[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54171.1

[Show Plain Result]


## Summary of Sequence Search
    1::389
    3::325     1e-55  42%  335 aa  KIPA_BACSU RecName: Full=KipI antagonist;         Short=Protein
    2::306     4e-49  38%  310 aa  YBGK_ECOLI RecName: Full=Uncharacterized protein ybgK;
   12::293     1e-47  38%  309 aa  Y1730_HAEIN RecName: Full=Uncharacterized protein HI1730;
 1085::1431    7e-35  33% 1835 aa  DUR1_YEAST RecName: Full=Urea amidolyase;Includes:  RecName:
  470::776     9e-30  34% 1241 aa  LAMA_EMENI RecName: Full=Putative urea carboxylase;       
 1075::1427    1e-29  32% 1830 aa  DUR1_SACKL RecName: Full=Urea amidolyase;AltName: Full=Uracil
    1::389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLVVKKPGVITTIQDVGRFGYQGSGFSTNGVMDHRAFAIANLLVENDPGAPVLEFALAGPTVRFTTNTC
KIPA_BACSU      ----VLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGNGENEAGLEITMMGPSFHFSKQTL
YBGK_ECOLI      --LKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQLTVEFETDGW
Y1730_HAEIN     ------------TIQDLGRFGLRRFGISHCGAMDKLALRAGNILLGNAENVPAIEVPLGGITLQFQQDMN
DUR1_YEAST      -------PGAHTSIQDYGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETV
LAMA_EMENI      --------GAYTLIQDWPGRPTVGRGFCHSGPMDSVAFRIANALVGNPVGLEGLEITLSGPELRFLGPAV
DUR1_SACKL      ----VTSPGAYTTVQDYGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETX


                         .         .         *         .         .         .         .:140
query           FAITGGDFAPTLDGEPVPMYAAVMVRRGSILRFKASRTGCYGYLAIAGNSVRVPEVMGSRSTNLKCEFGG
KIPA_BACSU      IAVTGADFTLRINDEEAPLWKPVLIKENSTVSFGPCKLGSRAYLAAAGG-IEVPAVMESKSTYVRGSIGG
YBGK_ECOLI      FALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKRPQHGMRSYLAVAGG-IDVPPVMGSCSTDLKVGIGG
Y1730_HAEIN     FCVTGAFYEMMLDDKPVFAYWRYQVRAGQILKMARAKIGMYGYLCVQGGFV-LPQALNSCSTDLRAQIGG
DUR1_YEAST      IAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRG-GIDVPKYLGSYSTFTLGNVGG
LAMA_EMENI      ISLCGAPIDAKLDEAPVPMWSRVKVSAGQRLKIKTTGGGCRAYLAVLGGFPNIAEWFGSKATAPMVGVGG
DUR1_SACKL      XXXXXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRG-GIDVPEYLGSRSTFALGNMGG


                         +         .         .         .         .         *         .:210
query           WKGRTLIVGDYLPFSTKSVDFLPNLGSHRIDGDNEFYGFDRDEITVRVVPGPQQDMFTDKGLATFYGQAY
KIPA_BACSU      LHGRALQKEDELEMSALSQTILSRLSSQL--GKQGFWSVSRGRFVIRVLEGKQFAFFTEESKTRFYEEAF
YBGK_ECOLI      LEGRLLKDGDRLPIGKSKRDSMEAQGVKQLLWGNR----------IRALPGPEYHEFDRASQDAFWRSPW
Y1730_HAEIN     IEGRCLQAGDQLQTANDHI-LRSEIGIAPIPL--------RD--VIRALPSSEYQAFKRKSQYYWWRNEW
DUR1_YEAST      YNGRVLKLGDFLPSNNKSVECLPNIPQSLIPQISETKEW---RIGVTCGPHGSPDFFKPESIEEFFSEKW
LAMA_EMENI      YQGRQLTSGDYLTISAQ----IP-------ESDNELSLPEHDSWELMSMPGPYDEGYAPESIDMLYNAEW
DUR1_SACKL      YNGRVLKLGDVLFLNQ------PELASSSLPGPNLLPKISDDEWTIGVTCGPSPDFFKPESVEEFFSEKW


                         .         .         .         +         .         .         .:280
query           TTTTKCDRMGYRLDGPEIETKHGSDIISDGVAFGAVQVPSHGRPIIMLADRQTTGGYAKIGTIASVDIPK
KIPA_BACSU      RVTPQSDRMGYRLKGEPLELKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRIAHIISADLPI
YBGK_ECOLI      QLSSQSNRMGYRLQGQILKRTTDRELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYH
Y1730_HAEIN     TLQSNSDRMGYRFQGQTLELKQPLEMLSHAIQFGSVQVPPSGQPIILMADAQTTGGYPKIANVIDADLGA
DUR1_YEAST      KVHYNSNRFGVRLIGPKPKGMHPSNTHDYVYSLGAINF-TGDEPVIITCDGPSLGGFVCQAVVPEAELWK
LAMA_EMENI      TISHNAARGGIRLLGPKPTGAHPSNLIECGYAIGSINWTGDD-PVIFPQDAPDLGGFVSSHTIVKADLWK
DUR1_SACKL      KVHYNSNRFGVRLIGPKPKWAHPSNAHDYVYSLGAINF-TGDEPVIITSDGPSLGGFVCQAVVPEAELWK


                         .         *         .         .         .         .         +:350
query           LVQRPPGGKIRFESIGVQEAQALLREEAHLFEMLALKVRRPSADGISPRRTARRLTPILEEQARKSQxxx
KIPA_BACSU      VSQIMPGEHVQFEPVSLQEAEALVEREQHIKEL-------------------------------------
YBGK_ECOLI      LAQIPLGQPIHFVQCSLEEALKARQDQQRYFEQLAWRL--------------------------------
Y1730_HAEIN     LAQVRLGSTIKFEAVSLQEAAKLRRK--------------------------------------------
DUR1_YEAST      VGQVKPGDSIQFVPLSYESSRSLKESQDVAIKSLGTKLRRLDSVSILPSFE----TPILAQMEKVNE---
LAMA_EMENI      LGQVKAGDKLKFRATSLKDT-LLARNELERF---------------------------------------
DUR1_SACKL      VGQVKPGDSIQFVPISYQVARQLKESQDAAIETLEGKLQTLTSDLILPTYE----DPVLVQLPKKS----


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KIPA_BACSU      ---------------------------------------
YBGK_ECOLI      ---------------------------------------
Y1730_HAEIN     ---------------------------------------
DUR1_YEAST      ---------------------------------------
LAMA_EMENI      ---------------------------------------
DUR1_SACKL      ---------------------------------------