------------------------------FENTFMMYLPRLCEHCLN
1siwB           ----------------------------------------------------FENTFMMYLPRLCEHCLN
1r27B           ----------------------------------------------------FENTFMMYLPRLCEHCLN
1q16B           ----------------------------------------------------FENTFMMYLPRLCEHCLN
1ti2B           MEQYYMVIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGHRWMNRERGTYPRNDINYRPTPCMHCEN
1h0hB           --------DTTRCTACRGCQVACKQWHGPDFNFHTYKLVRMHEQEIDGR------IDWLFFPDQCRHCIA
1bc6A           ----------------------------------------------------------YVITEPCIGTKD
1frkA           ----------------------------------------------------------------CIKCKY
1f5cA           ----------------------------------------------------------------CIKCKY
1bqxA           ----------------------------------------------------------YVITEPCIGTKC
1h98A           --------------------------------------------------------------VICEPCKD
1frmA           ----------------------------------------------------------------CIKCKY
2fd2A           ----------------------------------------------------------------CIKCKY
1frhA           ----------------------------------------------------------YVVTDNCIKCKY
3eunA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------CIKCKY
1bluA           ----------------------------------------------------------------------
1g6bA           ----------------------------------------------------------------CIKCKY
3exyA           ----------------------------------------------------------------------
1hfeL           ----------------------------------------------------------------------
1frjA           ----------------------------------------------------------------CIKCKY
5fd1A           ----------------------------------------------------------------CIKCKY
1f5bA           ----------------------------------------------------------------CIKCKY
1e08A           ----------------------------------------------------------------------
1frlA           ----------------------------------------------------------------CIKCKY
3c7bB           -------------------------------------------------------------------CEI
1b0tA           ----------------------------------------------------------------CIKCKY
1a6lA           --------------------------------------------------------------IKCKYCD-
1pc5A           ----------------------------------------------------------------CIKCKY
1gaoA           ----------------------------------------------------------------CIKCKY
1friA           ----------------------------------------------------------------CIKCKY
1fddA           ----------------------------------------------------------------CIKCKY


                         .         .         *         .         .         .         .:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
2vpyB           PPCVPVCPTGASYQTKDGLVLVDPKKXXXXXXXXXXXPYDARYLH-PAGYVSKCTFCAHRLEKGKVPACV
1kqfB           PGCLKACPSAGAIIQANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACV
2ivfB           PACLAACPTGAIYKREDGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCYPRIEKGIANACN
1y4zB           PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
1siwB           PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
1r27B           PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
1q16B           PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
1ti2B           APCVAK-GNGAVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEEENVAQKCTMCAHLLDDPKMPRCA
1h0hB           PPCKATADMESAIIHDDATGCVPKTKDLDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACV
1bc6A           ASCVEVCPVDCIHEGED-QYYIDPDVCIDCGACEAVCPVSAIY---------------------------
1frkA           TDCVEVCPVDCFYEGPNFLV-IDPDECIDCALCEPECP--------------------------------
1f5cA           TDCVEVCPVDC-HYEGPNFLVIHPDECIDCALCEPECP--------------------------------
1bqxA           ASCVEVCPVDCIHEGED-QYYIDPDVCIDCGACEAVCPVSAIY---------------------------
1h98A           QSCVEVCPVECIYDGGD-QFYIHPEECIDCGACVPACPVNAIY--PEEDVPEQ-----------------
1frmA           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCAPECP--------------------------------
2fd2A           TDCVEVCPVDAFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1frhA           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
3eunA           -------------------------ECINCDVCEPECPNGAISQGDETYVIEP-SLCTECVGHYETSQCV
1d3wA           TECVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1bluA           -------------------------ECINCDVCEPECPNGAISQGDETYVIEP-SLCTECVGHYETSQCV
1g6bA           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCESECP--------------------------------
3exyA           -------------------------ECINCDGCEPECPNGAISQGDETYVIEP-SLCTECVGHYETSQCV
1hfeL           -------------------VQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHIEACINCGQ-----------
1frjA           TDCVEVCPVDCIY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
5fd1A           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1f5bA           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1e08A           -------------------VQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHIEACINCGQ-----------
1frlA           TDCVEVCPVDCFY-EGPNFLVIHPDSCIDCALCEPECP--------------------------------
3c7bB           PSTVAACPTGA--LKPDKTIKVDVEKCMYCGNCYTMCP--------------------------------
1b0tA           TKCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1a6lA           --CVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1pc5A           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPEC--GAQAIFSEDEVPE------------------
1gaoA           TDCVEVCPVDCFY-EGPNFLVIHPDECIDCASCEPECP--------------------------------
1friA           TDCVEVCPVNCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------
1fddA           TNCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECP--------------------------------


                         +         .         .         .         .         *         .:210
query           AQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEPKLMYL
2vpyB           ETCPTYCRTFGDLED----------PESPVAKALKAAE-RV---DVLRP----------EQGTRPKLFYL
1kqfB           KTCPTGAIHFG-----------------------------------------------------------
2ivfB           RQCPGRVRAFGYLD--------------------------------------------------------
1y4zB           ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
1siwB           ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
1r27B           ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
1q16B           ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
1ti2B           HNCGS-----------------------------------------------------------------
1h0hB           TSCPTGAMNFGDLSE-------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1frkA           ----------------------------------------------------------------------
1f5cA           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1frmA           ----------------------------------------------------------------------
2fd2A           ----------------------------------------------------------------------
1frhA           ----------------------------------------------------------------------
3eunA           EVC-------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
1bluA           EVC-------------------------------------------------------------------
1g6bA           ----------------------------------------------------------------------
3exyA           EVC-------------------------------------------------------------------
1hfeL           ----------------------------------------------------------------------
1frjA           ----------------------------------------------------------------------
5fd1A           ----------------------------------------------------------------------
1f5bA           ----------------------------------------------------------------------
1e08A           ----------------------------------------------------------------------
1frlA           ----------------------------------------------------------------------
3c7bB           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1pc5A           ----------------------------------------------------------------------
1gaoA           ----------------------------------------------------------------------
1friA           ----------------------------------------------------------------------
1fddA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MREGRKxxx
2vpyB           NAPSKK---
1kqfB           ---------
2ivfB           ---------
1y4zB           ---------
1siwB           ---------
1r27B           ---------
1q16B           ---------
1ti2B           ---------
1h0hB           ---------
1bc6A           ---------
1frkA           ---------
1f5cA           ---------
1bqxA           ---------
1h98A           ---------
1frmA           ---------
2fd2A           ---------
1frhA           ---------
3eunA           ---------
1d3wA           ---------
1bluA           ---------
1g6bA           ---------
3exyA           ---------
1hfeL           ---------
1frjA           ---------
5fd1A           ---------
1f5bA           ---------
1e08A           ---------
1frlA           ---------
3c7bB           ---------
1b0tA           ---------
1a6lA           ---------
1pc5A           ---------
1gaoA           ---------
1friA           ---------
1fddA           ---------