[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54852.1

[Show Plain Result]


## Summary of Sequence Search
    1::126
   22::103     2e-07  40%  123 aa  Y1377_METTH RecName: Full=UPF0127 protein MTH_1377;
   24::101     1e-05  34%  114 aa  Y1496_METJA RecName: Full=UPF0127 protein MJ1496;
    7::93      1e-05  37%  116 aa  Y1050_PYRFU RecName: Full=UPF0127 protein PF1050;
   21::102     3e-04  37%  154 aa  Y1463_THESM RecName: Full=UPF0127 protein TSIB_1463;
   21::99      8e-04  36%  157 aa  Y1120_PYRKO RecName: Full=UPF0127 protein TK1120;
    1::126

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxGKRVPILTHTCRGFLERFCGLMLKREVPEACGLYFPGCRSIHTCMMRVPIDVVWV
Y1377_METTH     --------------------------RTFMSRFRGLMLRRDVETGLVLEIPVGRGIHMFFMLVPLDVLFV
Y1496_METJA     ----------------------------FIKRAFGLML-RDIGDKAMLFLYKRRKIHTFFMLYPIDIIFI
Y1050_PYRFU     ---------------GKEIRIEVRFADNFIKRFLGLMFRK--PRYVLIFVLPLESVHGLFMREAIDVIFL
Y1463_THESM     ----------------------------FFKRFRGLMLTPNVNYALVFILPSNASIHMFFMLQSIDVIFL
Y1120_PYRKO     ----------------------------FLKRFRGLMLVKNVNHALVFVLPANASIHMFFMLSDIDVIWL


                         .         .         *         .         .         .         .:140
query           REGEPGELDAVSLDVALKPWRFFAAPRGATGCVEFRAGSFDxxxxxxxxxxxxxxx
Y1377_METTH     -DGDMRVVDSVT----LRPWQIYNPRKPARYVIELREG------------------
Y1496_METJA     DKNRVVEA------VRLKPWKTYKCKNYSTAMLEFKCSDID---------------
Y1050_PYRFU     NSNK----EVVDLTV-LKPWRFYVPKRPAKYIVE----------------------
Y1463_THESM     DSSR----EVVDLKRA-RPWRFYVPKGGAKYIIETPVGVID---------------
Y1120_PYRKO     DSSR----RVVDFKTA-KKWRLYTPKKAAQYIIEGPVG------------------