[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54563.1

[Show Plain Result]


## Summary of Sequence Search
    1::474
  120::195     4e-07  38%  199 aa  DESR_BACSU RecName: Full=Transcriptional regulatory protein desR;
  821::873     8e-07  40%  882 aa  Y914_MYCBO RecName: Full=Putative HTH-type transcriptional
  821::873     8e-07  40%  882 aa  Y890_MYCTU RecName: Full=Putative HTH-type transcriptional
  148::199     3e-06  46%  210 aa  YGEK_ECOLI RecName: Full=Putative uncharacterized response
  148::199     3e-06  46%  210 aa  YGEK_ECO57 RecName: Full=Uncharacterized response regulatory
  138::217     4e-06  36%  229 aa  DEGU_BACSU RecName: Full=Transcriptional regulatory protein
  122::197     8e-06  30%  200 aa  YVFU_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  173::224     2e-05  38%  236 aa  DEGU_BREBE RecName: Full=Transcriptional regulatory protein degU;
  155::207     2e-05  38%  217 aa  NREC_STACT RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     4e-05  38%  217 aa  NREC_STAHJ RecName: Full=Oxygen regulatory protein nreC;AltName:
  839::897     4e-05  36%  904 aa  MALT_SERP5 RecName: Full=HTH-type transcriptional regulator
  142::191     7e-05  34%  200 aa  YHJB_ECOLI RecName: Full=Putative HTH-type transcriptional
  150::199     7e-05  42%  211 aa  LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR;
  147::198     9e-05  38%  214 aa  YHCZ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  162::213     9e-05  37%  227 aa  MOAR_KLEAE RecName: Full=Monoamine regulon transcriptional
  839::897     9e-05  36%  903 aa  MALT_YERPY RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERPS RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERPP RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERPE RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERPB RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERPA RecName: Full=HTH-type transcriptional regulator
  839::897     9e-05  36%  903 aa  MALT_YERP3 RecName: Full=HTH-type transcriptional regulator
  839::897     1e-04  32%  902 aa  MALT_VIBCH RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALTY RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALTI RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALSV RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALPK RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALPB RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALPA RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALNS RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALHS RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALG2 RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALEP RecName: Full=HTH-type transcriptional regulator
  837::895     1e-04  34%  902 aa  MALT_SALDC RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALCH RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALAR RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_SALA4 RecName: Full=HTH-type transcriptional regulator
  836::894     1e-04  34%  901 aa  MALT_ENT38 RecName: Full=HTH-type transcriptional regulator
  156::208     2e-04  36%  218 aa  NREC_STAES RecName: Full=Oxygen regulatory protein nreC;AltName:
  156::208     2e-04  36%  218 aa  NREC_STAEQ RecName: Full=Oxygen regulatory protein nreC;AltName:
  839::897     2e-04  32%  902 aa  MALT_VIBVY RecName: Full=HTH-type transcriptional regulator
  839::897     2e-04  32%  902 aa  MALT_VIBVU RecName: Full=HTH-type transcriptional regulator
  839::890     2e-04  37%  902 aa  MALT_VIBPA RecName: Full=HTH-type transcriptional regulator
  839::890     2e-04  37%  902 aa  MALT_VIBHB RecName: Full=HTH-type transcriptional regulator
  153::213     2e-04  43%  244 aa  CARR_PECCC RecName: Full=Transcriptional activator protein carR;
  155::207     2e-04  36%  217 aa  NREC_STAAW RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAT RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAS RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAR RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAN RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAM RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAE RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAC RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAAB RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAA9 RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAA8 RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAA3 RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAA2 RecName: Full=Oxygen regulatory protein nreC;AltName:
  155::207     2e-04  36%  217 aa  NREC_STAA1 RecName: Full=Oxygen regulatory protein nreC;AltName:
  836::894     2e-04  34%  901 aa  MALT_CITK8 RecName: Full=HTH-type transcriptional regulator
  149::204     2e-04  39%  209 aa  BVGA_BORPE RecName: Full=Virulence factors putative positive
  149::204     2e-04  39%  209 aa  BVGA_BORPA RecName: Full=Virulence factors putative positive
  149::204     2e-04  39%  209 aa  BVGA_BORBR RecName: Full=Virulence factors putative positive
  836::894     3e-04  34%  901 aa  MALT_KLEP7 RecName: Full=HTH-type transcriptional regulator
  836::894     3e-04  34%  901 aa  MALT_KLEP3 RecName: Full=HTH-type transcriptional regulator
  836::894     3e-04  34%  901 aa  MALT_ENTS8 RecName: Full=HTH-type transcriptional regulator
  148::199     4e-04  37%  209 aa  VRAR_STAS1 RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAHJ RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAES RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAEQ RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAW RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAS RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAR RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAN RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAM RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAAC RecName: Full=Response regulator protein vraR;
  148::199     4e-04  37%  209 aa  VRAR_STAA1 RecName: Full=Response regulator protein vraR;
  836::894     4e-04  34%  901 aa  MALT_ESCF3 RecName: Full=HTH-type transcriptional regulator
  836::894     4e-04  34%  901 aa  MALT_ECOLI RecName: Full=HTH-type transcriptional regulator
  836::894     4e-04  34%  901 aa  MALT_ECOLC RecName: Full=HTH-type transcriptional regulator
  836::894     4e-04  34%  901 aa  MALT_ECOHS RecName: Full=HTH-type transcriptional regulator
  836::894     4e-04  34%  901 aa  MALT_ECODH RecName: Full=HTH-type transcriptional regulator
  836::894     4e-04  34%  901 aa  MALT_ECOBW RecName: Full=HTH-type transcriptional regulator
   12::63      4e-04  38%   74 aa  GERE_BACSU RecName: Full=Spore germination protein gerE;
  839::897     5e-04  34%  903 aa  MALT_YERE8 RecName: Full=HTH-type transcriptional regulator
  156::216     5e-04  30%  216 aa  CSGD_SALTY RecName: Full=Probable csgAB operon transcriptional
  156::216     5e-04  30%  216 aa  CSGD_ECOLI RecName: Full=Probable csgAB operon transcriptional
   94::159     6e-04  37%  212 aa  RER1C_ARATH RecName: Full=Protein RER1C;         Short=AtRER1C;
  154::201     6e-04  42%  215 aa  NARP_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
  140::202     6e-04  38%  210 aa  FIMZ_SALTY RecName: Full=Fimbriae Z protein;
  119::207     6e-04  31%  221 aa  AGMR_PSEAE RecName: Full=Glycerol metabolism activator;AltName:
  150::208     8e-04  36%  218 aa  YXJL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  149::196     8e-04  42%  208 aa  NARP_HAEIN RecName: Full=Nitrate/nitrite response regulator protein
    1::474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DESR_BACSU      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
YVFU_BACSU      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
NREC_STACT      ----------------------------------------------------------------------
NREC_STAHJ      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
YHJB_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
NREC_STAES      ----------------------------------------------------------------------
NREC_STAEQ      ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
NREC_STAAW      ----------------------------------------------------------------------
NREC_STAAT      ----------------------------------------------------------------------
NREC_STAAS      ----------------------------------------------------------------------
NREC_STAAR      ----------------------------------------------------------------------
NREC_STAAN      ----------------------------------------------------------------------
NREC_STAAM      ----------------------------------------------------------------------
NREC_STAAE      ----------------------------------------------------------------------
NREC_STAAC      ----------------------------------------------------------------------
NREC_STAAB      ----------------------------------------------------------------------
NREC_STAA9      ----------------------------------------------------------------------
NREC_STAA8      ----------------------------------------------------------------------
NREC_STAA3      ----------------------------------------------------------------------
NREC_STAA2      ----------------------------------------------------------------------
NREC_STAA1      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------------
VRAR_STAHJ      ----------------------------------------------------------------------
VRAR_STAES      ----------------------------------------------------------------------
VRAR_STAEQ      ----------------------------------------------------------------------
VRAR_STAAW      ----------------------------------------------------------------------
VRAR_STAAS      ----------------------------------------------------------------------
VRAR_STAAR      ----------------------------------------------------------------------
VRAR_STAAN      ----------------------------------------------------------------------
VRAR_STAAM      ----------------------------------------------------------------------
VRAR_STAAC      ----------------------------------------------------------------------
VRAR_STAA1      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
RER1C_ARATH     ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DESR_BACSU      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
YVFU_BACSU      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
NREC_STACT      ----------------------------------------------------------------------
NREC_STAHJ      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
YHJB_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
NREC_STAES      ----------------------------------------------------------------------
NREC_STAEQ      ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
NREC_STAAW      ----------------------------------------------------------------------
NREC_STAAT      ----------------------------------------------------------------------
NREC_STAAS      ----------------------------------------------------------------------
NREC_STAAR      ----------------------------------------------------------------------
NREC_STAAN      ----------------------------------------------------------------------
NREC_STAAM      ----------------------------------------------------------------------
NREC_STAAE      ----------------------------------------------------------------------
NREC_STAAC      ----------------------------------------------------------------------
NREC_STAAB      ----------------------------------------------------------------------
NREC_STAA9      ----------------------------------------------------------------------
NREC_STAA8      ----------------------------------------------------------------------
NREC_STAA3      ----------------------------------------------------------------------
NREC_STAA2      ----------------------------------------------------------------------
NREC_STAA1      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------------
VRAR_STAHJ      ----------------------------------------------------------------------
VRAR_STAES      ----------------------------------------------------------------------
VRAR_STAEQ      ----------------------------------------------------------------------
VRAR_STAAW      ----------------------------------------------------------------------
VRAR_STAAS      ----------------------------------------------------------------------
VRAR_STAAR      ----------------------------------------------------------------------
VRAR_STAAN      ----------------------------------------------------------------------
VRAR_STAAM      ----------------------------------------------------------------------
VRAR_STAAC      ----------------------------------------------------------------------
VRAR_STAA1      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
RER1C_ARATH     ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxLLTIVIVLVSIQLGARSAILFGGVLPVVSAALGAYRTRASARTAPSVTIQPPFPLYLI
DESR_BACSU      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
YVFU_BACSU      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
NREC_STACT      ----------------------------------------------------------------------
NREC_STAHJ      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
YHJB_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
NREC_STAES      ----------------------------------------------------------------------
NREC_STAEQ      ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
NREC_STAAW      ----------------------------------------------------------------------
NREC_STAAT      ----------------------------------------------------------------------
NREC_STAAS      ----------------------------------------------------------------------
NREC_STAAR      ----------------------------------------------------------------------
NREC_STAAN      ----------------------------------------------------------------------
NREC_STAAM      ----------------------------------------------------------------------
NREC_STAAE      ----------------------------------------------------------------------
NREC_STAAC      ----------------------------------------------------------------------
NREC_STAAB      ----------------------------------------------------------------------
NREC_STAA9      ----------------------------------------------------------------------
NREC_STAA8      ----------------------------------------------------------------------
NREC_STAA3      ----------------------------------------------------------------------
NREC_STAA2      ----------------------------------------------------------------------
NREC_STAA1      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------------
VRAR_STAHJ      ----------------------------------------------------------------------
VRAR_STAES      ----------------------------------------------------------------------
VRAR_STAEQ      ----------------------------------------------------------------------
VRAR_STAAW      ----------------------------------------------------------------------
VRAR_STAAS      ----------------------------------------------------------------------
VRAR_STAAR      ----------------------------------------------------------------------
VRAR_STAAN      ----------------------------------------------------------------------
VRAR_STAAM      ----------------------------------------------------------------------
VRAR_STAAC      ----------------------------------------------------------------------
VRAR_STAA1      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
RER1C_ARATH     ------------LLNLIIAFLSPQEDPEASLTSGGSLP----------TRRSDEYRPFVRRLPEFKFWLS
NARP_ECOLI      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VILFVFGFMISFFSLLNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DESR_BACSU      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
YVFU_BACSU      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
NREC_STACT      ----------------------------------------------------------------------
NREC_STAHJ      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
YHJB_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
NREC_STAES      ----------------------------------------------------------------------
NREC_STAEQ      ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
NREC_STAAW      ----------------------------------------------------------------------
NREC_STAAT      ----------------------------------------------------------------------
NREC_STAAS      ----------------------------------------------------------------------
NREC_STAAR      ----------------------------------------------------------------------
NREC_STAAN      ----------------------------------------------------------------------
NREC_STAAM      ----------------------------------------------------------------------
NREC_STAAE      ----------------------------------------------------------------------
NREC_STAAC      ----------------------------------------------------------------------
NREC_STAAB      ----------------------------------------------------------------------
NREC_STAA9      ----------------------------------------------------------------------
NREC_STAA8      ----------------------------------------------------------------------
NREC_STAA3      ----------------------------------------------------------------------
NREC_STAA2      ----------------------------------------------------------------------
NREC_STAA1      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------------
VRAR_STAHJ      ----------------------------------------------------------------------
VRAR_STAES      ----------------------------------------------------------------------
VRAR_STAEQ      ----------------------------------------------------------------------
VRAR_STAAW      ----------------------------------------------------------------------
VRAR_STAAS      ----------------------------------------------------------------------
VRAR_STAAR      ----------------------------------------------------------------------
VRAR_STAAN      ----------------------------------------------------------------------
VRAR_STAAM      ----------------------------------------------------------------------
VRAR_STAAC      ----------------------------------------------------------------------
VRAR_STAA1      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
RER1C_ARATH     IIAFIIGFMMTFFEVFD-----------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DESR_BACSU      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
YVFU_BACSU      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
NREC_STACT      ----------------------------------------------------------------------
NREC_STAHJ      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
YHJB_ECOLI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
NREC_STAES      ----------------------------------------------------------------------
NREC_STAEQ      ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
NREC_STAAW      ----------------------------------------------------------------------
NREC_STAAT      ----------------------------------------------------------------------
NREC_STAAS      ----------------------------------------------------------------------
NREC_STAAR      ----------------------------------------------------------------------
NREC_STAAN      ----------------------------------------------------------------------
NREC_STAAM      ----------------------------------------------------------------------
NREC_STAAE      ----------------------------------------------------------------------
NREC_STAAC      ----------------------------------------------------------------------
NREC_STAAB      ----------------------------------------------------------------------
NREC_STAA9      ----------------------------------------------------------------------
NREC_STAA8      ----------------------------------------------------------------------
NREC_STAA3      ----------------------------------------------------------------------
NREC_STAA2      ----------------------------------------------------------------------
NREC_STAA1      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------------
VRAR_STAHJ      ----------------------------------------------------------------------
VRAR_STAES      ----------------------------------------------------------------------
VRAR_STAEQ      ----------------------------------------------------------------------
VRAR_STAAW      ----------------------------------------------------------------------
VRAR_STAAS      ----------------------------------------------------------------------
VRAR_STAAR      ----------------------------------------------------------------------
VRAR_STAAN      ----------------------------------------------------------------------
VRAR_STAAM      ----------------------------------------------------------------------
VRAR_STAAC      ----------------------------------------------------------------------
VRAR_STAA1      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
RER1C_ARATH     ----------------------------------------------------------------------
NARP_ECOLI      ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVMLGRIGLKAPAERERESTPAAAAHALAERYGLTAREAE
DESR_BACSU      ---------------------------------------------KRIYAPELMEDLYSEANPLTDREKE
Y914_MYCBO      ---------------------------------------------------------------LTPTERD
Y890_MYCTU      ---------------------------------------------------------------LTPTERD
YGEK_ECOLI      ---------------------------------------------------------------LTNRESE
YGEK_ECO57      ---------------------------------------------------------------LTNRESE
DEGU_BACSU      -------------------------------------------EFRRLATSGVSAHPQHEVYPLTRRECE
YVFU_BACSU      ---------------------------------------------KRVFSPELTFNMMRDENPLTVREQE
DEGU_BREBE      ---------------------------------------------------------------LTRRECE
NREC_STACT      ---------------------------------------------------------------LSKRELE
NREC_STAHJ      ---------------------------------------------------------------LSKRELE
MALT_SERP5      ---------------------------------------------------------------LTQREWQ
YHJB_ECOLI      ---------------------------------------------------------------LSARQRE
LIAR_BACSU      ---------------------------------------------------------------LTKRELE
YHCZ_BACSU      -------------------------------------------------------------YQLTRREKD
MOAR_KLEAE      ---------------------------------------------------------------LTAKERE
MALT_YERPY      ---------------------------------------------------------------LTQREWQ
MALT_YERPS      ---------------------------------------------------------------LTQREWQ
MALT_YERPP      ---------------------------------------------------------------LTQREWQ
MALT_YERPE      ---------------------------------------------------------------LTQREWQ
MALT_YERPB      ---------------------------------------------------------------LTQREWQ
MALT_YERPA      ---------------------------------------------------------------LTQREWQ
MALT_YERP3      ---------------------------------------------------------------LTQREWQ
MALT_VIBCH      ---------------------------------------------------------------LTQREWQ
MALT_SALTY      ---------------------------------------------------------------LTQREWQ
MALT_SALTI      ---------------------------------------------------------------LTQREWQ
MALT_SALSV      ---------------------------------------------------------------LTQREWQ
MALT_SALPK      ---------------------------------------------------------------LTQREWQ
MALT_SALPB      ---------------------------------------------------------------LTQREWQ
MALT_SALPA      ---------------------------------------------------------------LTQREWQ
MALT_SALNS      ---------------------------------------------------------------LTQREWQ
MALT_SALHS      ---------------------------------------------------------------LTQREWQ
MALT_SALG2      ---------------------------------------------------------------LTQREWQ
MALT_SALEP      ---------------------------------------------------------------LTQREWQ
MALT_SALDC      ---------------------------------------------------------------LTQREWQ
MALT_SALCH      ---------------------------------------------------------------LTQREWQ
MALT_SALAR      ---------------------------------------------------------------LTQREWQ
MALT_SALA4      ---------------------------------------------------------------LTQREWQ
MALT_ENT38      ---------------------------------------------------------------LTQREWQ
NREC_STAES      ---------------------------------------------------------------LSKRELE
NREC_STAEQ      ---------------------------------------------------------------LSKRELE
MALT_VIBVY      ---------------------------------------------------------------LTQREWQ
MALT_VIBVU      ---------------------------------------------------------------LTQREWQ
MALT_VIBPA      ---------------------------------------------------------------LTQREWQ
MALT_VIBHB      ---------------------------------------------------------------LTQREWQ
CARR_PECCC      ------------------------------------------AINDQDNPPDNSRNAL-----LSPRETE
NREC_STAAW      ---------------------------------------------------------------LSKRELE
NREC_STAAT      ---------------------------------------------------------------LSKRELE
NREC_STAAS      ---------------------------------------------------------------LSKRELE
NREC_STAAR      ---------------------------------------------------------------LSKRELE
NREC_STAAN      ---------------------------------------------------------------LSKRELE
NREC_STAAM      ---------------------------------------------------------------LSKRELE
NREC_STAAE      ---------------------------------------------------------------LSKRELE
NREC_STAAC      ---------------------------------------------------------------LSKRELE
NREC_STAAB      ---------------------------------------------------------------LSKRELE
NREC_STAA9      ---------------------------------------------------------------LSKRELE
NREC_STAA8      ---------------------------------------------------------------LSKRELE
NREC_STAA3      ---------------------------------------------------------------LSKRELE
NREC_STAA2      ---------------------------------------------------------------LSKRELE
NREC_STAA1      ---------------------------------------------------------------LSKRELE
MALT_CITK8      ---------------------------------------------------------------LTQREWQ
BVGA_BORPE      ---------------------------------------------------------------LSNRELT
BVGA_BORPA      ---------------------------------------------------------------LSNRELT
BVGA_BORBR      ---------------------------------------------------------------LSNRELT
MALT_KLEP7      ---------------------------------------------------------------LTQREWQ
MALT_KLEP3      ---------------------------------------------------------------LTQREWQ
MALT_ENTS8      ---------------------------------------------------------------LTQREWQ
VRAR_STAS1      ---------------------------------------------------------------LTEREME
VRAR_STAHJ      ---------------------------------------------------------------LTEREME
VRAR_STAES      ---------------------------------------------------------------LTEREME
VRAR_STAEQ      ---------------------------------------------------------------LTEREME
VRAR_STAAW      ---------------------------------------------------------------LTEREME
VRAR_STAAS      ---------------------------------------------------------------LTEREME
VRAR_STAAR      ---------------------------------------------------------------LTEREME
VRAR_STAAN      ---------------------------------------------------------------LTEREME
VRAR_STAAM      ---------------------------------------------------------------LTEREME
VRAR_STAAC      ---------------------------------------------------------------LTEREME
VRAR_STAA1      ---------------------------------------------------------------LTEREME
MALT_ESCF3      ---------------------------------------------------------------LTQREWQ
MALT_ECOLI      ---------------------------------------------------------------LTQREWQ
MALT_ECOLC      ---------------------------------------------------------------LTQREWQ
MALT_ECOHS      ---------------------------------------------------------------LTQREWQ
MALT_ECODH      ---------------------------------------------------------------LTQREWQ
MALT_ECOBW      ---------------------------------------------------------------LTQREWQ
GERE_BACSU      ---------------------------------------------------------------LTKRERE
MALT_YERE8      ---------------------------------------------------------------LTQREWQ
CSGD_SALTY      ---------------------------------------------------------------LTHREKE
CSGD_ECOLI      ---------------------------------------------------------------LTHREKE
RER1C_ARATH     ----------------------------------------------------------------------
NARP_ECOLI      ---------------------------------------------------------------LTERELD
FIMZ_SALTY      -------------------------------------------------TPKGGHHDMP----LSNREVT
AGMR_PSEAE      -------------------------------ILNGNVYLPSDVIRTQKSSPRRSGH---EEHGLTRKQLL
YXJL_BACSU      ------------------------------------------------------AEELAEPF--TKRELE
NARP_HAEIN      ---------------------------------------------------------------LTDREMG


                         .         .         +         .         .         .         .:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEELAR
DESR_BACSU      VLELVADGKNTKEIAQELSIKSGTVRNYISMILEKLEVKNRIEAITRSKEK---
Y914_MYCBO      VVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLASRVQLVD--------
Y890_MYCTU      VVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLPSRVQLVD--------
YGEK_ECOLI      ILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELI---------
YGEK_ECO57      ILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELI---------
DEGU_BACSU      VLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAV---------
YVFU_BACSU      ILRLAALGKTTKDITLELYLSQGTVRNYISEIIQKLNAKNRTEAASIAEEK---
DEGU_BREBE      VLQLMTDGYSNRMIGEALYISEKTVKNHVSNILQKMNVNDRTQAV---------
NREC_STACT      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMQKLNLKSKPELVE--------
NREC_STAHJ      ILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLDLKSKPELVE--------
MALT_SERP5      VLGLIYSGYSNDQIAGELAVAATTIKTHIRNLYQKLGVAHRQEAVQQAQQLL--
YHJB_ECOLI      ILTMLAAGESNKEIGRALNISTGTVKAHLESLYRRLEVKNRTQ-----------
LIAR_BACSU      ILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQ-----------
YHCZ_BACSU      VLTEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEVADRTQ-----------
MOAR_KLEAE      IVGMVREGASNKLIARQLDISLSTVKTHLRNIFAKTEVVNRTELV---------
MALT_YERPY      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERPS      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERPP      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERPE      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERPB      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERPA      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_YERP3      VLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRLL--
MALT_VIBCH      VLGLIYSGFSNEQIAHELDVAGTTIKTHIRNLYQKLNIANRKEAVQTAEQLL--
MALT_SALTY      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALTI      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALSV      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALPK      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALPB      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALPA      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALNS      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALHS      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALG2      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALEP      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALDC      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALCH      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALAR      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_SALA4      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ENT38      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
NREC_STAES      ILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLNLKSKPELVE--------
NREC_STAEQ      ILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLNLKSKPELVE--------
MALT_VIBVY      VLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAVTTAENLL--
MALT_VIBVU      VLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAVTTAENLL--
MALT_VIBPA      VLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAI---------
MALT_VIBHB      VLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAI---------
CARR_PECCC      VLFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDV----------------
NREC_STAAW      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAT      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAS      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAR      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAN      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAM      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAE      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAC      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAAB      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAA9      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAA8      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAA3      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAA2      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
NREC_STAA1      ILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVE--------
MALT_CITK8      VLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAVQHAQRLL--
BVGA_BORPE      VLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLAK-----
BVGA_BORPA      VLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLAK-----
BVGA_BORBR      VLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLAK-----
MALT_KLEP7      VLGLIYSGYSNEQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_KLEP3      VLGLIYSGYSNEQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ENTS8      VLGLIYSGYSNDQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
VRAR_STAS1      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAHJ      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAES      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAEQ      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAW      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAS      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAR      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAN      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAM      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAAC      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
VRAR_STAA1      ILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV---------
MALT_ESCF3      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ECOLI      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ECOLC      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ECOHS      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ECODH      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
MALT_ECOBW      VLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLL--
GERE_BACSU      VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAV---------
MALT_YERE8      VLGLIYSGYSNDQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQQAQRLL--
CSGD_SALTY      ILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR
CSGD_ECOLI      ILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR
RER1C_ARATH     ------------------------------------------------------
NARP_ECOLI      VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSR-------------
FIMZ_SALTY      VLRYLANGMSNKEIAEQLLLSNKTISAHKANIFSKLGLHSIVELID--------
AGMR_PSEAE      VLERMTKGESNKQIAYNLDIAETTVKAHVSAILRKLKVHNRVQAI---------
YXJL_BACSU      VLQQMAYGLRNEDIAEKLFVSESTVKTHVHRILQKCNAQDRTQAV---------
NARP_HAEIN      VLRQIATGLSNKQIAAQLFISEETVKVHIRNLLRKLNVHSR-------------