[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54068.1

[Show Plain Result]


## Summary of Sequence Search
    1::158
    1::84      2e-12  38%  142 aa  NSRR_PROMH RecName: Full=HTH-type transcriptional repressor nsrR;
    1::143     2e-12  29%  143 aa  NSRR_BACLD RecName: Full=HTH-type transcriptional regulator nsrR;
    1::84      2e-11  33%  141 aa  NSRR_PHOLL RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      6e-11  35%  141 aa  NSRR_ENT38 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::137     8e-11  28%  146 aa  NSRR_BACSU RecName: Full=HTH-type transcriptional regulator nsrR;
    1::73      1e-10  41%  141 aa  NSRR_ERWCT RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALTY RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALTI RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALSV RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALPK RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALPB RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALPA RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALHS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALG2 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALEP RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALCH RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_SALA4 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::73      2e-10  41%  141 aa  NSRR_PECCP RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOSE RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOLC RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOHS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO8A RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO24 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_SHISS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_SHIFL RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_SHIF8 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_SHIDS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_SHIBS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ESCF3 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOUT RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOSM RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOLU RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOLI RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOL6 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOL5 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOK1 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECODH RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECOBW RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO81 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO7I RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO5E RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO57 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO55 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO45 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-10  32%  141 aa  NSRR_ECO27 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::85      3e-10  41%  147 aa  Y846_SYNY3 RecName: Full=Putative HTH-type transcriptional
    1::84      3e-10  33%  141 aa  NSRR_KLEP7 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      3e-10  33%  141 aa  NSRR_KLEP3 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::85      4e-10  40%  150 aa  RRF2_DESVH RecName: Full=Protein rrf2;
    1::145     4e-10  29%  147 aa  NSRR_GEOKA RecName: Full=HTH-type transcriptional regulator nsrR;
    1::72      5e-10  40%  141 aa  NSRR_YERPS RecName: Full=HTH-type transcriptional repressor nsrR;
    1::72      5e-10  40%  141 aa  NSRR_YERPN RecName: Full=HTH-type transcriptional repressor nsrR;
    1::72      5e-10  40%  141 aa  NSRR_YERPE RecName: Full=HTH-type transcriptional repressor nsrR;
    1::72      5e-10  40%  141 aa  NSRR_YERPA RecName: Full=HTH-type transcriptional repressor nsrR;
    1::72      5e-10  40%  141 aa  NSRR_YERP3 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      5e-10  32%  141 aa  NSRR_SHIB3 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::72      7e-10  40%  141 aa  NSRR_YERE8 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      9e-10  29%  161 aa  Y1318_MYCBO RecName: Full=Putative HTH-type transcriptional
    1::84      9e-10  29%  161 aa  Y1287_MYCTU RecName: Full=Putative HTH-type transcriptional
    1::84      2e-09  32%  141 aa  NSRR_SERP5 RecName: Full=HTH-type transcriptional repressor nsrR;
   27::149     4e-09  26%  149 aa  NSRR_BACSK RecName: Full=HTH-type transcriptional regulator nsrR;
    1::146     4e-09  31%  164 aa  ISCR_PHOLL RecName: Full=HTH-type transcriptional regulator iscR;
    3::136     1e-08  28%  156 aa  BADM_RHOPA RecName: Full=Putative HTH-type transcriptional
    1::76      1e-08  36%  144 aa  NSRR_PHOPR RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      2e-08  29%  154 aa  AAU3_RHIME RecName: Full=Protein aau3;
    1::140     5e-08  29%  148 aa  Y1593_NEIMA RecName: Full=Putative HTH-type transcriptional
    1::140     5e-08  29%  148 aa  Y1378_NEIMB RecName: Full=Putative HTH-type transcriptional
    1::84      7e-08  33%  141 aa  NSRR_ALISL RecName: Full=HTH-type transcriptional repressor nsrR;
    1::148     9e-08  27%  164 aa  ISCR_SERP5 RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     9e-08  29%  172 aa  ISCR_PHOPR RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      1e-07  32%  141 aa  NSRR_VIBFM RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      1e-07  32%  141 aa  NSRR_VIBF1 RecName: Full=HTH-type transcriptional repressor nsrR;
    1::130     1e-07  28%  164 aa  ISCR_XENNE RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     1e-07  29%  173 aa  ISCR_VIBSL RecName: Full=HTH-type transcriptional regulator iscR;
    1::101     1e-07  32%  168 aa  ISCR_ALISL RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPS RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPP RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPN RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPG RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPE RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERP3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::149     2e-07  30%  164 aa  ISCR_YERE8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::131     2e-07  27%  163 aa  ISCR_KLEP3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-07  35%  138 aa  CYMR_BACSU RecName: Full=HTH-type transcriptional regulator
    1::84      3e-07  28%  141 aa  NSRR_VIBHB RecName: Full=HTH-type transcriptional repressor nsrR;
    1::131     3e-07  27%  163 aa  ISCR_KLEP7 RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     3e-07  28%  168 aa  ISCR_VIBVY RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     3e-07  28%  168 aa  ISCR_VIBVU RecName: Full=HTH-type transcriptional regulator iscR;
    1::95      4e-07  34%  164 aa  YOR2_AZOVI RecName: Full=Putative HTH-type transcriptional
   27::142     4e-07  25%  146 aa  NSRR_BACHD RecName: Full=HTH-type transcriptional regulator nsrR;
    1::155     4e-07  27%  163 aa  ISCR_ENT38 RecName: Full=HTH-type transcriptional regulator iscR;
    1::131     7e-07  26%  150 aa  Y379_HAEIN RecName: Full=Putative HTH-type transcriptional
    1::86      7e-07  29%  147 aa  NSRR_OCEIH RecName: Full=HTH-type transcriptional regulator nsrR;
    1::130     7e-07  28%  168 aa  ISCR_VIBPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     7e-07  28%  168 aa  ISCR_VIBHB RecName: Full=HTH-type transcriptional regulator iscR;
    1::130     7e-07  28%  173 aa  ISCR_VIBCH RecName: Full=HTH-type transcriptional regulator iscR;
    1::131     7e-07  28%  164 aa  ISCR_ERWCT RecName: Full=HTH-type transcriptional regulator iscR;
    1::87      1e-06  35%  141 aa  NSRR_VIBVY RecName: Full=HTH-type transcriptional repressor nsrR;
    1::87      1e-06  35%  141 aa  NSRR_VIBVU RecName: Full=HTH-type transcriptional repressor nsrR;
    1::84      1e-06  27%  141 aa  NSRR_VIBPA RecName: Full=HTH-type transcriptional repressor nsrR;
    1::85      1e-06  34%  162 aa  ISCR_SHISS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_SHIFL RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_SHIF8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_SHIDS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_SHIBS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_SHIB3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ESCF3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOUT RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOSM RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOSE RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOLU RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOLI RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOLC RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOL6 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOL5 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOK1 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOHS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECODH RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECOBW RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO8A RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO81 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO7I RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO5E RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO57 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO55 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO45 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO27 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  162 aa  ISCR_ECO24 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALTY RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALTI RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALSV RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALPK RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALPC RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALPB RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALNS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALHS RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALG2 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALEP RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALDC RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALCH RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALAR RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  164 aa  ISCR_SALA4 RecName: Full=HTH-type transcriptional regulator iscR;
    1::131     1e-06  28%  164 aa  ISCR_PECCP RecName: Full=HTH-type transcriptional regulator iscR;
    1::131     1e-06  26%  165 aa  ISCR_EDWI9 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      1e-06  34%  163 aa  ISCR_CITK8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::85      2e-06  34%  162 aa  ISCR_ENTS8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::137     2e-06  25%  156 aa  YFFB_LACLA RecName: Full=Putative HTH-type transcriptional
   31::86      1e-05  32%  150 aa  Y166_RHOCA RecName: Full=Putative HTH-type transcriptional
   27::84      2e-05  31%  156 aa  YWGB_BACSU RecName: Full=Putative HTH-type transcriptional
   28::87      2e-05  32%  144 aa  Y268_AQUAE RecName: Full=Putative HTH-type transcriptional
    1::131     3e-05  27%  165 aa  ISCR_ERWT9 RecName: Full=HTH-type transcriptional regulator iscR;
   12::130     9e-05  24%  133 aa  YWNA_BACSU RecName: Full=Putative HTH-type transcriptional
    1::101     6e-04  26%  165 aa  ISCR_SODGM RecName: Full=HTH-type transcriptional regulator iscR;
    1::158

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
NSRR_PROMH      MQLTSFTDYGLRALIYMASEGKMTSITEVTQVYGVSRNHMVKIINQLSHMGFVEAIRGKNGGIRLGKPAA
NSRR_BACLD      MKLTNYTDYSLRVLIFLATKNSNVNIKDIADSYSISKNHLMKVIYELGKLGYVETIRGRNGGIRLGKAPE
NSRR_PHOLL      MQLTSFTDYGLRALIYMASQSRMTSISEVTDIYGVSRNHMVKIINQLSHLGLVDAVRGKNGGIRLGKPAK
NSRR_ENT38      MQLTSFTDYGLRALIYMASQGQMTSISQVTEVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAQ
NSRR_BACSU      MKLTNYTDYSLRVLIFLAAEGELSNIKQIAETYSISKNHLMKVIYRLGQLGYVETXXXXXXXXXXXMDPE
NSRR_ERWCT      MQLTSFTDYGLRALIYMASSGKMTSISEVTEVYGVSRNHMVKIINQLSRAGLVMAVRGKNGGIRLGK-PA
NSRR_SALTY      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALTI      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYDVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALSV      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALPK      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALPB      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALPA      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALHS      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALG2      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALEP      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALCH      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_SALA4      MQLTSFTDYGLRALIYMASDGRMTSISEVTEVYGVSRNHMVKIINQLSRAGFVTAVRGKNGGIRLGK-PA
NSRR_PECCP      MQLTSFTDYGLRALIYMASLGKMTSISEVTEVYGVSRNHMVKIINQLSRAGLVMAVRGKNGGIRLGK-PA
NSRR_ECOSE      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKSAS
NSRR_ECOLC      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKSAS
NSRR_ECOHS      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKSAS
NSRR_ECO8A      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKSAS
NSRR_ECO24      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKSAS
NSRR_SHISS      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_SHIFL      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_SHIF8      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_SHIDS      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_SHIBS      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ESCF3      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOUT      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOSM      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOLU      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOLI      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOL6      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOL5      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOK1      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECODH      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECOBW      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO81      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO7I      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO5E      MQLTSFTDYGLRALIYMASEGLMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO57      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO55      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO45      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_ECO27      MQLTSFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
Y846_SYNY3      MKLTTKSHYSVKALLDLALQPDPASVKAIAERQNIPGPYLEKLLITLRRAGIVNAYRGVRGGYQLAQAPD
NSRR_KLEP7      MQLTSFTDYGLRALIYMASEGRMTSISEVTEVYGVSRNHMVKIINQLSRMGYVTAVRGKNGGIRLGKPAG
NSRR_KLEP3      MQLTSFTDYGLRALIYMASEGRMTSISEVTEVYGVSRNHMVKIINQLSRMGYVTAVRGKNGGIRLGKPAG
RRF2_DESVH      MKLTTRSRYGTRMLLDIAMHGSEVSIKDIAQRQGISVKYLEKLIRVLRKAGYITSTLGAHGGYQLAHKAE
NSRR_GEOKA      MQLTNYTEYALRVLLFLGAEEEKTNIKDIAAAFSISEHHLSKIVYELGKLGYIETIRGRNGGIRLAKRPA
NSRR_YERPS      MQLTSFTDYGLRALIYMASDGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
NSRR_YERPN      MQLTSFTDYGLRALIYMASDGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
NSRR_YERPE      MQLTSFTDYGLRALIYMASDGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
NSRR_YERPA      MQLTSFTDYGLRALIYMASDGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
NSRR_YERP3      MQLTSFTDYGLRALIYMASDGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
NSRR_SHIB3      MQLTNFTDYGLRALIYMASEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPAS
NSRR_YERE8      MQLTSFTDYGLRALTYMASEGQMTSISQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGK-PA
Y1318_MYCBO     MRMSAKAEYAVRAMVQLAASGTVVKTDDLAAAQGIPPQFLVDILTNLRTDRLVRSHRGREGGYELARPGT
Y1287_MYCTU     MRMSAKAEYAVRAMVQLAASGTVVKTDDLAAAQGIPPQFLVDILTNLRTDRLVRSHRGREGGYELARPGT
NSRR_SERP5      MQLTSFTDYGLRALIYMASPDKMTSISEVTEVYGVSRNHMVKIINQLSRVGFVTAVRGKNGGIRLGKPAE
NSRR_BACSK      ------------------------SVKQVADIYRISYNHLTKVTHELGKLGLIETIKGRNGGIRLAKEPE
ISCR_PHOLL      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
BADM_RHOPA      MRLQKSTMCGLYAVLELAANDRQVSAGDIADKYDISLNHLAKVLRALVRARLIESVRGPGGGYRFAGNPK
NSRR_PHOPR      MQLTSFTDYGLRALIYLATEGELTSISKVTEVYGVSRNHMVKIINKLGQLGYVDTVRGKNGGIRLGM-PA
AAU3_RHIME      MRLTKQTNYAVRMLMYCAANGEKLSRPEIARAYGVSELFLFKILQPLTRAGLVETVRGRNGGVRLPRPAS
Y1593_NEIMA     MRLTTKGRFAVTAMLDLAMNAQTGAVKAISERQNISLSYLEQLFGKLRRAGLVESLRGPGGGYXXXXXXX
Y1378_NEIMB     MRLTTKGRFAVTAMLDLAMNAQTGAVKAISERQNISLSYLEQLFGKLRRAGLVESLRGPGGGYXXXXXXX
NSRR_ALISL      MQLTNFTDFGLRALIYLASKGELTSITVVTETFDVSRNHMVKIINKLGQEGFIKTVRGKNGGICLGR-PA
ISCR_SERP5      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_PHOPR      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKAGLVASVRGPGGGYRLGEDAN
NSRR_VIBFM      MQLTNFTDFGLRALIYLGSEGELTSITVVTETFDVSRNHMVKIINKLGQEGYVKTIRGKNGGICLGK-PA
NSRR_VIBF1      MQLTNFTDFGLRALIYLGSEGELTSITVVTETFDVSRNHMVKIINKLGQEGYVKTIRGKNGGICLGK-PA
ISCR_XENNE      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGRDAG
ISCR_VIBSL      MKLTSKGRYAVTAMLDVASQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGAEAS
ISCR_ALISL      MKLTSKGRYAVTAMLDVAAQEGPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGLKPD
ISCR_YERPS      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERPP      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERPN      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERPG      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERPE      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERPA      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERP3      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_YERE8      MRLTSKGRYAVTAMLDVASQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAS
ISCR_KLEP3      MRLTSKGRYAVTAMLDVALNSETVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
CYMR_BACSU      MKISTKGRYGLTIMIELAGEGPT-SLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIRGAYGGYVLGSEPD
NSRR_VIBHB      MQLTSFTDYALRTLIYLASKDELTNITEVTDLFGVSRNHMVKVINRLGQLGYVHTVRGKNGGIRLMKAPQ
ISCR_KLEP7      MRLTSKGRYAVTAMLDVALNSETVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_VIBVY      MKLTSKGRYAVTAMLDVASQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGADAF
ISCR_VIBVU      MKLTSKGRYAVTAMLDVASQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGADAF
YOR2_AZOVI      MRLTTKGRYAVTAMLDLAAQNGPVSLADISERQGISLSYLEQLFAKLRRNSLVTSVRGPGGGYQLSRSMA
NSRR_BACHD      ------------------------SVKQVATIYNISYNHLTKVTYELGKLGLIETIKGRNGGIRLAKAPE
ISCR_ENT38      MRLTSKGRYAVTAMLDVALNSETVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
Y379_HAEIN      MKLTSKGRYAVTAVLDIAADGGPVSLADISERQHISLSYLEQLFAKLRKDGLVKSVRGPGGGYQLGLPSE
NSRR_OCEIH      MNLKKYTDYALRVLIFLKSDQELANIKEIAEVYQISQEHLRKVVHELTKMELVVTIRGRNGGIKLAKPAS
ISCR_VIBPA      MKLTSKGRYAVTAMLDVASQQNPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGADAH
ISCR_VIBHB      MKLTSKGRYAVTAMLDVASQQNPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGADAH
ISCR_VIBCH      MRLTSKGRYAVTAMLDVASQQNPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGGYRLGMDSY
ISCR_ERWCT      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKNAN
NSRR_VIBVY      MQLTSFTDYALRTLIYLASDNEQTNITDVTELFGVSRNHMVKVINRLGQLNYIQTVRGKNGGIRLNR-PA
NSRR_VIBVU      MQLTSFTDYALRTLIYLASDNEQTNITDVTELFGVSRNHMVKVINRLGQLNYIQTVRGKNGGIRLNR-PA
NSRR_VIBPA      MQLTSFTDYALRTLIYLASKDELTNITEVTDLFGVSRNHMVKVINRLGQLGYVHTVRGKNGGIRLMKPAS
ISCR_SHISS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SHIFL      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SHIF8      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SHIDS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SHIBS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SHIB3      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ESCF3      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOUT      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOSM      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOSE      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOLU      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOLI      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOLC      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOL6      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOL5      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOK1      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOHS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECODH      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECOBW      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO8A      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO81      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO7I      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO5E      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO57      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO55      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO45      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO27      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_ECO24      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAS
ISCR_SALTY      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALTI      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALSV      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALPK      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALPC      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALPB      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALPA      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALNS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALHS      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALG2      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALEP      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALDC      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALCH      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALAR      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_SALA4      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_PECCP      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKSAN
ISCR_EDWI9      MRLTSKGRYAVTAMLDVASQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKETS
ISCR_CITK8      MRLTSKGRYAVTAMLDVASEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDAG
ISCR_ENTS8      MRLTSKGRYAVTAMLDVASESGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKDAG
YFFB_LACLA      MKLSSGWEQSVYVLLILARENRTMSSIALANRLKVSPSYLKKIIKSLVDEGLLRSTPGKNGGFSLNKELH
Y166_RHOCA      --------------------------EEIATRSGTPKRFLEHILLDLRKAGVVASIRGRSGGYSLLKAPR
YWGB_BACSU      ------------------------TSEAISQRLRVSPSYLKKLMRTLVQAGLAESLPGTKGGFTLTKPLA
Y268_AQUAE      --------------------------EEIAKVHKIPRPFLAKVMHELSKRGVVYSVKGPRGGFSLAKEPD
ISCR_ERWT9      MRLTSKGRYAVTAMLDVALHSHEVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLGKAAD
YWNA_BACSU      -------------ILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGA-SLKKDPA
ISCR_SODGM      MRLTSKGRYAVTAMLDVALHSGKVPLAEISERQGISLSYLEQLFSRLRKHELVASVRGPGGGYLLGRDSD


                         .         .         *         .         .         .         .:140
query           DTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEESMDAYLSSLTVQMLLDCARNGDNSRT
NSRR_PROMH      DIIVGEVVRALE----------------------------------------------------------
NSRR_BACLD      LINIGEVIRHTEDDF--NLVECFNGEKNHCILSPICGLKHVLNKALSAYLDVLDQYTLQDIIMNQDHIRK
NSRR_PHOLL      DIRIGDVVRALE----------------------------------------------------------
NSRR_ENT38      SIRVGDVVRELE----------------------------------------------------------
NSRR_BACSU      DINIGEVVRKTEDDF--NIVECFDANKNLCVISPVCGLKHVLNEALLAYLAVLDKYTLRDLVKNKED---
NSRR_ERWCT      ET--------------------------------------------------------------------
NSRR_SALTY      NT--------------------------------------------------------------------
NSRR_SALTI      NT--------------------------------------------------------------------
NSRR_SALSV      NT--------------------------------------------------------------------
NSRR_SALPK      NT--------------------------------------------------------------------
NSRR_SALPB      NT--------------------------------------------------------------------
NSRR_SALPA      NT--------------------------------------------------------------------
NSRR_SALHS      NT--------------------------------------------------------------------
NSRR_SALG2      NT--------------------------------------------------------------------
NSRR_SALEP      NT--------------------------------------------------------------------
NSRR_SALCH      NT--------------------------------------------------------------------
NSRR_SALA4      NT--------------------------------------------------------------------
NSRR_PECCP      ET--------------------------------------------------------------------
NSRR_ECOSE      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOLC      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOHS      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO8A      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO24      AIRIGDVVRELE----------------------------------------------------------
NSRR_SHISS      AIRIGDVVRELE----------------------------------------------------------
NSRR_SHIFL      AIRIGDVVRELE----------------------------------------------------------
NSRR_SHIF8      AIRIGDVVRELE----------------------------------------------------------
NSRR_SHIDS      AIRIGDVVRELE----------------------------------------------------------
NSRR_SHIBS      AIRIGDVVRELE----------------------------------------------------------
NSRR_ESCF3      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOUT      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOSM      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOLU      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOLI      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOL6      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOL5      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOK1      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECODH      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECOBW      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO81      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO7I      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO5E      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO57      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO55      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO45      AIRIGDVVRELE----------------------------------------------------------
NSRR_ECO27      AIRIGDVVRELE----------------------------------------------------------
Y846_SYNY3      QISLGQILAALEE---------------------------------------------------------
NSRR_KLEP7      QIRVGDVVRDLE----------------------------------------------------------
NSRR_KLEP3      QIRVGDVVRDLE----------------------------------------------------------
RRF2_DESVH      DIPVGDVVYALEE---------------------------------------------------------
NSRR_GEOKA      EIVIGAVVRETEENL--SLVECFAAHGNECVLTPVCRLRFALHEALEAFLRVLDAYTLADLLEDRASLRS
NSRR_YERPS      D---------------------------------------------------------------------
NSRR_YERPN      D---------------------------------------------------------------------
NSRR_YERPE      D---------------------------------------------------------------------
NSRR_YERPA      D---------------------------------------------------------------------
NSRR_YERP3      D---------------------------------------------------------------------
NSRR_SHIB3      AIRIGDVVRELE----------------------------------------------------------
NSRR_YERE8      D---------------------------------------------------------------------
Y1318_MYCBO     EISIADVLRCID----------------------------------------------------------
Y1287_MYCTU     EISIADVLRCID----------------------------------------------------------
NSRR_SERP5      TIRLGDVVRALE----------------------------------------------------------
NSRR_BACSK      EINIGEVVKQTEDNLELVECFNRETNT--CILNPACRLKGVLHEALAAYLQVLEQYTVKDLVLNEDDLRA
ISCR_PHOLL      EIVVAEVIFAVDESVDATRCQGREGCQGGDRCLTHALWRDL-SDRITGFLSSISLQEVLDVAGRQDNDK-
BADM_RHOPA      RVTLLDIIALFEDTGLDLQEAASDDHEESRALHKVLRDIDEIAMTTLRSVSITSLLKVIDTER-------
NSRR_PHOPR      NRIIL-----------------------------------------------------------------
AAU3_RHIME      EITLFDVVKVTED---------------------------------------------------------
Y1593_NEIMA     XXXXXXXXXXXEDDATQ-CGSKANCHHGAPCLTH--DLWENLNKTINDYLGSVTLQSIIEQKNNGDGSR-
Y1378_NEIMB     XXXXXXXXXXXEDDATQ-CGSKANCHHGAPCLTH--DLWENLNKTINDYLGSVTLQSIIEQKNNGDGSR-
NSRR_ALISL      DQIIIEVIRSIE----------------------------------------------------------
ISCR_SERP5      EIAVGAVITAVDESVDATRCQGKEGCQGGDRCLTHTLWRDL-SERISGFLNNITLAELVN-----NQDVL
ISCR_PHOPR      DIAVGMVIAAVDESVDATKCHGKADCQGGVRCLTHTLWHDL-SSRISGFLNNITLGELM-----------
NSRR_VIBFM      DQIIIDVIRAIE----------------------------------------------------------
NSRR_VIBF1      DQIIIDVIRAIE----------------------------------------------------------
ISCR_XENNE      RIFVAEVISAVDESVDATRCQGKEGCQGGDRCLTHALWRDL-SERITSFLGSISLEELV-----------
ISCR_VIBSL      DIAVGTVIAAVDESVDATKCHGRADCQGGTRCLTHTLWRDL-SSRISSFLNDITLGELM-----------
ISCR_ALISL      EIAVGMVISAVDESVDATKCHGKEGCQGG-----------------------------------------
ISCR_YERPS      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERPP      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERPN      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERPG      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERPE      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERPA      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERP3      AIAVGAVITAVDESVDATRCQGKEGCQGGNRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_YERE8      AIAVGAVITAVDESVDATRCQGKEGCQGGDRCLTHTLWRDL-SERISSFLNNITLQDILEVAQNNDTRRT
ISCR_KLEP3      SIAVGEVISAVDESV-DATRXXXXXXXXXXXXXLTHALWRDLSERLTGFLNNITLGELVN----------
CYMR_BACSU      AITAGDIIRVLE----------------------------------------------------------
NSRR_VIBHB      EITVGGVVRDLE----------------------------------------------------------
ISCR_KLEP7      SIAVGEVISAVDESV-DATRXXXXXXXXXXXXXLTHALWRDLSERLTGFLNNITLGELVN----------
ISCR_VIBVY      TISIGTVIAAVDESVDATKCQGKGDCQGGTRCLTHTLWRDLSSRITD-FLNNITLGELM-----------
ISCR_VIBVU      TISIGTVIAAVDESVDATKCQGKGDCQGGTRCLTHTLWRDLSSRITD-FLNNITLGELM-----------
YOR2_AZOVI      AIQVAEVIDAVNESV-DVTRCQGD----------------------------------------------
NSRR_BACHD      EINIGAVVKQTEDNLELVECFNHETNT--CILNPVCRLKGVLHEALTAYLRVLEQYTLKDLLTNEDELQA
ISCR_ENT38      SIAVGEVISAVDESV-DATRXXXXXXXXXXXXXLTHALWRDLSDRLTGFLNNITLQEVLDVSGRQQSHET
Y379_HAEIN      QISVGMIIAAVNENIHVTKCLGRENCKNGVECL-THELWEDLSLRIESFLNEITLAELVN----------
NSRR_OCEIH      EINIGLLIRQLEND--------------------------------------------------------
ISCR_VIBPA      SIAIGTVIAAVDESVDATKCQGKGDCQGGTRCLTHTLWRDLSSRISD-FLNNITLGELM-----------
ISCR_VIBHB      SIAIGTVIAAVDESVDATKCQGKGDCQGGTRCLTHTLWRDLSSRISD-FLNNITLGELM-----------
ISCR_VIBCH      AISIGTVIAAVDESVDATKCNGKGDCQGGTRCLTHTLWRDLSSRITD-FLNNITLGELM-----------
ISCR_ERWCT      EIAVGMVISAVDESVDATRCQGRESCQGGDRCLTHTLWRDLSDRITD-FLNNITLDELVN----------
NSRR_VIBVY      KTEVVRDLEPLD----------------------------------------------------------
NSRR_VIBVU      KTEVVRDLEPLD----------------------------------------------------------
NSRR_VIBPA      EITVGGVVRDLE----------------------------------------------------------
ISCR_SHISS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SHIFL      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SHIF8      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SHIDS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SHIBS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SHIB3      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ESCF3      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOUT      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOSM      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOSE      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOLU      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOLI      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOLC      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOL6      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOL5      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOK1      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOHS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECODH      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECOBW      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO8A      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO81      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO7I      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO5E      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO57      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO55      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO45      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO27      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ECO24      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALTY      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALTI      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALSV      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALPK      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALPC      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALPB      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALPA      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALNS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALHS      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALG2      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALEP      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALDC      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALCH      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALAR      SIAVGEVISAVDE---------------------------------------------------------
ISCR_SALA4      SIAVGEVISAVDE---------------------------------------------------------
ISCR_PECCP      EIAVGMVISAVDESVDATRCQGREGCQGGDRCLTHTLWRDLSDRITD-FLNNITLDELVN----------
ISCR_EDWI9      EIAIGAVITAVDESVDATRCQGKEGCQGGTRCLTHTLWRDL-SERISGFLNNISLAELVN----------
ISCR_CITK8      SIAVGEVISAVDE---------------------------------------------------------
ISCR_ENTS8      QIAVGEVISAVDE---------------------------------------------------------
YFFB_LACLA      DISFYDVFLAIEGRGRQSQGLLQNSESGKAKRCAITSALDEIENTLVRTLSNVSLAQVAD----------
Y166_RHOCA      DVSISELVRRID----------------------------------------------------------
YWGB_BACSU      DITLYDVYQAVE----------------------------------------------------------
Y268_AQUAE      KITIWDIIELFGDAYK------------------------------------------------------
ISCR_ERWT9      AIAVGAVITAVDESVDATKCQGKEGCQGGERCLTHVLWRDLSERISD-FLNNITLAELVN----------
YWNA_BACSU      DISLLEVYRAVQKQEELFAVHENPNPKGKKIQNALDETFESVQRAMENELASKSLKDVMN----------
ISCR_SODGM      QIAVGAVITAVDESVDATRCQGKEGCQGG-----------------------------------------


                         +         .         .         .         .         *         .:210
query           FLAERLQEESRRxxxxxx
NSRR_PROMH      ------------------
NSRR_BACLD      LLS---------------
NSRR_PHOLL      ------------------
NSRR_ENT38      ------------------
NSRR_BACSU      ------------------
NSRR_ERWCT      ------------------
NSRR_SALTY      ------------------
NSRR_SALTI      ------------------
NSRR_SALSV      ------------------
NSRR_SALPK      ------------------
NSRR_SALPB      ------------------
NSRR_SALPA      ------------------
NSRR_SALHS      ------------------
NSRR_SALG2      ------------------
NSRR_SALEP      ------------------
NSRR_SALCH      ------------------
NSRR_SALA4      ------------------
NSRR_PECCP      ------------------
NSRR_ECOSE      ------------------
NSRR_ECOLC      ------------------
NSRR_ECOHS      ------------------
NSRR_ECO8A      ------------------
NSRR_ECO24      ------------------
NSRR_SHISS      ------------------
NSRR_SHIFL      ------------------
NSRR_SHIF8      ------------------
NSRR_SHIDS      ------------------
NSRR_SHIBS      ------------------
NSRR_ESCF3      ------------------
NSRR_ECOUT      ------------------
NSRR_ECOSM      ------------------
NSRR_ECOLU      ------------------
NSRR_ECOLI      ------------------
NSRR_ECOL6      ------------------
NSRR_ECOL5      ------------------
NSRR_ECOK1      ------------------
NSRR_ECODH      ------------------
NSRR_ECOBW      ------------------
NSRR_ECO81      ------------------
NSRR_ECO7I      ------------------
NSRR_ECO5E      ------------------
NSRR_ECO57      ------------------
NSRR_ECO55      ------------------
NSRR_ECO45      ------------------
NSRR_ECO27      ------------------
Y846_SYNY3      ------------------
NSRR_KLEP7      ------------------
NSRR_KLEP3      ------------------
RRF2_DESVH      ------------------
NSRR_GEOKA      LLKER-------------
NSRR_YERPS      ------------------
NSRR_YERPN      ------------------
NSRR_YERPE      ------------------
NSRR_YERPA      ------------------
NSRR_YERP3      ------------------
NSRR_SHIB3      ------------------
NSRR_YERE8      ------------------
Y1318_MYCBO     ------------------
Y1287_MYCTU     ------------------
NSRR_SERP5      ------------------
NSRR_BACSK      LLQFKTTEQ---------
ISCR_PHOLL      ------------------
BADM_RHOPA      ------------------
NSRR_PHOPR      ------------------
AAU3_RHIME      ------------------
Y1593_NEIMA     ------------------
Y1378_NEIMB     ------------------
NSRR_ALISL      ------------------
ISCR_SERP5      VVADRQNNDTRR------
ISCR_PHOPR      ------------------
NSRR_VIBFM      ------------------
NSRR_VIBF1      ------------------
ISCR_XENNE      ------------------
ISCR_VIBSL      ------------------
ISCR_ALISL      ------------------
ISCR_YERPS      ------------------
ISCR_YERPP      ------------------
ISCR_YERPN      ------------------
ISCR_YERPG      ------------------
ISCR_YERPE      ------------------
ISCR_YERPA      ------------------
ISCR_YERP3      ------------------
ISCR_YERE8      ------------------
ISCR_KLEP3      ------------------
CYMR_BACSU      ------------------
NSRR_VIBHB      ------------------
ISCR_KLEP7      ------------------
ISCR_VIBVY      ------------------
ISCR_VIBVU      ------------------
YOR2_AZOVI      ------------------
NSRR_BACHD      LL----------------
ISCR_ENT38      QRTTRAQD----------
Y379_HAEIN      ------------------
NSRR_OCEIH      ------------------
ISCR_VIBPA      ------------------
ISCR_VIBHB      ------------------
ISCR_VIBCH      ------------------
ISCR_ERWCT      ------------------
NSRR_VIBVY      ------------------
NSRR_VIBVU      ------------------
NSRR_VIBPA      ------------------
ISCR_SHISS      ------------------
ISCR_SHIFL      ------------------
ISCR_SHIF8      ------------------
ISCR_SHIDS      ------------------
ISCR_SHIBS      ------------------
ISCR_SHIB3      ------------------
ISCR_ESCF3      ------------------
ISCR_ECOUT      ------------------
ISCR_ECOSM      ------------------
ISCR_ECOSE      ------------------
ISCR_ECOLU      ------------------
ISCR_ECOLI      ------------------
ISCR_ECOLC      ------------------
ISCR_ECOL6      ------------------
ISCR_ECOL5      ------------------
ISCR_ECOK1      ------------------
ISCR_ECOHS      ------------------
ISCR_ECODH      ------------------
ISCR_ECOBW      ------------------
ISCR_ECO8A      ------------------
ISCR_ECO81      ------------------
ISCR_ECO7I      ------------------
ISCR_ECO5E      ------------------
ISCR_ECO57      ------------------
ISCR_ECO55      ------------------
ISCR_ECO45      ------------------
ISCR_ECO27      ------------------
ISCR_ECO24      ------------------
ISCR_SALTY      ------------------
ISCR_SALTI      ------------------
ISCR_SALSV      ------------------
ISCR_SALPK      ------------------
ISCR_SALPC      ------------------
ISCR_SALPB      ------------------
ISCR_SALPA      ------------------
ISCR_SALNS      ------------------
ISCR_SALHS      ------------------
ISCR_SALG2      ------------------
ISCR_SALEP      ------------------
ISCR_SALDC      ------------------
ISCR_SALCH      ------------------
ISCR_SALAR      ------------------
ISCR_SALA4      ------------------
ISCR_PECCP      ------------------
ISCR_EDWI9      ------------------
ISCR_CITK8      ------------------
ISCR_ENTS8      ------------------
YFFB_LACLA      ------------------
Y166_RHOCA      ------------------
YWGB_BACSU      ------------------
Y268_AQUAE      ------------------
ISCR_ERWT9      ------------------
YWNA_BACSU      ------------------
ISCR_SODGM      ------------------