[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54452.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    7::285     3e-15  29%  287 aa  DMSC_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
    7::282     6e-15  30%  284 aa  YNFH_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
    2::277     4e-14  26%  279 aa  DMSC_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxDTALGEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAMVGLVASATHL
DMSC_ECOLI      ----------EWPLMIFTVFGQCVAGGFIVLALALLKGDLRAEAQQRVIACMFGLWVLMGIGFIASMLHL
YNFH_ECOLI      ----------EWPLVIFTVLGQCVVGALIVSGIGWFA-AKNDADRQRIVRGMFFLWLLMGVGFIASVMHL
DMSC_HAEIN      -----NTGLYELPLVFFTVLAQSAVGAWLVFTFVLLNE-KNTKSRTYIHKVMFVILALLGIGFIASIMHL


                         .         .         *         .         .         .         .:140
query           GNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQRAWXXXXXXXXXXXXXXXXXX
DMSC_ECOLI      GSPMRAFNSLNRVGASALSNEIASGSIFFAVGGIGWLLAMLKKLSPALRTLWIVTMVLGVIFVWMMVRVY
YNFH_ECOLI      GSPLRAFNSLNRIGASGLSNEIAAGSIFFAVGGLWWLVAVIGKMPQALGKLWLLFSMALGVIFVWMMTCV
DMSC_HAEIN      GLPIRAFNSLNRVGSSMMSNEIAAGAIFFTLAGFYWLIAILGKMPVSLGNVWRIVTALIGILFMYVMNQV


                         +         .         .         .         .         *         .:210
query           XXXDTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYEPVEGRMGRXXXXXXXXXXXXXXXXFGVQGA
DMSC_ECOLI      NSIDTVPTWYSIWTPMGFFLTMFM---XXXXXXXXXXXXXXVDGWAMRLLPAIXXXXXXXXXXXXXMQGA
YNFH_ECOLI      YQIDTVPTWHNGYTTLAFFLTVLLSGPXXXXXXXXXXXVT----FNTTPFAIISVLALIACAGVIVLQGL
DMSC_HAEIN      YHITSIPTWNNALTSWSFYLTVVLGGLTLSYALL-------IPNKQREYQLQHLPSLFAIGVSLVAIQGF


                         .         .         .         +         .         .         .:280
query           DLASIENSYLTAAELVPSYGLMVCAFGVLGMAGIGLDAVELWPXXXXXXXXXXXXXXXXXXXXIFVMRFA
DMSC_ECOLI      ELATIHSSVQQAAALVPDYGALM-SWRIVLLA----VALCLWIAPQLKGYQPAVPLLSVSFILLLIGRGV
YNFH_ECOLI      SLASIHSSVQQASALVPDYASLQVWRVVLLCAGLGCWLCPL-IRRREPHVAXXXXXXXXXXXXXXXXRVL
DMSC_HAEIN      NLHNIHSAIQNAADLVPNYAIMIVAFLLFRVKNIGLLGISVLLTLVAEG----------------IGRVL


                         .         *         .         .         .         .         +:350
query           FYMMHMTVGLGV
DMSC_ECOLI      FYGLHMTVGMAV
YNFH_ECOLI      FYGLHMTVGMAI
DMSC_HAEIN      FYGLHMTYGMTI