[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54358.1

[Show Plain Result]


## Summary of Sequence Search
    1::589
  106::554     1e-21  28%  588 aa  FRD2_SHEFN RecName: Full=Fumarate reductase flavoprotein subunit;  
  191::562     3e-13  28%  596 aa  FRDA_SHEON RecName: Full=Fumarate reductase flavoprotein subunit;  
  261::566     5e-13  25%  571 aa  FRDA_SHEFR RecName: Full=Fumarate reductase flavoprotein subunit;  
  286::591     5e-13  25%  596 aa  FRDA_SHEFN RecName: Full=Fumarate reductase flavoprotein subunit;  
  257::336     1e-05  30%  466 aa  YDEU_ECOLI RecName: Full=Uncharacterized protein ydeU;
  112::300     1e-05  29%  596 aa  TRXR1_DROME RecName: Full=Thioredoxin reductase 1, mitochondrial;  
  440::561     3e-05  40%  573 aa  3O1D_COMTE RecName: Full=3-oxosteroid 1-dehydrogenase;       
  881::967     2e-04  26% 1102 aa  ICSA_SHIFL RecName: Full=Outer membrane protein icsA;Flags:
   27::145     3e-04  31%  431 aa  ORDL_HAEIN RecName: Full=Probable oxidoreductase ordL;       
 1143::1241    4e-04  26% 1371 aa  YUAQ_ECOLI RecName: Full=Uncharacterized protein yuaQ;
   32::60      7e-04  52%  263 aa  THI4_METJA RecName: Full=Putative thiazole biosynthetic enzyme;
  145::184     7e-04  42%  427 aa  THCD_RHOER RecName: Full=Rhodocoxin reductase;         EC=1.18.1.-;
    3::58      7e-04  41%  393 aa  GGR2_METST RecName: Full=Digeranylgeranylglycerophospholipid
    7::53      0.001  36%  610 aa  MNMG_CHLMU RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    1::589

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFE
FRD2_SHEFN      -------------------------------------------------------------------SFD
FRDA_SHEON      ----------------------------------------------------------------------
FRDA_SHEFR      ----------------------------------------------------------------------
FRDA_SHEFN      ----------------------------------------------------------------------
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      ----------------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      ----------------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
FRD2_SHEFN      IKPMPFSDAKKKKSWDTQVLVVGAGSAGFNASLAAKKAGANVILFSGGNSMISAGGMN-AVGTKQQTAHG
FRDA_SHEON      ---------------------------------------------------LAAGGMN-AAETKPQAKLG
FRDA_SHEFR      ----------------------------------------------------------------------
FRDA_SHEFN      ----------------------------------------------------------------------
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     -------------SYDYDLIVIGGGSAGLACAKEAVLNGARVACL-DFVKPTPTLGTKWGVGGTC-VNVG
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      ----------------------------------------------------------HNKYTSYSSRGT
ORDL_HAEIN      ----------LTQIEHADVCVIGAGFFGLSAALELAEKGKKVIVLEGARVGFGASGRSGGQAINGFEE-G
YUAQ_ECOLI      -------------------------------------------------------GNNHSVRTGYHSKGS
THI4_METJA      ---------------EADVVIVGAGPSGLTCARYLAKEGFKVVV--------------------------
THCD_RHOER      ------------------LVVIGAGFIGLEVAAAARKKGLDVTVVEAMDRPMARALSS------------
GGR2_METST      ---------------ETDILVVGAGPSGSLAAKEAALHGADVILIDRKSEIGSPKRCAEGVSKDGLAQLG
MNMG_CHLMU      ---------------EYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTIAKLSCNPAVG--------


                         +         .         .         .         .         *         .:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
FRD2_SHEFN      V----EDKVEWFIEDAMKGGRQQNDIKLVTILAEQSADGVQWLESL--GANLDDLKRSGGARVDRTHRPH
FRDA_SHEON      IEDKKQIMID-----DTMKGGRNINDPELVKVLNNSSDSIDWL----------TSMGADMTDVGRMGGAS
FRDA_SHEFR      ----------------------------------------------------------------------
FRDA_SHEFN      ----------------------------------------------------------------------
YDEU_ECOLI      ISGYSAGLYATWYQNDANKTGAYVDSWALYNWFDNSVSSDNRSADDYDSRGVTASVEGGYTFEAGTFSGS
TRXR1_DROME     CIPMHQASLLGEAVHEAAAYGWNVDEKDWHKLVQNHIKSVNWVVDLRDKK-------VEYINGLGSFV--
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      VSGYTAGLYSSWFQDEKERTGLYMDAWLQYSWFNNTVKGDGLTGEKYSSKGITGALEAGYIYPTIRWTAH
ORDL_HAEIN      IDEYIKETID-IIDERIEKYSIQCDWKKGYATLALNERRMDDLIEM------------------------
YUAQ_ECOLI      VNGYSTGLYATWYADDETHNGAYLDTWAQYGWFDNHVKGDGLPGESWKSKGLTASLETGYAWKIGEFSSN
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      I---------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
FRD2_SHEFN      ----------GGKSSGPE-----IIDTLRKAAKEQGIDTRLSRVVKLVVNDDHSV--VGAVVHGKHTGYY
FRDA_SHEON      ------VNRSHRPTXXXXXXXXXXXXLWDNAVK-RGTDIRLNSRVVRIL--EDASGKVTGVLVK---GEY
FRDA_SHEFR      --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
FRDA_SHEFN      --------------------------LYDNAVK-RNIDLRMNTRGIEVLKDDKGT--VKGILVKGMYKGY
YDEU_ECOLI      EGTLNWYVQ-------------------------------------------------------------
TRXR1_DROME     -DSHTLLAKLKSGER-TITAQTFVIAVGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGA-------
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      NNIDN-----------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      YGNLNWYVQ-------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
FRD2_SHEFN      M--IGAKSVVLATGGYGMNKEMIAYYRPTMKDMTSSNNIT----------ATGDGVLMAKEIGASWVQAH
FRDA_SHEON      TGYIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPG----------ATGDGLDVALQAGAATREYI
FRDA_SHEFR      Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
FRDA_SHEFN      Y-WVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPG----------AVGDGLDVAENAGGALKQYI
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      ----------------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      ----------------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
FRD2_SHEFN      PT---VGKDSRILISETVRGVGAVMVNKDGNRFISELTTRDKASDAILKQPGQFAWIIFDNQLY------
FRDA_SHEON      QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFD----------
FRDA_SHEFR      QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
FRDA_SHEFN      QAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRK-----
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
3O1D_COMTE      ----------------------------------------------------------------------
ICSA_SHIFL      ----------------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      ----------------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
FRD2_SHEFN      ------------KKAKMVRGY-----DHLEM--LYKGDTVEQ-LAKSTGMKVADLAKTVSDYNGYVASGK
FRDA_SHEON      --------DSIRKSLKAIEGYV---HLNIVK----EGKTIEELAKQIDVPAAELA-KTVTAYNGFVKSGK
FRDA_SHEFR      --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
FRDA_SHEFN      --------------------SLSKIDKYIGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
3O1D_COMTE      ---------------------------------------------------------SARRMTEYARAGK
ICSA_SHIFL      ----------------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      ----------------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGDSYAN
FRD2_SHEFN      DTAFGR-ADMPLNMTQSPYYAVKVAPGIHHTM---GGVAINTTASVLDLQSKPIDGLFAAGEVTG-----
FRDA_SHEON      DAQFER-PDLPRELVVAPFYA--LEIAPAVHHTM-GGLVIDTKAEVKSEKGKPITGLYAAGEVTG-----
FRDA_SHEFR      DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
FRDA_SHEFN      DTDFER-PNLPRALNEGNYYA--IEVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTG----G
YDEU_ECOLI      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
3O1D_COMTE      DLDFDRGGNVLGPIEKGPFYAMRLWPGEIG---TKGGLLTDREGRVLDTQGRIIEGLYCVGNNSASVMAP
ICSA_SHIFL      ----------------------------------------------------------------------
ORDL_HAEIN      ----------------------------------------------------------------------
YUAQ_ECOLI      ----------------------------------------------------------------------
THI4_METJA      ----------------------------------------------------------------------
THCD_RHOER      ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
MNMG_CHLMU      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           CYNFAICGHNLGMNCNTFAYMLGKDLAEx
FRD2_SHEFN      -----------------------------
FRDA_SHEON      -----------------------------
FRDA_SHEFR      VHGANRLGGNAISDIITFGRLAGEEAAK-
FRDA_SHEFN      VHGANRLGGNAISDIITFGRLAGEEAAK-
YDEU_ECOLI      -----------------------------
TRXR1_DROME     -----------------------------
3O1D_COMTE      AY--AGAGSTLG-PAMTFAFMVGKPL---
ICSA_SHIFL      -----------------------------
ORDL_HAEIN      -----------------------------
YUAQ_ECOLI      -----------------------------
THI4_METJA      -----------------------------
THCD_RHOER      -----------------------------
GGR2_METST      -----------------------------
MNMG_CHLMU      -----------------------------