[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54398.1

[Show Plain Result]


## Summary of Sequence Search
    1::447
    8::435     2e-51  34%  437 aa  PAAK_ECOLI RecName: Full=Phenylacetate-coenzyme A ligase;       
  339::427     3e-08  44%  503 aa  YDAB_BACSU RecName: Full=Putative acyl--CoA ligase ydaB;       
  442::561     5e-06  30%  578 aa  FAD21_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  442::561     5e-06  30%  578 aa  FAD21_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  434::517     2e-05  39%  606 aa  ACSF2_DANRE RecName: Full=Acyl-CoA synthetase family member 2,
  443::562     1e-04  29%  579 aa  FAD21_MYCLE RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  280::404     1e-04  34%  492 aa  MENE_GEOSW RecName: Full=2-succinylbenzoate--CoA ligase;       
  347::393     2e-04  36%  467 aa  MENE_LISMF RecName: Full=2-succinylbenzoate--CoA ligase;       
  325::453     2e-04  40%  490 aa  MENE_GEOKA RecName: Full=2-succinylbenzoate--CoA ligase;       
  329::413     2e-04  34%  565 aa  4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2;       
  360::406     3e-04  32%  485 aa  MENE_ENTFA RecName: Full=2-succinylbenzoate--CoA ligase;       
  810::886     3e-04  36% 1220 aa  YKL1_SCHPO RecName: Full=Putative cell agglutination protein
  332::411     3e-04  32%  461 aa  VRAA_STAHJ RecName: Full=Putative long chain fatty acid-CoA ligase
  370::457     3e-04  36%  545 aa  LUCI_PHOPE RecName: Full=Luciferin 4-monooxygenase;       
  337::380     4e-04  41%  451 aa  MENE_LACLA RecName: Full=2-succinylbenzoate--CoA ligase;       
  347::387     6e-04  39%  467 aa  MENE_LISMO RecName: Full=2-succinylbenzoate--CoA ligase;       
  266::406     6e-04  26%  562 aa  4CLL9_ARATH RecName: Full=4-coumarate--CoA ligase-like 9;       
  332::376     7e-04  33%  411 aa  VRAA_STAES RecName: Full=Putative long chain fatty acid-CoA ligase
  332::376     7e-04  33%  453 aa  VRAA_STAEQ RecName: Full=Putative long chain fatty acid-CoA ligase
  347::387     7e-04  39%  467 aa  MENE_LISIN RecName: Full=2-succinylbenzoate--CoA ligase;       
  364::404     0.001  39%  478 aa  MENE_BACLD RecName: Full=2-succinylbenzoate--CoA ligase;       
  414::583     0.001  28%  666 aa  BGM_DROME RecName: Full=Very long-chain-fatty-acid--CoA ligase
  363::512     0.001  29%  598 aa  4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6;       
    1::447

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
PAAK_ECOLI      ------------DP-IETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFP
YDAB_BACSU      ----------------------------------------------------------------------
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSF2_DANRE     ----------------------------------------------------------------------
FAD21_MYCLE     ----------------------------------------------------------------------
MENE_GEOSW      ----------------------------------------------------------------------
MENE_LISMF      ----------------------------------------------------------------------
MENE_GEOKA      ----------------------------------------------------------------------
4CLL2_ARATH     ----------------------------------------------------------------------
MENE_ENTFA      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
VRAA_STAHJ      ----------------------------------------------------------------------
LUCI_PHOPE      ----------------------------------------------------------------------
MENE_LACLA      ----------------------------------------------------------------------
MENE_LISMO      ----------------------------------------------------------------------
4CLL9_ARATH     ----------------------------------------------------------------------
VRAA_STAES      ----------------------------------------------------------------------
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
MENE_BACLD      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
4CLL6_ORYSJ     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPN
PAAK_ECOLI      CTTKQDLRDNYPFDTF-----AVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPK
YDAB_BACSU      ----------------------------------------------------------------------
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSF2_DANRE     ----------------------------------------------------------------------
FAD21_MYCLE     ----------------------------------------------------------------------
MENE_GEOSW      ----------------------------------------------------------------------
MENE_LISMF      ----------------------------------------------------------------------
MENE_GEOKA      ----------------------------------------------------------------------
4CLL2_ARATH     ----------------------------------------------------------------------
MENE_ENTFA      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
VRAA_STAHJ      ----------------------------------------------------------------------
LUCI_PHOPE      ----------------------------------------------------------------------
MENE_LACLA      ----------------------------------------------------------------------
MENE_LISMO      ----------------------------------------------------------------------
4CLL9_ARATH     ----------------------------------------------------------------------
VRAA_STAES      ----------------------------------------------------------------------
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
MENE_BACLD      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
4CLL6_ORYSJ     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
PAAK_ECOLI      DKIHVAYGYGLFTGGLGAYGAERLGATVIPMSGGQTEKQAQLIRDFQPDMIMVTPSYCLNLEELERQLGG
YDAB_BACSU      ----------------------------------------------------------------------
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSF2_DANRE     ----------------------------------------------------------------------
FAD21_MYCLE     ----------------------------------------------------------------------
MENE_GEOSW      ----------------------------------------------------------------------
MENE_LISMF      ----------------------------------------------------------------------
MENE_GEOKA      ----------------------------------------------------------------------
4CLL2_ARATH     ----------------------------------------------------------------------
MENE_ENTFA      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
VRAA_STAHJ      ----------------------------------------------------------------------
LUCI_PHOPE      ----------------------------------------------------------------------
MENE_LACLA      ----------------------------------------------------------------------
MENE_LISMO      ----------------------------------------------------------------------
4CLL9_ARATH     -----------------MIRAISLGETLVLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVKSELTKKY
VRAA_STAES      ----------------------------------------------------------------------
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
MENE_BACLD      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
4CLL6_ORYSJ     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
PAAK_ECOLI      D-ASGCSLRVGVFGAEPW--TQAMRKEIERRLGITALDIYGLSEVMGPGVACLETTDGPTIWEDHFYPEI
YDAB_BACSU      ----------------------------------------------------------------------
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSF2_DANRE     --------------------------------------------------------------------KV
FAD21_MYCLE     ----------------------------------------------------------------------
MENE_GEOSW      --------------------------------GIPVYQTYGMTETASQIATLAPEYSGKPLFPSQLRIEK
MENE_LISMF      ----------------------------------------------------------------------
MENE_GEOKA      ----------------------------------------------------------------------
4CLL2_ARATH     ------SLHTV-VAGGAPLSREVTEKFVENYPKVKILQGYGLTESTAIAASMFNKEETKRYGASGLLAKI
MENE_ENTFA      ----------------------------------------------------------------------
YKL1_SCHPO      ------------VLADASGSVTGTVEVVEPAAGTVTTTVYSGSEVYTTLASASESVPG--------TVEV
VRAA_STAHJ      ----------------------------------------------------------------------
LUCI_PHOPE      -------------------------------------------------------------------VKV
MENE_LACLA      ----------------------------------------------------------------------
MENE_LISMO      ----------------------------------------------------------------------
4CLL9_ARATH     DLR---SLRSLGCGGAPLG--KDIAERFKQKFDVDIVQGYGLTESSGPAASTFGPEEMVKYISENMEAKI
VRAA_STAES      ----------------------------------------------------------------------
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
MENE_BACLD      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------KIVDAFGMSETAG-CHTIC--------LPDSVGLNT
4CLL6_ORYSJ     ----------IVVGGAPLGREVSQRFATV-FPSVQIVQSYGLTESTGPVATMAAAYGSVGRLAPRVQAKI


                         .         *         .         .         .         .         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
PAAK_ECOLI      VNPHDGTPLADGEHGELLFTTLTKEALPVIRYRTRDLTRLLPGTARTMRRMDRI--SGRSDDMLIIRGVN
YDAB_BACSU      -DPLTGEELPQGEIGEIVVHTATAKVLQNGWFRTGDSGYVDED--------GFIFITGRYKDVIIYGGDN
FAD21_MYCTU     --------------------------------RTGDLGFLSED---------EMFIVGRMKDMLIVYGRN
FAD21_MYCBO     --------------------------------RTGDLGFLSED---------EMFIVGRMKDMLIVYGRN
ACSF2_DANRE     VDPTTGEIVPLGAQGELMIRGYCEKTRECITYKTGDIASLD--------QFAYCKIEGRIKDLIIRGGEN
FAD21_MYCLE     --------------------------------RTGDLGFISED---------ELFIVGRMKDLLIVYGRN
MENE_GEOSW      ----DGQVARPYEPGEIVYLHRPDATAKAIRFYTGDIGYIDED--------GFLYVLDRRSDLIISGGEN
MENE_LISMF      -------------------------------FKTGDIGYLDEE--------GFLFVLERRSDLIISGGEN
MENE_GEOKA      -----GKPAAPHEAGEIVYWQRPEATAQAIRFFTGDIGYLDED--------GFLYVLDRRSDLIISGGEN
4CLL2_ARATH     VDPDTGRVLGVNQTGEL-----------------------------------------------------
MENE_ENTFA      -------------------------------FKTGDMGYLDAQ--------SYLYLVSRLSELIISGGEN
YKL1_SCHPO      VDPEAGSVTTTIYSGSVEYTTVLADA--------------------------------------------
VRAA_STAHJ      --------------------------QPHSWIETGDYAYIQNN---------QLYLVSRKSDRLIIGGKN
LUCI_PHOPE      VDPTTGKILGPNETGELYYYNNEEATKAIINLRSGDIAYYDND--------GHFYIVDRLKSLIKYKGYQ
MENE_LACLA      -------------------------------FETGDIGYLDTD--------GFLYLLNRRKDIIISGGEN
MENE_LISMO      -------------------------------FKTGDIGYLDEE--------GFLFVVERRSDLIISGGEN
4CLL9_ARATH     VDPSTGESLPPGKTGEL-----------------------------------------------------
VRAA_STAES      --------------------------------KTGDFAYIKNQ---------HLFLVGRESDRIIVGGIN
VRAA_STAEQ      --------------------------------KTGDFAYIKNQ---------HLFLVGRESDRIIVGGIN
MENE_LISIN      -------------------------------FKTGDIGYLDEE--------GFLFVLERRSDLIISGGEN
MENE_BACLD      -------------------------------FKTGDIGYFDDD--------GFLYVLDRRSDLIISGGEN
BGM_DROME       IGKTLGELCIRGRHVFMGYIDNKEKTEESLDLHSGDLGFVDDK--------GYVSLTGRSKEIIITGGEN
4CLL6_ORYSJ     VDTATGEVLGPGRRGELWIEATAATITPDGWLKTGDLCYFNED--------GYLYVVDRLKELIKYKGYQ


                         .         .         .         .         *         .         .:420
query           VFPSDIEYVVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI
PAAK_ECOLI      VFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDSLSVKVELKESSHEQRCQVCHQLRHRIKSMVGI-STDVM
YDAB_BACSU      VYPDQVEEVIQQIPGI------------------------------------------------------
FAD21_MYCTU     HYPEDIESTVQEITG--GRVAAISVPVDHTEKLVTVIELKLLGDDELDVIKNNVTAAISRSHGLNVADLV
FAD21_MYCBO     HYPEDIESTVQEITG--GRVAAISVPVDHTEKLVTVIELKLLGDDELDVIKNNVTAAISRSHGLNVADLV
ACSF2_DANRE     IYPAEIE---------------------------------------------------------------
FAD21_MYCLE     HYPEDIESTVQEIGGRVAAISVPVDETEKLVTI-IEVKKRGDSDQKLVAVKNNITAAISKSHGLNVADLV
MENE_GEOSW      VYPAEIEAVL------------------------------------------------------------
MENE_LISMF      IYPTEIEHVISEYEGV------------------------------------------------------
MENE_GEOKA      VYPAEVEAVLLSHPD--------VEEAGVT-----GVENETWGQVPYAFVASPDEAALRAFCRERLAK--
4CLL2_ARATH     ----------------------------------------------------------------------
MENE_ENTFA      IYPTEVEQVLQAITGI------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
VRAA_STAHJ      IYPNVIEQQVKSLDGIEGEIAVLIYVGNQELDY-------------------------------------
LUCI_PHOPE      VAPAEIEGIL------------------------------------------------------------
MENE_LACLA      IYPKEIEDLVYSL---------------------------------------------------------
MENE_LISMO      IYPTEIEHVI------------------------------------------------------------
4CLL9_ARATH     ----------------------------------------------------------------------
VRAA_STAES      VYPTAIESLIMDIEGI------------------------------------------------------
VRAA_STAEQ      VYPTAIESLIMDIEGI------------------------------------------------------
MENE_LISIN      IYPTEIEHVI------------------------------------------------------------
MENE_BACLD      IYPAEVEAVL------------------------------------------------------------
BGM_DROME       IPPVHIENTIKKLDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKS----------
4CLL6_ORYSJ     VPPAELEHILQ-----------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VYDAGKLGTSSEHKASRFIDERGCVxx
PAAK_ECOLI      IVNCGSI-PRSEGKACRVFDLRNIV--
YDAB_BACSU      ---------------------------
FAD21_MYCTU     LVPPGSIPTTTSGKIRR----------
FAD21_MYCBO     LVPPGSIPTTTSGKIRR----------
ACSF2_DANRE     ---------------------------
FAD21_MYCLE     LVPPGSIPTTTSGKVRR----------
MENE_GEOSW      ---------------------------
MENE_LISMF      ---------------------------
MENE_GEOKA      ---------------------------
4CLL2_ARATH     ---------------------------
MENE_ENTFA      ---------------------------
YKL1_SCHPO      ---------------------------
VRAA_STAHJ      ---------------------------
LUCI_PHOPE      ---------------------------
MENE_LACLA      ---------------------------
MENE_LISMO      ---------------------------
4CLL9_ARATH     ---------------------------
VRAA_STAES      ---------------------------
VRAA_STAEQ      ---------------------------
MENE_LISIN      ---------------------------
MENE_BACLD      ---------------------------
BGM_DROME       ---------------------------
4CLL6_ORYSJ     ---------------------------