[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54955.1

[Show Plain Result]


## Summary of Sequence Search
    1::381
   17::368     4e-99  51%  373 aa  TGT_MOOTA RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::366     9e-99  52%  373 aa  TGT_CLOCE RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::364     2e-98  50%  370 aa  TGT_DESRM RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::364     1e-97  50%  373 aa  TGT_HALOH RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::381     3e-97  50%  381 aa  TGT_LYSSC RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     1e-96  50%  379 aa  TGT_MACCJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     2e-96  50%  379 aa  TGT_BACWK RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     2e-96  50%  379 aa  TGT_BACCN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     7e-96  48%  392 aa  TGT_HERA2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     9e-96  50%  379 aa  TGT_BACCQ RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::370     1e-95  50%  380 aa  TGT_STACT RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACHK RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACCZ RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACCR RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC7 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC1 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACC0 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACAN RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACAH RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACAC RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-95  50%  379 aa  TGT_BACAA RecName: Full=Queuine tRNA-ribosyltransferase;       
   15::379     2e-95  48%  384 aa  TGT_SYNE7 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAW RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAT RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAS RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAR RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAN RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAM RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAE RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAC RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAAB RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAA9 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAA8 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAA3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAA2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     2e-95  50%  379 aa  TGT_STAA1 RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::381     2e-95  50%  381 aa  TGT_BACP2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::381     2e-95  50%  381 aa  TGT_BACA2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::381     2e-95  50%  381 aa  TGT_BACSU RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::363     3e-95  49%  370 aa  TGT_NATTJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   24::367     3e-95  49%  374 aa  TGT_CLOTH RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::381     3e-95  50%  381 aa  TGT_BACLD RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::380     1e-94  50%  380 aa  TGT_GEOKA RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     5e-94  49%  379 aa  TGT_STAHJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::365     7e-94  49%  379 aa  TGT_OCEIH RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     1e-93  49%  379 aa  TGT_STAES RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::369     1e-93  49%  379 aa  TGT_STAEQ RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-93  50%  379 aa  TGT_ANOFW RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::380     2e-93  50%  380 aa  TGT_GEOTN RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     4e-93  49%  379 aa  TGT_BACHD RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     1e-92  49%  379 aa  TGT_LISIN RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::367     1e-92  49%  383 aa  TGT_BACSK RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     2e-92  49%  379 aa  TGT_LISMH RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::353     2e-92  49%  375 aa  TGT_THEPX RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     2e-92  49%  379 aa  TGT_LISW6 RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::368     2e-92  48%  374 aa  TGT_ANASP RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::353     3e-92  50%  375 aa  TGT_THEP3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     5e-92  49%  379 aa  TGT_LISMO RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     5e-92  49%  379 aa  TGT_LISMF RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::379     5e-92  49%  379 aa  TGT_LISMC RecName: Full=Queuine tRNA-ribosyltransferase;       
   17::366     1e-91  48%  375 aa  TGT_THETN RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     2e-91  48%  372 aa  TGT_SYNS3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::371     3e-91  49%  377 aa  TGT_GRABC RecName: Full=Queuine tRNA-ribosyltransferase;       
   23::364     1e-90  47%  370 aa  TGT_PELTS RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::362     1e-90  47%  372 aa  TGT_DESHD RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::362     2e-90  46%  372 aa  TGT_SYNSC RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::372     3e-90  48%  376 aa  TGT_RHOS1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::351     4e-90  47%  378 aa  TGT_THEEB RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::367     4e-90  48%  381 aa  TGT_ENTFA RecName: Full=Queuine tRNA-ribosyltransferase;       
   14::361     4e-90  47%  373 aa  TGT_DESMR RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::372     6e-90  47%  376 aa  TGT_RHOS4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::379     1e-89  46%  381 aa  TGT_CYAP4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::373     4e-89  45%  374 aa  TGT_SYNY3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     4e-89  47%  380 aa  TGT_STRPI RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::357     4e-89  47%  373 aa  TGT_IDILO RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::370     5e-89  47%  378 aa  TGT_GLOVI RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRZJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRR6 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRPS RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRPN RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRPJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRP4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     6e-89  47%  380 aa  TGT_STRP2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::360     6e-89  52%  371 aa  TGT_CAUCR RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::382     8e-89  49%  382 aa  TGT_LACLS RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     1e-88  47%  380 aa  TGT_STRZP RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     1e-88  47%  380 aa  TGT_STRZT RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     1e-88  47%  380 aa  TGT_STRP7 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::382     1e-88  49%  382 aa  TGT_LACLM RecName: Full=Queuine tRNA-ribosyltransferase;       
   19::368     1e-88  48%  386 aa  TGT_ACIAD RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     2e-88  47%  380 aa  TGT_STRSY RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     2e-88  47%  380 aa  TGT_STRS2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     2e-88  47%  375 aa  TGT_PSEHT RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     2e-88  47%  380 aa  TGT_STRA5 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     2e-88  47%  380 aa  TGT_STRA3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     2e-88  47%  380 aa  TGT_STRA1 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::382     2e-88  49%  382 aa  TGT_LACLA RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     3e-88  47%  380 aa  TGT_STRU0 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     3e-88  48%  380 aa  TGT_STRGC RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPZ RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPM RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPG RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPF RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPD RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPC RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRPB RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRP8 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRP6 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRP3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-88  47%  380 aa  TGT_STRP1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::374     7e-88  46%  377 aa  TGT_DESDG RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     7e-88  47%  377 aa  TGT_ACIBS RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::367     7e-88  47%  384 aa  TGT_ACIBL RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::360     9e-88  46%  376 aa  TGT_RHIME RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     9e-88  47%  377 aa  TGT_ACIBY RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     9e-88  47%  377 aa  TGT_ACIBT RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     9e-88  47%  377 aa  TGT_ACIB5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     9e-88  47%  377 aa  TGT_ACIB3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   11::357     2e-87  47%  373 aa  TGT_SYNFM RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::355     2e-87  47%  361 aa  TGT_NITEC RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     2e-87  48%  380 aa  TGT_STRSV RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::372     2e-87  45%  376 aa  TGT_SILPO RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::364     3e-87  47%  377 aa  TGT_ACIBC RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-87  46%  372 aa  TGT_SYNS9 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-87  45%  372 aa  TGT_PROM4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   18::365     4e-87  48%  380 aa  TGT_LACSS RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::365     5e-87  48%  380 aa  TGT_STRMU RecName: Full=Queuine tRNA-ribosyltransferase;       
   16::365     8e-87  48%  400 aa  TGT_SYMTH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::372     8e-87  45%  376 aa  TGT_SILST RecName: Full=Queuine tRNA-ribosyltransferase;       
   23::359     1e-86  47%  392 aa  TGT_DEHE1 RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     2e-86  46%  380 aa  TGT_STRT1 RecName: Full=Queuine tRNA-ribosyltransferase;       
   15::365     2e-86  47%  383 aa  TGT_PSYA2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::350     2e-86  48%  371 aa  TGT_ACIF5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::350     2e-86  48%  371 aa  TGT_ACIF2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::355     3e-86  47%  370 aa  TGT_METFK RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     3e-86  47%  370 aa  TGT_DESAH RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     4e-86  46%  380 aa  TGT_STRE4 RecName: Full=Queuine tRNA-ribosyltransferase;       
   15::365     4e-86  47%  383 aa  TGT_PSYCK RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     5e-86  46%  380 aa  TGT_STRTD RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::363     5e-86  46%  380 aa  TGT_STRT2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   23::359     5e-86  47%  392 aa  TGT_DEHSB RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::368     7e-86  46%  380 aa  TGT_STRS7 RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::369     9e-86  42%  394 aa  TGT_DEIRA RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::372     1e-85  46%  376 aa  TGT_JANSC RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::372     3e-85  45%  375 aa  TGT_JANMA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::318     3e-85  50%  372 aa  TGT_PROMM RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::369     3e-85  45%  373 aa  TGT_NITSB RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::372     3e-85  45%  375 aa  TGT_HERAR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     3e-85  44%  367 aa  TGT_FRATN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     4e-85  46%  371 aa  TGT_PSESM RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     6e-85  47%  381 aa  TGT_XANCP RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     6e-85  47%  381 aa  TGT_XANCB RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     6e-85  47%  381 aa  TGT_XANC8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     6e-85  46%  371 aa  TGT_PSEPK RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::318     6e-85  50%  372 aa  TGT_PROM3 RecName: Full=Queuine tRNA-ribosyltransferase;       
   25::362     6e-85  46%  380 aa  TGT_PEDPA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRATW RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRATT RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRATO RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRATH RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRATF RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     6e-85  44%  367 aa  TGT_FRAT1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::340     6e-85  49%  372 aa  TGT_DESAP RecName: Full=Queuine tRNA-ribosyltransferase;       
    8::375     6e-85  46%  376 aa  TGT_CLOAB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     7e-85  47%  371 aa  TGT_THISH RecName: Full=Queuine tRNA-ribosyltransferase;       
    8::348     7e-85  44%  373 aa  TGT_FUSNN RecName: Full=Queuine tRNA-ribosyltransferase;       
   23::359     7e-85  47%  392 aa  TGT_DEHSC RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     1e-84  46%  372 aa  TGT_PSEAE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     1e-84  46%  372 aa  TGT_PSEAB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     1e-84  46%  372 aa  TGT_PSEA8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::355     1e-84  45%  371 aa  TGT_NITEU RecName: Full=Queuine tRNA-ribosyltransferase;       
    7::366     1e-84  45%  378 aa  TGT_EUBE2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     1e-84  46%  371 aa  TGT_AZOVD RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     1e-84  45%  367 aa  TGT_THIDA RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::365     1e-84  46%  383 aa  TGT_PSYWF RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     1e-84  43%  378 aa  TGT_AQUAE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-84  46%  369 aa  TGT_DECAR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     2e-84  47%  381 aa  TGT_XANAC RecName: Full=Queuine tRNA-ribosyltransferase;       
   12::381     2e-84  45%  387 aa  TGT_POLNA RecName: Full=Queuine tRNA-ribosyltransferase;       
    8::346     2e-84  47%  375 aa  TGT_DESVV RecName: Full=Queuine tRNA-ribosyltransferase;       
    8::346     2e-84  47%  375 aa  TGT_DESVH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::352     2e-84  49%  370 aa  TGT_AZOSE RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::361     2e-84  44%  376 aa  TGT_AGRT5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     3e-84  47%  381 aa  TGT_XANC5 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::361     3e-84  45%  373 aa  TGT_MARAV RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::355     4e-84  45%  370 aa  TGT_PSEA6 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     8e-84  46%  373 aa  TGT_TOLAT RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::362     8e-84  46%  370 aa  TGT_THICR RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     8e-84  45%  374 aa  TGT_SACD2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::365     8e-84  43%  367 aa  TGT_FRATM RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::363     1e-83  47%  376 aa  TGT_RALEJ RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-83  47%  381 aa  TGT_PECCP RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::361     1e-83  45%  377 aa  TGT_BRUME RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::361     2e-83  45%  377 aa  TGT_BRUSU RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::348     2e-83  47%  374 aa  TGT_NOVAD RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::355     2e-83  48%  376 aa  TGT_CUPTR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     3e-83  44%  376 aa  TGT_STRM5 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::373     3e-83  46%  387 aa  TGT_GLUDA RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::368     3e-83  46%  380 aa  TGT_CLOPS RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::368     3e-83  46%  380 aa  TGT_CLOPE RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::368     3e-83  46%  380 aa  TGT_CLOP1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     4e-83  46%  381 aa  TGT_XANOR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     4e-83  46%  381 aa  TGT_XANOP RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     4e-83  46%  381 aa  TGT_XANOM RecName: Full=Queuine tRNA-ribosyltransferase;       
   14::372     4e-83  45%  376 aa  TGT_DINSH RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::361     5e-83  46%  372 aa  TGT_RHOBA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::371     9e-83  45%  376 aa  TGT_STRMK RecName: Full=Queuine tRNA-ribosyltransferase;       
   24::386     9e-83  47%  398 aa  TGT_POLSJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::362     9e-83  45%  369 aa  TGT_DICNV RecName: Full=Queuine tRNA-ribosyltransferase;       
   25::362     1e-82  47%  380 aa  TGT_LACPL RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     2e-82  44%  378 aa  TGT_VIBVY RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     2e-82  44%  378 aa  TGT_VIBVU RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::362     2e-82  42%  383 aa  TGT_THEYD RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     2e-82  46%  374 aa  TGT_PHOLL RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     2e-82  46%  371 aa  TGT_NEIMA RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::355     2e-82  46%  375 aa  TGT_METPP RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     3e-82  46%  371 aa  TGT_NEIMF RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::349     3e-82  45%  368 aa  TGT_FRAP2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::355     3e-82  46%  385 aa  TGT_THET2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     3e-82  46%  381 aa  TGT_ERWCT RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     4e-82  44%  372 aa  TGT_CHRSD RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     6e-82  46%  378 aa  TGT_YERE8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     8e-82  44%  377 aa  TGT_SHEPA RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     8e-82  45%  371 aa  TGT_NEIM0 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     8e-82  46%  376 aa  TGT_ERWT9 RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::355     1e-81  45%  385 aa  TGT_THET8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     1e-81  45%  371 aa  TGT_NEIMB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-81  47%  374 aa  TGT_SERP5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::367     1e-81  43%  370 aa  TGT_LARHH RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::361     2e-81  46%  384 aa  TGT_XYLFA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::361     2e-81  46%  384 aa  TGT_XYLFM RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     2e-81  44%  379 aa  TGT_VIBCM RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     2e-81  44%  379 aa  TGT_VIBCH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHISS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHIFL RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHIF8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHIDS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHIBS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_SHIB3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     2e-81  44%  377 aa  TGT_SHEHH RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::368     2e-81  44%  376 aa  TGT_RHILO RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ESCF3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOUT RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOSM RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOSE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOLU RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOLI RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOLC RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOL6 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOL5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOK1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOHS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECODH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECOBW RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO8A RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO81 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO7I RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO5E RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO57 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO55 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO45 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO27 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     2e-81  46%  375 aa  TGT_ECO24 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     3e-81  44%  374 aa  TGT_SHESR RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     3e-81  44%  374 aa  TGT_SHESM RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     3e-81  44%  374 aa  TGT_SHESA RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     3e-81  45%  371 aa  TGT_NEIG2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::363     3e-81  41%  378 aa  TGT_NAUPA RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::368     4e-81  44%  372 aa  TGT_PROMA RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::365     4e-81  42%  388 aa  TGT_DICTD RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::350     4e-81  46%  371 aa  TGT_CHRVO RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::354     5e-81  44%  369 aa  TGT_THENN RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::363     5e-81  46%  376 aa  TGT_RALME RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-81  45%  380 aa  TGT_PROMH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     6e-81  44%  377 aa  TGT_SHEPW RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPY RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPP RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPG RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERPA RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     8e-81  46%  374 aa  TGT_YERP3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::361     8e-81  46%  377 aa  TGT_XYLFT RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::361     8e-81  46%  377 aa  TGT_XYLF2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::355     8e-81  47%  376 aa  TGT_RALEH RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::358     8e-81  45%  371 aa  TGT_NEIG1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     8e-81  46%  382 aa  TGT_ACTPJ RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     8e-81  46%  382 aa  TGT_ACTP7 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     8e-81  46%  382 aa  TGT_ACTP2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::387     8e-81  46%  390 aa  TGT_ACIAC RecName: Full=Queuine tRNA-ribosyltransferase;       
    8::361     1e-80  45%  374 aa  TGT_PSYIN RecName: Full=Queuine tRNA-ribosyltransferase;       
   14::372     1e-80  42%  388 aa  TGT_DICT6 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     1e-80  44%  374 aa  TGT_SHEFN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  45%  374 aa  TGT_SHEB9 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  45%  374 aa  TGT_SHEB8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  45%  374 aa  TGT_SHEB5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  45%  374 aa  TGT_SHEB2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  46%  379 aa  TGT_EDWI9 RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     1e-80  45%  376 aa  TGT_CLOBH RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     1e-80  45%  376 aa  TGT_CLOB1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-80  45%  370 aa  TGT_AZOSB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     2e-80  47%  373 aa  TGT_SYNPX RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::358     2e-80  44%  371 aa  TGT_LAWIP RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     2e-80  45%  376 aa  TGT_CLOBM RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     2e-80  45%  376 aa  TGT_CLOBL RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     2e-80  45%  376 aa  TGT_CLOBK RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     2e-80  45%  376 aa  TGT_CLOBJ RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::366     2e-80  45%  376 aa  TGT_CLOB6 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::387     2e-80  46%  390 aa  TGT_LEPCP RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::373     2e-80  46%  390 aa  TGT_DIAST RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     3e-80  44%  379 aa  TGT_VIBC3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::363     3e-80  43%  372 aa  TGT_SULDN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     3e-80  43%  377 aa  TGT_SHESH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     3e-80  45%  377 aa  TGT_SHEDO RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     3e-80  44%  370 aa  TGT_HAMD5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::373     3e-80  46%  390 aa  TGT_ACISJ RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     4e-80  45%  374 aa  TGT_SHEAM RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::364     4e-80  43%  376 aa  TGT_CLOK5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::364     4e-80  43%  376 aa  TGT_CLOK1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     5e-80  42%  373 aa  TGT_SULNB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-80  44%  374 aa  TGT_SHESW RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-80  44%  374 aa  TGT_SHEPC RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     5e-80  44%  374 aa  TGT_SHEON RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::349     5e-80  46%  375 aa  TGT_PHOPR RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::367     5e-80  45%  385 aa  TGT_PASMU RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::352     5e-80  46%  367 aa  TGT_NITMU RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::387     5e-80  45%  390 aa  TGT_DELAS RecName: Full=Queuine tRNA-ribosyltransferase;       
    9::366     5e-80  45%  376 aa  TGT_CLOTE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::364     7e-80  44%  374 aa  TGT_SHELP RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     7e-80  45%  375 aa  TGT_KLEP7 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     7e-80  45%  375 aa  TGT_KLEP3 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::369     7e-80  43%  374 aa  TGT_CAMFF RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::346     9e-80  49%  394 aa  TGT_SORC5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     9e-80  42%  361 aa  TGT_RICTY RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     9e-80  46%  382 aa  TGT_HAEI8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     9e-80  45%  375 aa  TGT_CITK8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     9e-80  44%  375 aa  TGT_ALISL RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     1e-79  43%  378 aa  TGT_VIBSL RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::365     1e-79  43%  377 aa  TGT_VIBPA RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::359     1e-79  44%  378 aa  TGT_VIBHB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     1e-79  45%  385 aa  TGT_HAEPS RecName: Full=Queuine tRNA-ribosyltransferase;       
   14::385     2e-79  41%  386 aa  TGT_ZYMMO RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     2e-79  44%  375 aa  TGT_VIBFM RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     2e-79  44%  375 aa  TGT_VIBF1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::368     2e-79  44%  372 aa  TGT_PROMP RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     3e-79  45%  375 aa  TGT_SALTI RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     3e-79  42%  361 aa  TGT_RICB8 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::357     4e-79  43%  359 aa  TGT_RICBR RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     4e-79  45%  382 aa  TGT_HAEIG RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     4e-79  44%  376 aa  TGT_CAMC1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     4e-79  44%  378 aa  TGT_AERHH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::349     5e-79  44%  370 aa  TGT_VESOH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALTY RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALSV RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALPK RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALPC RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALPB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALPA RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALNS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALHS RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALG2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALEP RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALDC RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALCH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     5e-79  45%  375 aa  TGT_SALA4 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::362     5e-79  44%  382 aa  TGT_HAEDU RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     6e-79  46%  382 aa  TGT_HAEIN RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::347     6e-79  47%  384 aa  TGT_DESOH RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::359     8e-79  44%  375 aa  TGT_SPHAL RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     8e-79  45%  382 aa  TGT_HAEIE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     8e-79  44%  378 aa  TGT_AERS4 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     1e-78  42%  361 aa  TGT_RICPR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     1e-78  42%  361 aa  TGT_RICCN RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     1e-78  42%  361 aa  TGT_RICAE RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::370     1e-78  43%  396 aa  TGT_XENTR RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::357     1e-78  43%  367 aa  TGT_THEAB RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-78  45%  375 aa  TGT_SALAR RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::368     1e-78  42%  372 aa  TGT_PROM5 RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::379     1e-78  42%  403 aa  TGT_HUMAN RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     1e-78  45%  375 aa  TGT_ENT38 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     1e-78  41%  373 aa  TGT_ARCB4 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     2e-78  42%  361 aa  TGT_RICPU RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     2e-78  42%  361 aa  TGT_RICM5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     5e-78  42%  361 aa  TGT_RICRS RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     5e-78  42%  361 aa  TGT_RICRO RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::370     7e-78  43%  396 aa  TGT_XENLA RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::357     7e-78  44%  382 aa  TGT_SODGM RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::367     7e-78  44%  379 aa  TGT_MANSM RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     9e-78  42%  372 aa  TGT_PROM2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     1e-77  43%  372 aa  TGT_CAMHC RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     1e-77  41%  371 aa  TGT_HELPS RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::357     3e-77  43%  367 aa  TGT_THEM4 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::362     3e-77  50%  383 aa  TGT_RALSO RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     4e-77  42%  369 aa  TGT_THEP1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     4e-77  42%  369 aa  TGT_THEMA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::360     4e-77  41%  361 aa  TGT_RICAH RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::362     4e-77  49%  383 aa  TGT_RALPJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   15::368     4e-77  44%  372 aa  TGT_PROM0 RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     6e-77  42%  361 aa  TGT_RICFE RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::368     6e-77  42%  372 aa  TGT_PROMS RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     6e-77  42%  372 aa  TGT_PROM9 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::376     7e-77  41%  377 aa  TGT_WOLSU RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::353     7e-77  45%  376 aa  TGT_HAES1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::361     7e-77  44%  379 aa  TGT_ACTSZ RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::353     1e-76  41%  369 aa  TGT_THESQ RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::377     1e-76  45%  390 aa  TGT_VEREI RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     1e-76  41%  371 aa  TGT_HELPY RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     1e-76  40%  371 aa  TGT_HELAH RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::359     3e-76  41%  361 aa  TGT_RICCK RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     3e-76  42%  373 aa  TGT_CAMLR RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     4e-76  41%  371 aa  TGT_HELP2 RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     6e-76  40%  371 aa  TGT_HELPJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::377     8e-76  41%  403 aa  TGT_RAT RecName: Full=Queuine tRNA-ribosyltransferase;       
   28::377     8e-76  41%  403 aa  TGT_MOUSE RecName: Full=Queuine tRNA-ribosyltransferase;       
    6::374     1e-75  40%  379 aa  TGT_SOLUE RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::356     1e-75  46%  378 aa  TGT_CLOPH RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     2e-75  40%  371 aa  TGT_HELPH RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::359     2e-75  41%  368 aa  TGT_BLOPB RecName: Full=Queuine tRNA-ribosyltransferase;       
    2::363     3e-75  40%  371 aa  TGT_HELPG RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::381     9e-75  44%  388 aa  TGT_CAMC5 RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::370     1e-74  41%  381 aa  TGT_HELHP RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::371     3e-74  41%  427 aa  TGT_DROME RecName: Full=Probable queuine tRNA-ribosyltransferase;  
    4::363     4e-74  42%  373 aa  TGT_CAMJJ RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     6e-74  42%  373 aa  TGT_CAMJR RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::378     8e-74  40%  378 aa  TGT_METI4 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     2e-73  42%  373 aa  TGT_CAMJ8 RecName: Full=Queuine tRNA-ribosyltransferase;       
   22::359     2e-73  43%  370 aa  TGT_BAUCH RecName: Full=Queuine tRNA-ribosyltransferase;       
    5::398     3e-73  42%  400 aa  TGT_ROSS1 RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     4e-73  42%  373 aa  TGT_CAMJD RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::363     5e-73  42%  373 aa  TGT_CAMJE RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::371     1e-72  41%  404 aa  TGT_SCHPO RecName: Full=Probable queuine tRNA-ribosyltransferase;  
    8::362     1e-72  41%  378 aa  TGT_BLOFL RecName: Full=Queuine tRNA-ribosyltransferase;       
   30::368     5e-72  42%  372 aa  TGT_BRAHW RecName: Full=Queuine tRNA-ribosyltransferase;       
   13::371     7e-72  39%  379 aa  TGT_TREDE RecName: Full=Queuine tRNA-ribosyltransferase;       
   11::359     2e-71  41%  368 aa  TGT_BUCAP RecName: Full=Queuine tRNA-ribosyltransferase;       
   25::357     5e-71  40%  370 aa  TGT_BUCAT RecName: Full=Queuine tRNA-ribosyltransferase;       
   25::357     5e-71  40%  370 aa  TGT_BUCA5 RecName: Full=Queuine tRNA-ribosyltransferase;       
   25::357     6e-71  40%  370 aa  TGT_BUCAI RecName: Full=Queuine tRNA-ribosyltransferase;       
   26::384     8e-71  40%  400 aa  TGT_DANRE RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::365     3e-70  38%  371 aa  TGT_LEPBP RecName: Full=Queuine tRNA-ribosyltransferase;       
    3::365     3e-70  38%  371 aa  TGT_LEPBA RecName: Full=Queuine tRNA-ribosyltransferase;       
    4::360     3e-69  39%  400 aa  TGT_CAEEL RecName: Full=Probable queuine tRNA-ribosyltransferase;  
    7::401     1e-68  40%  403 aa  TGT_ARCFU RecName: Full=Putative queuine tRNA-ribosyltransferase;  
    4::360     1e-68  39%  400 aa  TGT_CAEBR RecName: Full=Probable queuine tRNA-ribosyltransferase;  
   10::366     2e-68  38%  375 aa  TGT_BORT9 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::366     6e-68  38%  375 aa  TGT_BORHD RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::365     3e-66  38%  375 aa  TGT_BORDL RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::365     8e-66  37%  375 aa  TGT_BORRA RecName: Full=Queuine tRNA-ribosyltransferase;       
   27::363     1e-64  38%  374 aa  TGT_LEPIN RecName: Full=Queuine tRNA-ribosyltransferase;       
   27::363     1e-64  38%  374 aa  TGT_LEPIC RecName: Full=Queuine tRNA-ribosyltransferase;       
   27::363     2e-64  38%  374 aa  TGT_LEPBL RecName: Full=Queuine tRNA-ribosyltransferase;       
   27::363     2e-64  38%  374 aa  TGT_LEPBJ RecName: Full=Queuine tRNA-ribosyltransferase;       
   12::382     1e-61  36%  387 aa  TGT_PARUW RecName: Full=Queuine tRNA-ribosyltransferase;       
   12::365     3e-61  36%  375 aa  TGT_BORGA RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::368     6e-61  37%  372 aa  TGT_CHLCV RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-60  36%  372 aa  TGT_CHLTR RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-60  36%  372 aa  TGT_CHLTB RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-60  36%  372 aa  TGT_CHLT2 RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::368     4e-60  37%  372 aa  TGT_CHLAB RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::368     8e-60  37%  372 aa  TGT_CHLFF RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     2e-59  36%  372 aa  TGT_CHLTA RecName: Full=Queuine tRNA-ribosyltransferase;       
    1::368     4e-59  36%  372 aa  TGT_CHLMU RecName: Full=Queuine tRNA-ribosyltransferase;       
   10::368     3e-57  36%  372 aa  TGT_CHLPN RecName: Full=Queuine tRNA-ribosyltransferase;       
   12::365     1e-54  34%  375 aa  TGT_BORBU RecName: Full=Queuine tRNA-ribosyltransferase;       
   12::365     2e-54  34%  375 aa  TGT_BORBZ RecName: Full=Queuine tRNA-ribosyltransferase;       
    7::330     1e-21  28%  653 aa  ATGT_METTH RecName: Full=7-cyano-7-deazaguanine
  119::405     3e-21  27%  416 aa  QTRD1_DANRE RecName: Full=Queuine tRNA-ribosyltransferase subunit
  222::408     1e-20  37%  415 aa  QTRD1_XENLA RecName: Full=Queuine tRNA-ribosyltransferase subunit
  251::390     2e-20  40%  394 aa  QTRD1_IXOSC RecName: Full=Queuine tRNA-ribosyltransferase subunit
  223::399     2e-19  39%  413 aa  QTRD1_XENTR RecName: Full=Queuine tRNA-ribosyltransferase subunit
  230::398     3e-19  38%  415 aa  QTRD1_HUMAN RecName: Full=Queuine tRNA-ribosyltransferase subunit
   21::328     4e-19  26%  490 aa  ATGT_METAC RecName: Full=7-cyano-7-deazaguanine
  230::398     5e-19  38%  415 aa  QTRD1_MOUSE RecName: Full=Queuine tRNA-ribosyltransferase subunit
  239::371     5e-19  40%  417 aa  QTRD1_DROAN RecName: Full=Queuine tRNA-ribosyltransferase subunit
  240::376     7e-19  41%  432 aa  QTRD1_ANOGA RecName: Full=Queuine tRNA-ribosyltransferase subunit
  240::372     2e-18  39%  418 aa  QTRD1_DROYA RecName: Full=Queuine tRNA-ribosyltransferase subunit
  240::382     2e-18  37%  418 aa  QTRD1_DROER RecName: Full=Queuine tRNA-ribosyltransferase subunit
  244::398     2e-18  39%  415 aa  QTRD1_PONAB RecName: Full=Queuine tRNA-ribosyltransferase subunit
  240::372     3e-18  38%  418 aa  QTRD1_DROSE RecName: Full=Queuine tRNA-ribosyltransferase subunit
   21::328     3e-18  26%  490 aa  ATGT_METBF RecName: Full=7-cyano-7-deazaguanine
    5::329     8e-18  25%  674 aa  ATGT_METST RecName: Full=7-cyano-7-deazaguanine
   24::334     2e-17  26%  652 aa  ATGT_META3 RecName: Full=7-cyano-7-deazaguanine
  228::362     2e-17  31%  369 aa  QTRD1_TRIAD RecName: Full=Queuine tRNA-ribosyltransferase subunit
   21::328     2e-17  25%  490 aa  ATGT_METMA RecName: Full=7-cyano-7-deazaguanine
   13::333     2e-17  28%  516 aa  ATGT_HALVO RecName: Full=7-cyano-7-deazaguanine
  240::372     1e-16  40%  418 aa  QTRD1_DROME RecName: Full=Queuine tRNA-ribosyltransferase subunit
    3::327     1e-16  28%  659 aa  ATGT_METS3 RecName: Full=7-cyano-7-deazaguanine
   18::326     1e-16  28%  512 aa  ATGT_AERPE RecName: Full=7-cyano-7-deazaguanine
  231::381     2e-16  37%  417 aa  QTRD1_DROVI RecName: Full=Queuine tRNA-ribosyltransferase subunit
  125::385     2e-16  24%  421 aa  QTRD1_AEDAE RecName: Full=Queuine tRNA-ribosyltransferase subunit
  128::371     3e-16  29%  417 aa  QTRD1_DROPE RecName: Full=Queuine tRNA-ribosyltransferase subunit
  232::353     3e-16  37%  373 aa  QTRD1_CAEEL RecName: Full=Queuine tRNA-ribosyltransferase subunit
    1::322     3e-16  24%  580 aa  ATGT_THEON RecName: Full=7-cyano-7-deazaguanine
  239::371     6e-16  36%  417 aa  QTRD1_DROPS RecName: Full=Queuine tRNA-ribosyltransferase subunit
   25::335     7e-16  24%  655 aa  ATGT_METJA RecName: Full=7-cyano-7-deazaguanine
  228::398     2e-15  33%  425 aa  QTRD1_CHICK RecName: Full=Queuine tRNA-ribosyltransferase subunit
   13::333     5e-15  27%  520 aa  ATGT_NATPD RecName: Full=7-cyano-7-deazaguanine
    3::334     5e-15  25%  649 aa  ATGT_METMP RecName: Full=7-cyano-7-deazaguanine
  127::377     6e-15  24%  429 aa  QTRD1_CULQU RecName: Full=Queuine tRNA-ribosyltransferase subunit
   11::326     6e-15  25%  582 aa  ATGT_PYRHO RecName: Full=7-cyano-7-deazaguanine
    3::334     8e-15  25%  649 aa  ATGT_METM7 RecName: Full=7-cyano-7-deazaguanine
  238::370     2e-14  33%  416 aa  QTRD1_DROMO RecName: Full=Queuine tRNA-ribosyltransferase subunit
    3::334     2e-14  25%  649 aa  ATGT_METM6 RecName: Full=7-cyano-7-deazaguanine
    3::334     2e-14  26%  649 aa  ATGT_METM5 RecName: Full=7-cyano-7-deazaguanine
   27::330     2e-14  29%  459 aa  ATGT_METKA RecName: Full=7-cyano-7-deazaguanine
    7::322     7e-14  22%  590 aa  ATGT_KORCO RecName: Full=7-cyano-7-deazaguanine
  234::356     9e-14  35%  376 aa  QTRD1_CAEBR RecName: Full=Queuine tRNA-ribosyltransferase subunit
    6::334     9e-14  24%  491 aa  ATGT_HALSA RecName: Full=7-cyano-7-deazaguanine
   11::326     1e-13  24%  585 aa  ATGT_PYRFU RecName: Full=7-cyano-7-deazaguanine
   24::334     1e-13  25%  649 aa  ATGT_METVS RecName: Full=7-cyano-7-deazaguanine
  247::381     2e-13  32%  428 aa  QTRD1_DROWI RecName: Full=Queuine tRNA-ribosyltransferase subunit
    2::162     3e-13  31%  632 aa  ATGT_THEAC RecName: Full=7-cyano-7-deazaguanine
   14::327     7e-13  25%  481 aa  ATGT_ARCFU RecName: Full=7-cyano-7-deazaguanine
    2::162     2e-12  30%  632 aa  ATGT_THEVO RecName: Full=7-cyano-7-deazaguanine
   27::329     5e-11  24%  489 aa  ATGT_METHJ RecName: Full=7-cyano-7-deazaguanine
  229::350     1e-10  34%  419 aa  QTRD1_DROGR RecName: Full=Queuine tRNA-ribosyltransferase subunit
   10::321     1e-10  22%  625 aa  ATGT_PICTO RecName: Full=7-cyano-7-deazaguanine
   20::329     2e-10  23%  498 aa  ATGT_SULAC RecName: Full=7-cyano-7-deazaguanine
  239::338     4e-09  30%  348 aa  TGTL_SCHPO RecName: Full=Queuine tRNA-ribosyltransferase-like
    1::138     1e-08  30%  580 aa  ATGT_PYRKO RecName: Full=7-cyano-7-deazaguanine
   11::142     2e-08  30%  584 aa  ATGT_PYRAB RecName: Full=7-cyano-7-deazaguanine
   25::240     2e-07  25%  410 aa  ATGT_NANEQ RecName: Full=7-cyano-7-deazaguanine
    1::333     2e-06  28%  490 aa  ATGT_HALMA RecName: Full=7-cyano-7-deazaguanine
   20::329     5e-06  20%  491 aa  ATGT_SULTO RecName: Full=7-cyano-7-deazaguanine
   85::205     1e-05  33%  241 aa  TGTL_PLAFA RecName: Full=Queuine tRNA-ribosyltransferase-like
  251::371     1e-05  33%  407 aa  TGTL_PLAF7 RecName: Full=Queuine tRNA-ribosyltransferase-like
  224::332     1e-05  27%  503 aa  ATGT_SULSO RecName: Full=7-cyano-7-deazaguanine
  341::382     2e-05  48%  402 aa  TGTL_THEPA RecName: Full=Queuine tRNA-ribosyltransferase-like
  344::382     4e-05  46%  402 aa  TGTL_THEAN RecName: Full=Queuine tRNA-ribosyltransferase-like
    1::381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALFDCELQATSGHARALSYETAHGSFQTPMFMPVGTSASVKGVTVGQLNDLNAQVVLANTYHLSLRPGA
TGT_MOOTA       --------------ARLGRLTTPHGTIETPVFMPVGTQATVKTMTPEEVAGLGAEIILANTYHLYLRPGA
TGT_CLOCE       --------------ARLGKVHTPHGSFDTPVFMPVGTLATVKGMSPEELKEIDARIILSNTYHCYLRPGQ
TGT_DESRM       --------------ARLGKLTTPHGEVETPIFMPVGTQATVKTMTPEEVKETGGRLVLSNTYHLYLRPGH
TGT_HALOH       --------------ARLGKLKTPHGDIDTPIFMPVGTQATVKSMTPDELENIKAQIILSNTYHLYLRPGS
TGT_LYSSC       --------------ARLGIVHTPHGSFETPAFMPVGTQATVKTMSPEELKEMNAGIILSNTYHLWLRPGN
TGT_MACCJ       --------------ARLGIVHTPHGSFETPMFMPVGTQATVKTMSPEELKAMNAKIILSNTYHLWLRPGN
TGT_BACWK       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACCN       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_HERA2       ---FTYTLEHSDGEARAGQFSTPHGTIQTPVFMPVGTQATVKTLDPLEVEAIGSQIILSNTYHLYLRPSA
TGT_BACCQ       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_STACT       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELHDINAKIILGNTYHLWLQPGN
TGT_BACHK       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACCZ       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACCR       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC7       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC4       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC3       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC2       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC1       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACC0       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACAN       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACAH       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACAC       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_BACAA       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGH
TGT_SYNE7       ---FQIDRQCSQTRGRACSFHTPHGIVETPRFMPVGTLATVKTVTPAQLRDTGAQMVLSNTYHLHLQPGE
TGT_STAAW       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAT       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAS       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAR       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAN       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAM       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAE       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAC       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAAB       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAA9       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAA8       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAA3       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAA2       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_STAA1       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_BACP2       --------------ARLGRVHTPHGSFDTPVFMPVGTLATVKTMAPEELKAMEAGIILSNTYHLWLRPGH
TGT_BACA2       --------------ARLGRVHTPHGSFETPVFMPVGTLATVKTMSPDELKSMDAGIILSNTYHLWLRPGH
TGT_BACSU       --------------ARLGKVHTPHGSFETPVFMPVGTLATVKTMSPEELKAMDAGIILSNTYHLWLRPGQ
TGT_NATTJ       ------QLEQTSSESRARKLKTPRGEIQTPVFMPVGTQATVKTMTPEELKNLDAEIILGNTYHLHLRPGN
TGT_CLOTH       ---------------------TPHGCFDTPAFMPVGTQATVKGMSPDEMKEIEAQIILSNTYHLHMRPGE
TGT_BACLD       --------------ARLGRVHTPHGSFETPVFMPVGTLATVKTMSPEELKEMGADIILSNTYHLWLRPGH
TGT_GEOKA       --------------ARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGH
TGT_STAHJ       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGN
TGT_OCEIH       --------------ARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEDLQSMQANIILSNTYHLWLRPGE
TGT_STAES       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRNIEAKIILGNTYHLWLQPGN
TGT_STAEQ       --------------ARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRNIEAKIILGNTYHLWLQPGN
TGT_ANOFW       --------------ARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGH
TGT_GEOTN       --------------ARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGH
TGT_BACHD       --------------ARLGKLHTPHGTIETPIFMPVGTLATVKTMSPEELKQLGAQIILSNTYHLWLRPGH
TGT_LISIN       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_BACSK       --------------ARLGRVHTPHGTIETPMFMPVGTLATVKTMSPEDLKAMDAQIILSNTYHLWLRPGE
TGT_LISMH       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_THEPX       -------------NARLGILETPHGVIETPVFMPVGTQATVKAMTPEELKEIGATIILSNTYHLYLRPGH
TGT_LISW6       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_ANASP       -AIFSFQSLARCSQTKARSFLTPHGIVETPRFMPVGTLANVKTVTPAQLKETGAQMVLSNTYHLHLQPGE
TGT_THEP3       -------------NARLGILETPHGIIETPVFMPVGTQATVKSMTPEELKEIGATIILSNTYHLYLRPGH
TGT_LISMO       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_LISMF       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_LISMC       --------------ARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGE
TGT_THETN       --------------ARLGILETPHGVIETPVFMPVGTQATVKAMTPDELKEMGATIILGNTYHLYLRPGH
TGT_SYNS3       --MFQFEIQATCSNARCGCFHTPHGPVTTPRFMPXXXXXXXXXXXXSQLAETGAQMVLSNTYHLHLQPGE
TGT_GRABC       -------LQAEDGRARAATLHTAHGDVPTPTFMPVGTAATVKAMMMDSVRATGAGIVLGNTYHLMLRPGA
TGT_PELTS       ---------------------TPHGTVETPVFMPVGTQATVKTMTPEEVRDIGGRMILSNTYHLYLRPGH
TGT_DESHD       --------------ARLGKLHTPHGVIETPVFMPVGTQATVKTMTPEELKDLGAGIILSNTYHLFLRPGH
TGT_SYNSC       ---FEINAHCANTSARCGTFETPHGPVNTPRFMPVGTLATVKGISTEQLGRTGAQMVLSNTYHLHLQPGE
TGT_RHOS1       ---FSFELTATDGRARTGVISTPRGEIRTPAFMPVGTAGTVKAMLPENVRATGADILLGNTYHLMLRPTA
TGT_THEEB       ---FVCQQECAHTQARAGLFHTPHGTVATPRFMPVGTLANVKTLTPEHLKAAGAQMILANTYHLHLQPGE
TGT_ENTFA       ---------------------TPHGTFPTPMFMPVGTLATVKTMSPEELKEMGAGVILSNTYHLWLRPGE
TGT_DESMR       ------------GSARTARLTTAHGEIETPVFMPVGTQGTVKSLCPTDLQDIKARIILGNTYHLYLRPGD
TGT_RHOS4       ---FSFELTATDGRARTGVISTPRGEIRTPAFMPVGTAGTVKAMLPENVRATGADILLGNTYHLMLRPTA
TGT_CYAP4       --------QASCSHARAGQFFTPHGVVETPRFMPVGTLANIKTVTPEQLRGTGAQMILANTYHLHLQPGE
TGT_SYNY3       ---YQCQARCSHSQARAGIFQTPHGPVETPRFMPVGTLATVKGITPAQLADTQAQMVLANTYHLHLQPGE
TGT_STRPI       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_IDILO       ------ELDKTSGRARRGRMVFERGTVETPAFMPVGTLGTVKGMTPEEVKDTGAQICLGNTFHLMLRPGT
TGT_GLOVI       -ASFAFTIEHRDGEARAGTFATPHGPVYTPCFMPVGTQATVKTLTPAQLAETGAQMILANTYHLSLQPGA
TGT_STRZJ       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRR6       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRPS       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRPN       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRPJ       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRP4       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRP2       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_CAUCR       MAAFPFEIEATDGKARTGVLKTPRGDIRTPAFMPVGTAATVKAMTVDQVKDTGADIILGNTYHLMLRPSA
TGT_LACLS       ---------------------TPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGD
TGT_STRZP       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRZT       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRP7       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_LACLM       ---------------------TPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGD
TGT_ACIAD       -----------SGRARRGRLTLAHGVVETPVFMPVGTYGTVKGMLPRDIEEIQAQIILGNTFHLYLRPGL
TGT_STRSY       ---------------------TPHGTFPTPMFMPVGTQATVKTMSPEELKAMGSGIILSNTYHLWLRPGD
TGT_STRS2       ---------------------TPHGTFPTPMFMPVGTQATVKTMSPEELKAMGSGIILSNTYHLWLRPGD
TGT_PSEHT       ------ELDTTDGKARRGRLIFDRGVIETPAFMPVGTYGTVKGMTPDEVKATGAQVCLGNTFHLMLRPGT
TGT_STRA5       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRA3       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_STRA1       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGD
TGT_LACLA       ---------------------TPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGD
TGT_STRU0       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAMGSGIILSNTYHLWLRPGD
TGT_STRGC       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGD
TGT_STRPZ       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPM       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPG       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPF       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPD       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPC       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRPB       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRP8       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRP6       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRP3       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_STRP1       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGD
TGT_DESDG       -------LHATDGKARTGVLQTAHGPVRTPIFMPVGTVGSVKGVAPDDLDAIGAEIILGNTYHLYLRPGD
TGT_ACIBS       -----------SGRARRGRLTLEHGVVETPIFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_ACIBL       ---FSFQVEATQGAARAGRMITPHGEVETPVFMPVGTVATVKGIPQDLLEELGVQILLNNTYHLYLRPGV
TGT_RHIME       ---FQFKLLAADGNARRGEVVTPRGTIRTPAFMPVGTVGTVKAMYLDQVRDLGADIILGNTYHLMLRPGA
TGT_ACIBY       -----------SGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_ACIBT       -----------SGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_ACIB5       -----------SGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_ACIB3       -----------SGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_SYNFM       -----------SCHARRGRLRTAHGTFDTPVFMPVGTQASVKSLSPDELEDLGAHIILGNTYHLLLRPGA
TGT_NITEC       ------QLHCHDHHARRGTLTLAHGMIETPAFMPVGTYGAVKGLSPDELQTLGAEIILGNTFHLWLRPGL
TGT_STRSV       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGD
TGT_SILPO       ---FSFDLHASDGKARTGVIHTPRGGVRTPAFMPVGTAATVKAMMPESVRATGADILLGNTYHLMLRPTA
TGT_ACIBC       -----------SGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGL
TGT_SYNS9       --MFNFEISAHCPHTRCGCFHTPHGPVQTPRFMPVGTLATVKGISTEQLARTGAQMVLSNTYHLHLQPGE
TGT_PROM4       MFSFQINSNCSSTRARVGCLNTPHGDVHTPQFMPVGTLGTVKGVSPDQLLKTGSEMILANTYHLHLQPGE
TGT_LACSS       --------------ARLGEIVTPHGTFKTPMFMPVGTQASVKTMAPEDLKEMGAGIILSNTYHLWLRPGE
TGT_STRMU       ---------------------TPHGVFPTPMFMPVGTQATVKTQSPEELKEMKAGIILANTYHLWLRPGD
TGT_SYMTH       --------------ARLGRLHTPRGVIETPVFMPVGTQATVKTLNPEEVWDLGARIILSNTYHLYLRPGH
TGT_SILST       --LFNFEMTATDGKARTGVIHTPRGEIRTPAFMPVGTAATVKAMMPESVRATGADILLGNTYHLMLRPTA
TGT_DEHE1       ---------------------TAHGQVETPVFCPVGSQATVKTLTPEDLKSVNVNMILSNTYHLYLRPGI
TGT_STRT1       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELQQMGSGIILANTYHLWLRPGD
TGT_PSYA2       --------------ARRGTVHLNHGDVQTPAFMPVGTYGTVKGMLPRDIEAIGADIILGNTFHLWLRPGT
TGT_ACIF5       MSIF--QLLARDGAARRGTIRLPRGTVQTPAFMPVGTYGTVKAMSPEELKTLGAEIILGNTFHLFLRPGL
TGT_ACIF2       MSIF--QLLARDGAARRGTIRLPRGTVQTPAFMPVGTYGTVKAMSPEELKTLGAEIILGNTFHLFLRPGL
TGT_METFK       ------------GAARRGTVSLAHGDVQTPAFMPVGTYGAVKSLSPVEVRDTGAHILLGNTFHLWLRPGL
TGT_DESAH       MLTFDIINQSLESRARTGRITTAHGVIETPIFMPVGTLGTVKAVSVEELKACQAQIILGNTYHLYLRPGC
TGT_STRE4       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEIGSGIILSNTYHLWLRPGD
TGT_PSYCK       --------------ARRGTVHLNHGDVQTPAFMPVGTYGTVKGMLPRDIEAIGADIILGNTFHLWLRPGT
TGT_STRTD       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGD
TGT_STRT2       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELQQMGSGIILANTYHLWLRPGD
TGT_DEHSB       ---------------------TAHGKVETPVFCPVGSQATVKTLTPEDLKSVNINMILSNTYHLYLRPGI
TGT_STRS7       ---------------------TPHGTFPTPMFMPVGTQATVKTQSPEELKEIGSGIILSNTYHLWLRPGD
TGT_DEIRA       -AVFEFEIKQRDGRARTATFQTPRGAVTTPMFMPVGTQGTVKGISPQELLEIGSQMILANTYHLMLRPGE
TGT_JANSC       -------LDATSGKARTGVIQTPRGDIRTPAFMPVGTAATVKAMMPESVAATGADILLGNTYHLMLRPTA
TGT_JANMA       --MLNFKLLKTDGNARRGQLTLNHGVIETPIFMPVGTYGSVKAMSPLELNEIDAQIILGNTFHLWLRPGN
TGT_PROMM       --MFDFQINAHCSHTRARCFRTPHGSVNTPRFMPVGTLATVKGITATQLADTGAQMVLANTYHLHLQPGE
TGT_NITSB       ----DFFIDATDNNARACTIKTSHSTIKTPVFMPVGTAASVKSLDTVDLRDLQTQIILANTYHLYLRPGD
TGT_HERAR       --MLNFKLLNTDGNARRGQLTVNHGVIETPIFMPVGTYGSVKAMSPLELKEIDAQIILGNTFHLWLRPGN
TGT_FRATN       MTVMKFDLIKKEGKARRGKISFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_PSESM       ------ELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEATGAQMILGNTFHLWLRPGT
TGT_XANCP       MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGL
TGT_XANCB       MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGL
TGT_XANC8       MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGL
TGT_PSEPK       ------ELLATDGKARRGRITFPRGTVETPAFMPVGTYGTVKGMLPRDIEAIGAEMILGNTFHLWLRPGT
TGT_PROM3       --MFDFQINAHCSHTRARCFRTPHGSVNTPRFMPVGTLATVKGITATQLADTGAQMVLANTYHLHLQPGE
TGT_PEDPA       ---------------------TPHGTFPTPIFMPVGTQATVKAMSPEELEDLGADIILSNTYHLWVRPGE
TGT_FRATW       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_FRATT       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_FRATO       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_FRATH       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_FRATF       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_FRAT1       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_DESAP       --LFEVLKQDSRTRARLGRLTTPHGVVETPVFMPVGTQATVKTMTPEEVRDLGARIILSNTYHLYLRPGH
TGT_CLOAB       -----------TGKVRRGRFETVHGTIETPVFMNVGTLAAIKGVSSMDLKEINCQVELSNTYHLSLRPGD
TGT_THISH       ------ELIANDGAARRGRLSFPRGTVETPAFMPVGTYGTVKAMTPXXXXXXXXXXXXXNTFHLMLRPGT
TGT_FUSNN       ------KVEDKDGKARAGVITTLHGEIETPVFMPVGTQATVKTMSKEELLDIGSEIILGNTYHLYLRPND
TGT_DEHSC       ---------------------TAHGKVETPVFCPVGSQAAVKTLTPEDLKSVNINMILSNTYHLYLRPGI
TGT_PSEAE       ------ELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGT
TGT_PSEAB       ------ELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGT
TGT_PSEA8       ------ELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGT
TGT_NITEU       ------QLHCRDHEARRGTLTLAHGTVETPAFMPVGTYGAVKGLSPDELHTLGAGIILGNTFHLWLRPGL
TGT_EUBE2       ----------TDGRAKRAEFTTVHGTVQTPVFMNVGTVAAIKGVATTDLQQIGTQIELSNTYHLHVRPGD
TGT_AZOVD       ------ELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEAIGAQIILGNTFHLWLRPGT
TGT_THIDA       ------DLLRTDGGARRGQLHLAHGVVQTPVFMPVGTYGTVKAMSPTEIADIGFEMLLSNTFHLWLRPGL
TGT_PSYWF       ---------AGESRARRGTVTVNHGEIRTPAFMPVGTYGTVKGMLPRDIEDIGADIILGNTFHLWLRPGT
TGT_AQUAE       --MFKFHLITKDGKARRGRIYTPHGVIETPVFMPVGTQGTVKAMLHKLLDEIGTQIILGNTYHLYLRPGT
TGT_DECAR       ------DLLKTDGVARRGTLTLAHGVIQTPVFMPVGTYGTVKAMTPQSLNDIGAQICLGNTFHLWLRPGL
TGT_XANAC       MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGL
TGT_POLNA       -ATVDSEGAYLGSYARRGQLTLNHGVVQTPIFMPVGTYGTVKGVTPQSLHDMNAQIILGNTFHLWMRPGL
TGT_DESVV       ------EIHATDGAARTGCLHTAHGIVRTPIFMPVGTVGSVKAIAPDDLEAIGAEIILGNTYHLYLRPGD
TGT_DESVH       ------EIHATDGAARTGCLHTAHGIVRTPIFMPVGTVGSVKAIAPDDLEAIGAEIILGNTYHLYLRPGD
TGT_AZOSE       ------ELLAQHGAARRGRLTLAHGTVDTPAFMPVGTYGTVKAMTPAALADTGAQICLGNTFHLWLRPGL
TGT_AGRT5       ---FTFTLKSTSGGARLGEVAMPRGVIRTPAFMPVGTVGTVKAMYLDQVRELGADIILGNTYHLMLRPGP
TGT_XANC5       MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGL
TGT_MARAV       ------------GKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEEIGAHIILGNTFHLMLRPGT
TGT_PSEA6       ------ELDNTDGKARRGRLKFDRGIVETPAFMPVGTYGTVKGMTPEELDETGAHICLGNTFHLMLRPGT
TGT_TOLAT       ------ELKKTEGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVKDTGAQILLGNTFHLWLRPGQ
TGT_THICR       ------ELDKQDGRARRGRLIFKRGVVETPAFMPVGTYGSVKGMMPEEVADTGAQIILGNTFHLSIRPGT
TGT_SACD2       ------ELTTTDGDARRGQLTFSRGTVQTPAFMPVGTYGTVKGMLPRDIVDSGAEIILGNTFHLMLRPGT
TGT_FRATM       MTVMKFDLIKKEGKARRGKITFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGAEIILGNTFHLWLRPGT
TGT_RALEJ       --MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAEIILGNTFHLWLRPGL
TGT_PECCP       ------ELQTTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKDTGAQILLGNTFHLWLRPGQ
TGT_BRUME       ---FGFKVLARDGAARQGEISMPRGVVRTPAFMPVGTAGTVKAMYMDQVKELGADIILGNTYHLMLRPGA
TGT_BRUSU       ---FGFKVLARDGAARQGEISMPRGVVRTPAFMPVGTAGTVKAMYMDQVKELGADIILGNTYHLMLRPGA
TGT_NOVAD       MTRFSFKIHATDGKARTGAIQMMRGEIRTPAFMPVGTAATVKAMKVEDVRASGADIILGNTYHLMLRPGA
TGT_CUPTR       --MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAQIILGNTFHLWLRPGL
TGT_STRM5       MSRLQFQLQTRDGRARRGRLTFPRGTVETPAFMPVGTYGSVKGILPDQVRALGAEIILGNTFHLYLRPGL
TGT_GLUDA       --------QARVGRARAGHLHTAHGVVPTPTFMPVGTVGTVKAMTMDSVRSTGAGIVLGNTYHLMLRPGA
TGT_CLOPS       ------------GKARRGEFVTPHGTIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOPE       ------------GKARRGEFVTPHGTIQTPIFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOP1       ------------GKARRGEFVTPHGTIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_XANOR       MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGL
TGT_XANOP       MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGL
TGT_XANOM       MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGL
TGT_DINSH       ------------GAARLGRINTPRGEIRTPAFMPVGTAATVKAMRPESVRETGADILLGNTYHLMLRPTA
TGT_RHOBA       --MFRYELIGTDGGARRGVFHTPRGPVRTPGFMPVGTLGTVKGLTIDQVAATGADMILGNTYHLRLRPGH
TGT_STRMK       MSRLQFQLQTRDGRARRGRLTFPRGTVETPAFMPVGTYGSVKGILPDDVRALGAEIILGNTFHLYLRPGL
TGT_POLSJ       -------------HARRGQLTLTHGVVQTPIFMPVGTYGTVKGVMPQSLHEMGAQIILGNTFHLWMRPGL
TGT_DICNV       ---------------------------QTPVFMPVGTQATVKGLSPEELDALGAEIILGNTFHLMLRPGA
TGT_LACPL       ---------------------TPHGTFPTPMFMPVGTQASVKSLAPEELDAMGAGVILSNTYHLWLRPGE
TGT_VIBVY       ------DLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAEILLGNTFHLWLRPGQ
TGT_VIBVU       ------DLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAEILLGNTFHLWLRPGQ
TGT_THEYD       ------------GLARTGIIETQRGIIHTPAFMPVGTNGTVKAMTPEEVRQIGYEIILSNTYHLYLRPGH
TGT_PHOLL       ------ELQTTDGQARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_NEIMA       -------LHKKDGYARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_METPP       ------DLLHTEGHARRGRLTLNHGVVETPIFMPVGTYGTVKGVMPASLEAMGAQIILGNTFHLWLRPGL
TGT_NEIMF       -------LHKKDGYARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_FRAP2       MTVMKFDLIKKEGKARRGKISFPRGDIQTPAFMPVGTYGAVKSLSPVELKEMGADIILGNTFHLWLRPGT
TGT_THET2       ---------------------TPHGAVETPLFMPVGTAGSVKGLMPKDLEAIGSQVLLANTYHLLLRPGP
TGT_ERWCT       ------ELQTTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_CHRSD       ------ERLAQDGQARRGRLSFPRGTVETPAFMPVGTYGTVKGMTPQSVKDIGAEIILGNTFHLWLRPGT
TGT_YERE8       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_SHEPA       ------ELDTTQGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRETGADILLGNTFHLWLRPGE
TGT_NEIM0       -------LHKKDGYARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_ERWT9       ------ELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVQDTGAQIILGNTFHLWLRPGQ
TGT_THET8       ---------------------TPHGAVETPLFMPVGTAGSVKGLMPKDLEAIGSQVLLTNTYHLLLRPGP
TGT_NEIMB       -------LHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_SERP5       ------ELDTTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_LARHH       --MLEFTLHKTSGHARRGTLRLNHGTIETPVFMPVGTYGAVKAMTPDRLDETGAQIILGNTFHLWLRPGL
TGT_XYLFA       MSRLQFQLQATDGAARRGQLSFPCGTVQTPAFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGL
TGT_XYLFM       MSRLQFQLQATDGAARRGQLSFPCGTVQTPAFMPVGTYGAVKAVLPGQLCDLGAEIILGNTFHLFLRPGL
TGT_VIBCM       ------ELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_VIBCH       ------ELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_SHISS       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHIFL       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHIF8       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHIDS       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHIBS       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHIB3       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHEHH       ------ELDTTQGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_RHILO       ---FSFKVLATDGRARRGIIDMPRGEIRTPAFMPVGTGGTVKTMYMDQVRGVGADIILGNTYHLMLRPGA
TGT_ESCF3       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOUT       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOSM       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOSE       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOLU       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOLI       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOLC       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOL6       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOL5       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOK1       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOHS       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECODH       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECOBW       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO8A       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO81       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO7I       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO5E       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO57       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO55       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO45       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO27       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ECO24       ------ELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SHESR       ------ELDTTDGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHESM       ------ELDTTDGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHESA       ------ELDTTDGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_NEIG2       -------LHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_NAUPA       -------IDSIDGNARACTIKTEHSEIKTPIFMPVGTAAAVKSLAIDMMEILDAPIILGNTYHLYLRPGD
TGT_PROMA       ----------TAGRVGRLS--TPHGILSTPQFMPVGTLGTVKGITATQLKDTNAQMILANTFHLHLQPGE
TGT_DICTD       --IFEIIVRDKKTRARLGKLKTFHGEINTPVFMPVGTQGAVKTLSPEEVEKVGAEIILSNTYHLFLRPGH
TGT_CHRVO       ----------TSGGARRGTLELNHGTVETPVFQPVGTYGSVKAMSPVELNDIGAQIILGNTFHLWLRPGL
TGT_THENN       ------EVKKTSGKARVGVLKLPHGVVRTPVFMPVGTNANVKLLTPRDLEEAGAEIVLSNTFHLMLKPGV
TGT_RALME       --MLNFELLTTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAQIILGNTFHLWLRPGL
TGT_PROMH       ------ELDKTDGHARRGRLKFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQILLGNTFHLWLRPGQ
TGT_SHEPW       ------ELDTTQGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRETGADILLGNTFHLWLRPGE
TGT_YERPY       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPS       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPP       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPN       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPG       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPE       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPB       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERPA       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_YERP3       ------ELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_XYLFT       MSRLQFQLQATDGAARRGQLSFPCGTVQTPTFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGL
TGT_XYLF2       MSRLQFQLQATDGAARRGQLSFPCGTVQTPTFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGL
TGT_RALEH       --MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAHIILGNTFHLWLRPGL
TGT_NEIG1       -------LHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDIKAQIILGNTYHLWLRPGL
TGT_ACTPJ       ------ELKTTSGNARRLTFSRPKGEYETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQ
TGT_ACTP7       ------ELKTTSGNARRLTFSRPKGEYETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQ
TGT_ACTP2       ------ELKTTSGNARRLTFSRPKGEYETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQ
TGT_ACIAC       ------ELLATASHARRGTLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLHEMGAQIILSNTFHLWMRPGL
TGT_PSYIN       ----------TDGRARRGRLTFDRGSVETPAFMPVGTYGTVKGMTPEEVDATGAEILLGNTFHLWLRPGQ
TGT_DICT6       --------------ARLGRLKTFHGEVNTPVFMPVGTQGAVKTLSPEEVEEVGAEIILSNTYHLFLRPGQ
TGT_SHEFN       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEB9       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEB8       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEB5       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEB2       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_EDWI9       ------ELVSTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVAQTGAQILLGNTFHLWLRPGQ
TGT_CLOBH       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOB1       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_AZOSB       ------ELLSTSAGARRGRLTLAHGAVETPVFMPVGTYGTVKAMTPAMLSDVGAQICLGNTFHLWLRPGL
TGT_SYNPX       ---FEISAHCANTAARCGCFHTPHGPVHTPRFMPVGTLATVKGISTDQLARTGAQMVLSNTYHLHLQPGE
TGT_LAWIP       -------ITATDGSARTGVLYTAHGIVNTPIFMPVGTVGSVKAIAPDDLEAISAEIILGNTYHLYLRPGD
TGT_CLOBM       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOBL       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOBK       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOBJ       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_CLOB6       ------KLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_LEPCP       --MLNFDLLTTEGHARRGRLTLNHGVVETPIFMPVGTYGTVKGVMPRDLETMGAQIILGNTFHLWMRPGQ
TGT_DIAST       MLKFEILATDTSSHARRGTLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLREMGAQIILGNTFHLWMRPGL
TGT_VIBC3       ------ELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_SULDN       -------LEATSKNARACTIKTAHSTIKTPVFMPVGTLGSVKALDMEDVLDLGAEIILANTYHMYLRPGD
TGT_SHESH       ------ELDTTQGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEDO       ------ELDTTQGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_HAMD5       ------QLQKTDGRARLGKLIFERGLVDTPAFMPVGTYGSVKSMTPDEITETGAQIILGNTFHLWLRPGQ
TGT_ACISJ       MLKFEILATDTSSHARRGKLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLREMGAQIILGNTFHLWMRPGL
TGT_SHEAM       ------ELITTQGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_CLOK5       ------KLLKKDGSSRRGEFSTPHGVVQTPVFMNVGTLAAIKGVSTEDLKEIGCQIELSNTYHLSLRPGD
TGT_CLOK1       ------KLLKKDGSSRRGEFSTPHGVVQTPVFMNVGTLAAIKGVSTEDLKEIGCQIELSNTYHLSLRPGD
TGT_SULNB       ------QIDKTDSKARACTIKTAHSTIQTPVFMPVGTVGAVKALDATDLATIKPEIILGNTYHLYIRPGD
TGT_SHESW       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEPC       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_SHEON       ------ELDTTDGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_PHOPR       ------ELDKTQGRARRGRLQFERGTVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_PASMU       ------ELDKTDGNARRLVFERPQGTFETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_NITMU       ------QLHRTDGLARRGTLSLTHGVVETPAFMPVGTYGAVKTMSPADLQVINAHIVLGNTFHLWLRPGL
TGT_DELAS       MLQFDLLKTDPSSHARRGQLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLQEMGAQIILGNTFHLWMRPGL
TGT_CLOTE       ------------GNAKRGRFETPHGTIETPVFMNVGTLGVIKGVSSMDLKEIGCQVELSNTYHLHLRPGD
TGT_SHELP       ------ELDTTDGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGE
TGT_KLEP7       ------ELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_KLEP3       ------ELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_CAMFF       ------KIDKTDGNARACTLQTAHSTIQTPIFMPVGTLGAVKSLDAIDLKELDAKIILANTYHLYLRPTS
TGT_SORC5       ---------ARDGHARTGVLSTPHGDVLTPTFMPVGTQGSVKTLTPAEVAATGARIVLGNTYHLWLRPGP
TGT_RICTY       MSKFSFTIHSNYKKARSGVITTAHGKIRTPTFMPVGTRGTVKAMLTESVVETGADILLGNTYHLMLQPSA
TGT_HAEI8       ------ELDKTSGNARRLVFERPQGTFETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_CITK8       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ALISL       ------ELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKDTGAEILLGNTFHLWLRPGQ
TGT_VIBSL       ------ELKKTNSGARRGQLQFERGTVETPAFMPVGTYGTVKGMTPEEVKDTGAEILLGNTFHLWLRPGQ
TGT_VIBPA       ------DLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQ
TGT_VIBHB       ------DLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQ
TGT_HAEPS       ------ELKKTNGNARRLTFSRPKGEYETPAFMPVGTYGTVKGMTPEEVAQTGAQILLGNTFHLWLRPGQ
TGT_ZYMMO       ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGA
TGT_VIBFM       ------ELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQ
TGT_VIBF1       ------ELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQ
TGT_PROMP       ---FEIKSNCSNTEARTGIFHTPNGQVNTPRFMPVGTLATVKGISSEQLISTGSEMILSNTFHLHLQPGE
TGT_SALTI       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_RICB8       MSKFSFNINHQYKKARSGIITTAHGNIRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPSA
TGT_RICBR       MSKFSFNINHQYKKARSGIITTAHGNIRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPSA
TGT_HAEIG       ------ELDKTSGNARRLVFERPQGTFETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_CAMC1       ------EVIKKDGNARRGILTTAHSVIQTPVFMPVGTVGAVKSLDAFDMSELDAKIILANTYHMYLRPGS
TGT_AERHH       ------ELKTTDGRARRGQLVFERGTVQTPAFMPVGTYGTVKGMTPEEVRETGAQILLGNTFHLWLRPGQ
TGT_VESOH       ------ELKNTNYLARRGKIIFDRGEVETPSFMPVGTYGSVKAMTPEELSSFGTQMILGNSFHLAITPGI
TGT_SALTY       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALSV       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALPK       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALPC       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALPB       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALPA       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALNS       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALHS       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALG2       ------ELDTTDGRARRGRLVFDRGIVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALEP       ------ELDTTDGRARRGRLVFDRGIVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALDC       ------ELDTTDGRARRGRLVFDRGIVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALCH       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_SALA4       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_HAEDU       ------ELKSTSGMARRLTFSRPQGEVETPAFMPVGTYGTVKGMTPEEVKATGAQILLGNTFHLWLRPGQ
TGT_HAEIN       ------ELDKTSGNARRLVFERPQGTFETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_DESOH       MFQFETTTACPDTKARTGKMTTAHGDVATPVFMPVGTLATVKSLSPEDLVACGAQIILGNTYHLYLRPGC
TGT_SPHAL       ---FAFSISATDGAARAGVIAMQRGEIRTPAFMPVGTAATVKAMRPAEVRAAGADIILGNTYHLMLRPTA
TGT_HAEIE       ------ELDKTSGNARRLVFERPQGTFETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_AERS4       ------ELKTTDGRARRGQLVFERGTVQTPAFMPVGTYGTVKGMTPEEVRETGAEILLGNTFHLWLRPGQ
TGT_RICPR       MSKFSFTIHSHYKKARSGVITTAHGEIRTPAFMPVGTRGAVKAMLTEAVVETGADILLGNTYHLMLQPSA
TGT_RICCN       MSKFSFNIHHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_RICAE       MSKFSFNIHHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_XENTR       --------------ARACEFRLPHGPVKTPVFMPVGTQGTMKGVTADQLRNLGCEICLGNTYHLGMRPGP
TGT_THEAB       ------ELLKTSGNARRGRIYLPHGVVETPTFMPVGTNANVKLMTPKLLDEIGAQIILGNAFHLYLKPGL
TGT_SALAR       ------ELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_PROM5       ---FEVISSCSNTEARTGIFHTPHGQVRTPRFMPVGTLATVKGISSQQLKSTGSEMILSNTFHLHLQPGE
TGT_HUMAN       --------ECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGP
TGT_ENT38       ------ELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQ
TGT_ARCB4       ------KIDGTSQGARACTIKTAHSTILTPVFMPVGTQGTVKALDANDMLELGAKIILGNTYHLYLRPGS
TGT_RICPU       MSKFSFNIYHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_RICM5       MSKFSFNIHHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_RICRS       MSKFSFNIHHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_RICRO       MSKFSFNIHHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_XENLA       --------------ARACELQMPHGQVKTPVFMPVGTQGTMKGVTADQLRNLGCEICLGNTYHLGMRPGP
TGT_SODGM       ------QLLKTDGQARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQ
TGT_MANSM       ------KLKTTSGAARRLTFNRPQGEFQTPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_PROM2       --MFEFEITSNCSNTKARTFHTPNGKVNTPKFMPVGTMATVKGISSKQLTSTGSEMILSNTFHLHLQPGE
TGT_CAMHC       ------QIDKTDGNARACTITTAHSVIKTPIFMPVGTVGAVKSLDALDLKELDAKIILANTYHMFLRPGS
TGT_HELPS       ----DFQLQATDNNARAGLLNLAHSQVATPVFMPVGTQGCIKSLDATDMQGLGAKLILANTYHLYLRPGE
TGT_THEM4       ------ELLKTHKNARRGRIYLPHGVVETPTFMPVGTNANVKLMTPENLEEIGAQIILANAFHLYLKPGM
TGT_RALSO       --MLNFDLLTTDGLARRGRMTLNHGVVETPIFMPVGTYGAVKAMSPVELKDIGAQIILGNTFHLWLRPAL
TGT_THEP1       ------EVKKTFGKARLGVMKLHHGAVETPVFMPVGTNASVKLLTPRDLEEAGAEIILSNTFHLMLKPGV
TGT_THEMA       ------EVKKTFGKARLGVMKLHHGAVETPVFMPVGTNASVKLLTPRDLEEAGAEIILSNTFHLMLKPGV
TGT_RICAH       MSKFSFNIHHQHKKARSGIIATAHGEIRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPSA
TGT_RALPJ       ------ELLTTDGLARRGRMTLNHGVVETPIFMPVGTYGAVKAMSPAELKDIGAQIILGNTFHLWLRPGL
TGT_PROM0       --------------ARTGIFHTPNGKVNTPKFMPVGTLATVKGISSKQLISTGSEMILSNTFHLHLQPGE
TGT_RICFE       MSKFSFNIHHQHKKARNGVITTAHGEIRTPAFMPVGTRGTVKAMLPESVAETGADILLGNTYHLMLQPTA
TGT_PROMS       ---FEITSNCSNTAARTGIFHTPNGQVNTPKFMPVGTLATVKGISSKQLTSTGSEMILSNTFHLHLQPGE
TGT_PROM9       MFQFEITSNCSNTDARTGIFHTPNGQVNTPRFMPVGTLGTVKGISSKQLTSTGSEMILSNTFHLHLQPGE
TGT_WOLSU       -------LHVTDGRARAATLELAHGSIPTPIFMPVGTQASVKALDTDLLEHIDAPIILGNTYHLYLRPGD
TGT_HAES1       -------LHKTNGMARTMTFNRPQGEFETPAFMPVGTYGTVKGMTPEEVRVTGAEILLGNTFHLWLRPGQ
TGT_ACTSZ       ------KLKTTSGTARRMTFSRPQGEFQTPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQ
TGT_THESQ       ------EVKKTFGKARLGVMKLHHGAVETPVFMPVGTNANVKLLTPRDLEEAGAEIILSNTFHLMLKPGV
TGT_VEREI       MLQFDLLTTDPASHARRGRLTLRHGQVQTPIFMPVGTHGSVKGVLPRSLHEMGAQIILGNTFHLWLRPGL
TGT_HELPY       ----DFQLQATDNNARAGLLNLAHSQVATPVFMPVGTQGCIKSLDATDAQELGAKLILANTYHMYLRPGE
TGT_HELAH       ----DFQLQAVDKHARAGILNLVHSQVETPIFMPVGTQGCIKSLDAIDMQELSAKLILANTYHMYLRPGE
TGT_RICCK       MSKFSFNIHQMHKKARSGVITTAHGEIRTPAFMPVGTRGTIKAMLSESVAETGADILLGNTYHLMLQPSS
TGT_CAMLR       ------KVEYKSANARACRIKTTHSEILTPAFMPVGTLAAIKSLDAIDMSELDAKIILANTYHLYLRPSS
TGT_HELP2       ----DFQLQATDKHARAGLLNLAHSQVATPVFMPVGTQGCIKSLDATDAQELGAKLILANTYHMYLRPGE
TGT_HELPJ       ----DFQLQAVDDNARAGVLNLAHSQVETPVFMPVGTQGCIKSLDAMDAQELGAKLILANTYHMYLRPGE
TGT_RAT         --------ECSRSRARAGELRLPHGTVATPVFMPVGTQATMKGITAEQLDSLGCRICLGNTYHLGLRPGP
TGT_MOUSE       --------------ARAGELRLPHGTVATPVFMPVGTQATMKGITTEQLDSLGCRICLGNTYHLGLRPGP
TGT_SOLUE       ---FEVVAECPHTRARAGVLHTAHGDIETPVFMPVGTQATVKGLTQRDLEDLGVKILLSNTYHLYLRPGH
TGT_CLOPH       ------KLICKDGNAKRGEFTTVHGKIQTPVFMNVGTAAAIKGVSTMDLQEIGTQVELSNTYHLHVRPGD
TGT_HELPH       ----DFQLQAVDDNARAGLLNLAHSQVATPVFMPVGTQGCIKSLDATDAQELGAKLILANTYHMYLRPGE
TGT_BLOPB       ------QLLQTDGHARLGRLICNQGIVDTPAFMPVGTYGSIKTLTAKEVEASGTQIILSNTFHLWLRPGL
TGT_HELPG       ----DFQLQAIDKHARAGLLNLAHSQVATPVFMPVGTQGCIKSLDAMDMQELGAKLILANTYHMYLRPGE
TGT_CAMC5       ------EVLKTDGNARAGVLTTAHSVIQTPIFMPVGTVGAVKSLDATDMRELDAKIILANTYHMYLRPGS
TGT_HELHP       -------LQAQDGGARALSLKLAHSEVQTPVFMPVGTQGCVKALDSRDMSELNAQIILVNTYHMYLRIGI
TGT_DROME       --------------ARAGLMTLRHSEVNTPVFMPVGTQGTLKGIVPDQLIELNCQILLGNTYHLGLRPGI
TGT_CAMJJ       ------KLKHKDGMARVCEITTAHSTFLTPVFMPVGTVGAVKSLDANDMNELDAKIILANTYHMYLRPTS
TGT_CAMJR       ------KLKHKDGMARVCEITTAHSTFLTPVFMPVGTVGAVKSLDANDMNELDAKIILANTYHMYLRPTS
TGT_METI4       ---FEVIQKSGGSRARLGRLLTPHGVVETPCFMPVGTSATVKAIFPKDLEEEGIKLILANAYHLLFRPGI
TGT_CAMJ8       ------KLKHKDGMARVCEITTAHSTFLTPVFMPVGTVGAVKSLDANDMNELDAKIILANTYHMYLRPTS
TGT_BAUCH       ------------------------GVVETPAFMPVGTYGTVKSLTTEEVKDTGTQMILCNAFHLWLRSEQ
TGT_ROSS1       ---FDIEARDPHSRARAGRITTAHGVIETPVFMPVGTRGSIKSLTPDEVRNHGAQIILGNTYHLYLQPGH
TGT_CAMJD       ------KLKHKDGMARVCEITTAHSTFLTPVFMPVGTVGAVKSLDANDMNELDAKIILANTYHMYLRPTS
TGT_CAMJE       ------KLKHKDGMARVCEITTAHSTFLTPVFMPVGTVGAVKSLDANDMNELDAKIILANTYHMYLRPTS
TGT_SCHPO       ---FKVVARCSTTRARVTDIQLPHGLVESPVFMPVGTQASLKGVLPEQLDALGCKIMLNNTYHLGLKPGQ
TGT_BLOFL       ----------TDGDARVGKLTCHHGIIETPAFIPVGTYGVVKSVTSQEVAESGAQIILSNTFHLWLRPGL
TGT_BRAHW       ----------------------------TPVFMPVGTKATVKALTPLMIEETESKIILANTYHLVLKPGL
TGT_TREDE       --------QDAASPARTGVLELPHGKVLTPAFMPVGTAATVKAMTKDDLDEIGFEIILANTYHLFLRPGI
TGT_BUCAP       --------------------EARHGMFETPVFMPVGTYGTVKSLNIEEIKNTGSKIILSNALHLYLRPGQ
TGT_BUCAT       ---------------------------ETPVFMPVGTYGAVKSISTEEIKNTGSRIILSNAFHLYFRPGL
TGT_BUCA5       ---------------------------ETPVFMPVGTYGAVKSISTEEIKNTGSRIILSNAFHLYFRPGL
TGT_BUCAI       ---------------------------ETPVFMPVGTYGAVKSISTEEIKNTGSRIILSNAFHLYFRPGL
TGT_DANRE       --------------ARACSLTLPHCAVNTPVFMPVGTQGTMKGITADQLEDLDCQICLGNTYHLGMRPGP
TGT_LEPBP       -SIFKEGIYDTGSYARTGTLDLNGIQIQTPIFMPVGTRGSIKSLTSEDIDELGYNLILANTYHLYLKPGK
TGT_LEPBA       -SIFKEGIYDTGSYARTGTLDLNGIQIQTPIFMPVGTRGSIKSLTSEDIDELGYNLILANTYHLYLKPGK
TGT_CAEEL       ------DVLARAGFARRGNLHLPHSIVETPVFMPVGTQGTMKGIVPEQLVSMDCRILLCNTYHLGHRPGH
TGT_ARCFU       -------IKHTLDRMRVGKVKTRHGSFETPVFIPVATLAAIRGLDNRDLKDMGVEVILANTYHLHLRPGD
TGT_CAEBR       ------DVLARAGFARRGNLHLPHSIVETPVFMPVGTQGTMKGVVTEQLVAMDCRILLCNTYHLGHRPGH
TGT_BORT9       -----------NSNARLGVLELPHGKVETPCFMPVGTLGAMKALKHDVLEKLGCDLMLANTYHLYLRPGI
TGT_BORHD       -----------NSNARIGVLELPHGKVTTPCFMPVGTLGVMKALKHDVLEKLGCNLMLANTYHLYLRPGI
TGT_BORDL       -----------NSNARLGILELPHGNVATPCFMPVGTLGVMKALKHDVLEKLGCDLMLANTYHLYLRPGI
TGT_BORRA       -----------NSNARLGILELPHGNVATPCFMPVGTLGVMKALKHDVLEKLGCDLMLANTYHLYLRPGI
TGT_LEPIN       ---------------------------KTPVFMPVGTRGVVKTLSADDLEELEYSLILGNTYHLYLRPGT
TGT_LEPIC       ---------------------------KTPVFMPVGTRGVVKTLSADDLEELEYSLILGNTYHLYLRPGT
TGT_LEPBL       ---------------------------ETPVFMPVGTRGVVKTISADDLEELEYSLILGNTYHLYLRPGT
TGT_LEPBJ       ---------------------------ETPVFMPVGTRGVVKTISADDLEELEYSLILGNTYHLYLRPGT
TGT_PARUW       MTYFKFELRSKKSRARVGRIHTPHGIIDTPNFVAVGTNGTVKALNNTMLHDIGLQLMFCNTYHMMLQPGT
TGT_BORGA       -------------NARVGFLNLPHGRVDTPCFMPVGTLGAMKGLKHSVLEKLKCNLMLANTYHLYLRPGI
TGT_CHLCV       --------QSKKSRARVGKIETAHGIIDTPAFVPVATNGALKGV----IDHSNIPLMFCNTYHLLVHPGT
TGT_CHLTR       MALFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGV----LDHSNIPLMFCNTYHLIVHPGA
TGT_CHLTB       MALFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGV----LDHSNIPLMFCNTYHLIVHPGA
TGT_CHLT2       MALFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGV----LDHSNIPLMFCNTYHLIVHPGA
TGT_CHLAB       --------QSKKSRARVGRIETAHGIIDTPAFVPVATNGALKGV----VDHSNIQLMFCNTYHLLVHPGT
TGT_CHLFF       --------QSKKSRARVGRIETDHGIIDTPAFVPVATNGALKGV----VDHSNIPLMFCNTYHLLVHPGT
TGT_CHLTA       MALFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGV----LDHSNIPLMFCNTYHLIVHPGA
TGT_CHLMU       MALFEILHQSKKSRARVGRIETEHGCIDTPAFVPVATNGALKGV----LDHSNIPLMFCNTYHLIVHPGA
TGT_CHLPN       --------QSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGV----IDHSDIPLLFCNTYHLLLHPGP
TGT_BORBU       -------------NARVGFLNLPHGRVDIPCFMPVGTLGAMKGLKHAVLEKLECNLMLANTYHLYLRLGI
TGT_BORBZ       -------------NARVGFLNLPHGRVDIPCFMPVGTLGAMKGLKHAVLEKLECNLMLANTYHLYLRLGI
ATGT_METTH      ---FMFEIKSKDGLGRTGILKTEHGTVRTPALMPVKQTIDVKGP--------GAEIVITNAYIIYRNPEL
QTRD1_DANRE     ----------------------------------------------------------------------
QTRD1_XENLA     ----------------------------------------------------------------------
QTRD1_IXOSC     ----------------------------------------------------------------------
QTRD1_XENTR     ----------------------------------------------------------------------
QTRD1_HUMAN     ----------------------------------------------------------------------
ATGT_METAC      ---------------------TPHGIVETPTVMPV-INPNIQLISPKEMKSFGAEILITNSYIIYRKEEL
QTRD1_MOUSE     ----------------------------------------------------------------------
QTRD1_DROAN     ----------------------------------------------------------------------
QTRD1_ANOGA     ----------------------------------------------------------------------
QTRD1_DROYA     ----------------------------------------------------------------------
QTRD1_DROER     ----------------------------------------------------------------------
QTRD1_PONAB     ----------------------------------------------------------------------
QTRD1_DROSE     ----------------------------------------------------------------------
ATGT_METBF      ---------------------TPHGTVETPTVMPV-INPNIQLIPPKEMRNFGAEILITNSYIIYRKEEL
ATGT_METST      --IVDFEIKYKDAMARVGKFKTPHGTVTTPALMPVVHP----GKQTLDVKKLGAQIVITNSYIIYXXXXX
ATGT_META3      ---------------------------ETPTIMPVHPNPKKQTVSIEKIEKL-ASVIITNSYIINTNPEL
QTRD1_TRIAD     ----------------------------------------------------------------------
ATGT_METMA      ---------------------TPHGVVETPTVMPV-INPNIQLISPKEMRSFGAEILITNSYIIYRKEEL
ATGT_HALVO      -----------AGRIGRLSVPRAGVTVETPALLPV-VNPNIDTISPARLSEFGAEILITNSYIIKTNDHL
QTRD1_DROME     ----------------------------------------------------------------------
ATGT_METS3      ------EIKAKDNRGRVGVLKTNSGDVKTPNLMPV---IHPRKQTI-DVKKYGADIVITNAYLIYKDEDL
ATGT_AERPE      ---------------------TQHGVVETPAFFPV-IDVYRQEVSVDEVRAAGFGQVITNAYLLWKRFGW
QTRD1_DROVI     ----------------------------------------------------------------------
QTRD1_AEDAE     ----------------------------------------------------------------------
QTRD1_DROPE     ----------------------------------------------------------------------
QTRD1_CAEEL     ----------------------------------------------------------------------
ATGT_THEON      MVEFKFEVKARDAAGRIGKLEVNGKKIETPAIMPVINPKQLT-VTPKELKEMGFGIIITNSYIIYKTPEL
QTRD1_DROPS     ----------------------------------------------------------------------
ATGT_METJA      ---------------------------ETPTIMPVIHPNPKKQIVSMDLINKLADVIITNSYITYKTKHL
QTRD1_CHICK     ----------------------------------------------------------------------
ATGT_NATPD      -----------AGRIGELSVPRAGTTVETPALLPV-VNPHIRTIAPAELESFGAQILITNGYILY---GS
ATGT_METMP      ------EIKARDAMGRLGSITINGKKIETPTIMPVIHPNPKKQTVSMDLINKMADVVITNSYITYTTPEL
QTRD1_CULQU     ----------------------------------------------------------------------
ATGT_PYRHO      ------EIKARDGAGRIGKLEVNGKKIETPAIMPVVNPKQMV-VEPKELEKMGFEIIITNSYIIYKDEEL
ATGT_METM7      ------EIKARDAMGRLGSITINGKKIETPTIMPVIHPNPKKQTVSMDLINKMADVVITNSYITYTTPEL
QTRD1_DROMO     ----------------------------------------------------------------------
ATGT_METM6      ------EIKARDAMGR-LGVITINGKIETPTIMPVIHPNPKKQTVSMDLINKMADVVITNSYITYTTPEL
ATGT_METM5      ------EIKARDAMGR-LGVITINGKIETPTIMPVHPNPKKQTVSMDLINKL-ADVVITNSYITYTTPEL
ATGT_METKA      ---------------------------KTPALLPV-VNPNKPTLDPREISKLGFDGVITNAYIIRKHEHL
ATGT_KORCO      -------VRKSDASARLSELKTKSGTLILPEFFPV-YNPNKPVITPREMSEMGIKAIITNSYLIYRSPEL
QTRD1_CAEBR     ----------------------------------------------------------------------
ATGT_HALSA      ------EVGAQDGLARILDVPRAGVTVETPTLMPVVNPNLITVEPSRFVDEFGAELLITNSYIINSDDDL
ATGT_PYRFU      ------EIKDRDAAGRIGKLEVNGKKIETPAIMPVVNPKQLI-VEPKELKRMGFDIIITNSYIIYKDKKL
ATGT_METVS      ---------------------------ETPTIMPVHPNPKKQTVSIDLINKLS-DVIITNSYITYTTPEL
QTRD1_DROWI     ----------------------------------------------------------------------
ATGT_THEAC      ------KIEERDGLARIAKFETPHGPIETPTVLPV-INPNIMNITPQEMKPLGLQGIITNSYIILRTPEL
ATGT_ARCFU      ---------------RICRIETPHGRIETPTILPV-INPNIPFIRAEEMKKFGAQAVITNSYIIYRSMRE
ATGT_THEVO      ------EIRERDGLARIARFDTPHGTIETPTVLPV-INPNIMDITPEEMKKYGVHGVITNSYIILRNDRL
ATGT_METHJ      ---------------------------KTPTLLPV-INPHLNLIPPKEMQEMGVEAVITNAYIFSRSEEY
QTRD1_DROGR     ----------------------------------------------------------------------
ATGT_PICTO      --------------ARIARFKTPHGEIETPTVMPV-INPNLNFLDESTLRSYGVQAVITNSYIIKRNQRL
ATGT_SULAC      --------------------ETKHGKLETPAFFPVINPVKNE-ITIQDILSVGFESIITNAFLIK-----
TGTL_SCHPO      ----------------------------------------------------------------------
ATGT_PYRKO      MVDFRFEVKARDASGRIGKLTVNGKTVETPAIMPVINPKQLI-VTPKELKEMGFGMIITNSYIIYKTPEL
ATGT_PYRAB      ------EVKARDGAGRIGKLEVNGKKIETPAIMPVVNPKQLI-VEPKELEKMGFDIIITNSYIIYKDREL
ATGT_NANEQ      -------------------------TIETPYLFPV-INPFKQELPIKEIKKMGFNAIITNAYILFKRK--
ATGT_HALMA      MTNFEVRQYDAAGRLGELTVPRAGVTVETPTILPV-VNPHVQTVAPATLSEFGAEILITNSYILH---GS
ATGT_SULTO      --------------------ETKSGKLETPVFFPV-INPFKSEISIKDIENLGFKNLITNAYLIKKITNT
TGTL_PLAFA      ----------------------------------------------------------------------
TGTL_PLAF7      ----------------------------------------------------------------------
ATGT_SULSO      ----------------------------------------------------------------------
TGTL_THEPA      ----------------------------------------------------------------------
TGTL_THEAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVVAEAGGVHRFMNYDGPMLTDSGGFQVFSLADTLKLDDEGLTFRSIYDGTKVRWTPESNMEIQEQLGAD
TGT_MOOTA       DIIREAGGLHRFMHWERPILTDSGGFQVFSLADLREISDEGVTFRSHLDGSIHFLGPAESMAVQEALGSD
TGT_CLOCE       DIVKQAGGLHGFMNWDRPILTDSGGFQVFSLSGLRKITEEGVTFRSHLDGSKHVFTPESVMDIENDLGAD
TGT_DESRM       DLVKEAGGLHKFMNWDGPILTDSGGFQVFSLGPLRTITEEGVEFRSHIDGSKHFFTPEKVMEIEQALGAD
TGT_HALOH       SLIDEAGGLHNFMNWQKPILTDSGGFQVFSLSDLREIKEEGVYFRSHLDGSRHFISPEKAIQIQMELGAD
TGT_LYSSC       DIVKEAGGLHKFMNWDRPILTDSGGFQVFSLSQFRKIEEEGVHFRNHLNGDKLFLSPEKAMEIQNDLGSD
TGT_MACCJ       DVIREAGGLHKFMNWDGPILTDSGGFQVFSLSDMRKIEEEGVHFRHHLNGSKLFLSPHKAMHIQNDLGSD
TGT_BACWK       EIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACCN       EIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVYFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_HERA2       DLVAEMGGLHRFMQWPKPILTDSGGFQVFSLGPHSKIDEDGVTFKSHIDGSKHRFTPESAIGIQEKLGAD
TGT_BACCQ       EIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_STACT       ELIKRAGGLHQFMNWDGPILTDSGGFQVFSLSNLRKITEEGVYFRHHKNGSKLFLSPEKSMEIQNDLGSD
TGT_BACHK       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACCZ       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACCR       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC7       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC4       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC3       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC2       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC1       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACC0       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACAN       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACAH       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACAC       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACAA       EIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_SYNE7       EIVAKAGGLHRFMNWSGPMLTDSGGFQVFSLSELRKIEERGVTFRSPRDGAVIEFTPERSIRIQNALGAD
TGT_STAAW       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAT       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAS       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAR       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAN       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAM       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAE       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAC       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAAB       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAA9       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAA8       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAA3       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAA2       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAA1       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_BACP2       DIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSEFRKIEEEGVHFRNHLNGDKLFLSPEKAMDIQNALGSD
TGT_BACA2       DIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_BACSU       DIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_NATTJ       DIVREADGLHKFMNWDRPILTDSGGFQVFSLGKLRQISEQGVEFRSHIDGSKLFMTPEKSIEIQEDLGSD
TGT_CLOTH       DIVKEAGGLHGFMNWDRPILTDSGGFQVFSLSDLRDIKEEGVTFKSHIDGSKHFISPEMAIKIQNDLGAD
TGT_BACLD       DIVKEAGGLHQFMNWNRAILTDSGGFQVFSLSEFRKIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSD
TGT_GEOKA       DIVEEAGGLHAFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDKLFLSPEKAVEIQNALGAD
TGT_STAHJ       DIIKQVGGLHNFMNWDGPILTDSGGFQVFSLSNLRKITEESVEFRHHTNGLKLFLSPEKSMEIQNDLGSD
TGT_OCEIH       DIIREAGGLHKFMNWDGAILTDSGGFQVFSLSDMREIKEEGVHFRNHLNGEKLFLSPEKAMDIQNALGSD
TGT_STAES       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKISEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_STAEQ       DIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKISEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSD
TGT_ANOFW       DIVKEAGGLHSFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDQLFLSPEKAMEIQNALGSD
TGT_GEOTN       DIVAEAGGLHAFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDKLFLSPEKATEIQNALGAD
TGT_BACHD       DIVKEAGGLHEFMNWDRPILTDSGGFQVFSLSDLRTIEEEGVHFRNHLSGEKLFLSPEGAMEIQNALGSD
TGT_LISIN       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_BACSK       EIIKEAGGLHQFMNWDKPILTDSGGFQVFSLSDLRKITEEGVHFRNHLSGEKLFLSPEKAMQIQHVLGSD
TGT_LISMH       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_THEPX       KIIEKAGGLHRFMNWDRAILTDSGGFQIFSLSSLRKIKEEGVEFRSHIDGSKHFFTPEKVIEIQNALGSD
TGT_LISW6       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_ANASP       AIVAGGGGLHKFMGWNGPMLTDSGGFQVFSLSEMRKITEEGVTFRSPRDGQIIKLTPERSIEIQNILGAD
TGT_THEP3       KIIEKAGGLHKFMNWDRAILTDSGGFQVFSLNSLRKITEDGVEFRSHIDGSRHFFTPEKVIEIQNALGSD
TGT_LISMO       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_LISMF       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_LISMC       ELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSD
TGT_THETN       KIIEKAGGLHKFMNWDRAILTDSGGFQVFSLSSLRKITEDGVEFRSHIDGSKHFFTPEKVIEIQNSLGSD
TGT_SYNS3       EIVADAGGLHRFMGWDGPMLTDSGGFQVFSLGDLNRIDDEGVDFRNPRNGSRILLTPERSMQIQMRLGAD
TGT_GRABC       DRVAALGGLHRFMDWPGPILTDSGGFQVMSLSSLRKLDKDGVTFQSHIDGSRHRLTPESSIGIQHKLDAT
TGT_PELTS       ELIREAGGLHRFMHWDGPILTDSGGFQVFSLGPLRKVSEEGVAFRSHIDGSEHFFSPEKAMEVQMALGSD
TGT_DESHD       ELIREAGGLHAFMHWDGAILTDSGGFQVFSLGDLRKITEEGVEFRSHLDGSKKFLSPEIATQVQMALGSD
TGT_SYNSC       EIVAAAGGLHRFMGWNGPMLTDSGGFQVFSLGDLNKIDDRGVVFRNPRDGRTIDMTPEHATQIQMALGAD
TGT_RHOS1       ERVARLGGLHRFMNWDRPILTDSGGFQVMSLADLRKLSEEGVTFRSHIDGSKHHLSPERSMEIQRLLGSD
TGT_THEEB       DIVAAAGGLHCFMGWSGPILTDSGGFQVFSLSEMRQISDQGVVFRSPHDGQIIELSPEGAIAIQEALGAD
TGT_ENTFA       DLVEEAGGLHKFMNWDQPILTDSGGFQVFSLSDMRKIEEEGVHFRNHLNGSKMFLSPEKAINIQNKLGSD
TGT_DESMR       ELVAKLGGLHRFMGWDGPILTDSGGFQVFSLSGLRRITEEGVTFASHIDGSKHLFSPEKVVSIQRNLGSD
TGT_RHOS4       ERVVRLGGLHRFMNWDRPILTDSGGFQVMSLADLRKLSEEGVTFRSHIDGSKHHLSPERSMEIQRLLGSD
TGT_CYAP4       GIVAAAGGLHRFMGWTGPILTDSGGFQVFSLSELRSIAEAGVTFRSPRDGEEIYLSPEKAIAIQNQLGAD
TGT_SYNY3       KIIAAAGGVHKFMGWSGPMLTDSGGFQVFSLSQLRTIGEQGVLFRSPRDGRLIDMTPENSIRIQNALGAD
TGT_STRPI       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_IDILO       QIIQQHGDLHDFMNWDKPILTDSGGFQVFSLGELRKITEEGVTFRSPINGEKILLTPEKSMQVQRELGSD
TGT_GLOVI       DIVAGAGGLHGFMQWPGPILTDSGGFQVFSLSSLRTIDDDGVTFREPKSGALVRFTPEHAVAVQNALGAD
TGT_STRZJ       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRR6       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPS       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPN       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPJ       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP4       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP2       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_CAUCR       ERVKRLGGLHKFMRWDKPILTDSGGFQVMSLSGISKLTEEAVTFSSHVDGSKHVLTPERSIEIQDLLGSD
TGT_LACLS       ELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSD
TGT_STRZP       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMLLSPEKAISIQNNLGSD
TGT_STRZT       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP7       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_LACLM       ELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSD
TGT_ACIAD       EVIKEHGGLHEFIKWDKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQQVLNSD
TGT_STRSY       ELVARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNISEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRS2       ELVARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNISEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_PSEHT       EIIKQHGGLHKFMNWDFPILTDSGGFQVFSLGAMRKITEEGVLFSSPVNGEKIMMTPESSMQVQRDLGSD
TGT_STRA5       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSD
TGT_STRA3       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSD
TGT_STRA1       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSD
TGT_LACLA       ELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSD
TGT_STRU0       ELIAKAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRGC       ELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPZ       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPM       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPG       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPF       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPD       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPC       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRPB       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP8       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP6       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP3       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_STRP1       ELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_DESDG       ELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRISEEGVEFRSHLDGSKHLFTPEKVVSIQRNLNSD
TGT_ACIBS       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_ACIBL       EQIRKLGGTHKFMSWDRSILTDSGGFQVFSLSELRKVTEEGVSFRSHLDGSSHLFSPESAMASQIGIGAD
TGT_RHIME       ERVARLGGLHKFIRWERPILTDSGGFQVMSLSSLRKLNEQGVTFKSHVDGALYHMSPERSIEIQGLLGSD
TGT_ACIBY       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_ACIBT       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_ACIB5       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_ACIB3       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_SYNFM       ERVARLGGLHRFMHWNRSILTDSGGFQVFSLARINRIEEDGVVFQSHIDGARHAITPETSMECQMQLGSD
TGT_NITEC       EVIEAHGGLHRFMHWDGPILTDSGGFQVFSLGALRKISEEGVRFRSPVNGDTCFLTPEESMRIQRVLNSD
TGT_STRSV       ELIARAGGLHTFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_SILPO       ERIDRLGGLHRFMNWDRPILTDSGGFQVMSLAGLRKLTEKGVTFKSHIDGSKHELTPERSMEIQRLLGSD
TGT_ACIBC       EVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSD
TGT_SYNS9       QVVAEAGGLHRFMGWDGPMLTDSGGFQVFSLGNLNKIDERGVVFRNPRDGRTIDMTPEHATNIQMALGAD
TGT_PROM4       EIVHEAGGLHKFMGWDQPILTDSGGYQVFSLGKLNKIDDEGVEFKNPRDGSHLKLTPEIAIQIQMSLGSD
TGT_LACSS       DIVEKAGGLHKFMNWDRGVLTDSGGFQVFSLAKLRDISEEGVAFKSHLNGEKLFLSPEKAIHVENALGAD
TGT_STRMU       DLVARAGGLHKFMNWDQPILTDSGGFQVYSLAEKRNITEEGVTFKNHLNGARMFLTPEKAISIQNNLGSD
TGT_SYMTH       DLVQEAGGLHRFMNWKGAVLTDSGGFQVFSLADLRKITEEGVQFRSHIDGSTHFLSPEKAIAVENALGAD
TGT_SILST       ERIDRLGGLHKFMNWDRPILTDSGGFQVMSLAGLRKLTEKGVTFKSHIDGSRHELTPERSMEIQRLLGSD
TGT_DEHE1       PVVKEMGGLHKFMNWDGVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSD
TGT_STRT1       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSD
TGT_PSYA2       DIIDKFGGLHKFMHWDKPILTDSGGFQVFSLGAMRKITEEGVTFKSPIDGAKVFLSPEKSMQIQYSLNSD
TGT_ACIF5       EVISAVGGLHRMMHWDRPILTDSGGFQVFSLGALRKLTEAGVQFRAPTDGHMVFLGPEESMQIQAALGSD
TGT_ACIF2       EVISAVGGLHRMMHWDRPILTDSGGFQVFSLGALRKLTEAGVQFRAPTDGHMVFLGPEESMQIQAALGSD
TGT_METFK       EVIGEFGGLHRFMGWNGPILTDSGGFQVWSLGDLRKITEEGVRFRSPINGDSCFLTPEESMRIQKVLNSD
TGT_DESAH       EVMAHMGGLHPFMNWDRPILTDSGGFQFFSLAKLAKFKDEGVSFQSHIDGSRHLFTPERAVEIQSILGSD
TGT_STRE4       ELIARAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_PSYCK       DIIDKFGGLHKFMHWDKPILTDSGGFQVFSLGAMRKITEEGVTFKSPIDGAKVFLSPEKSMQIQYSLNSD
TGT_STRTD       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSD
TGT_STRT2       ELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSD
TGT_DEHSB       PIIKEMGGLHKFMNWDGVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSD
TGT_STRS7       ELIARAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSD
TGT_DEIRA       QLVKAHGGLPGFTAYPGPFLTDSGGFQVMSLGHMRKISEEGVVFKNHLDGSRVELTPERSIQVQEALGAD
TGT_JANSC       ERIANLGGLHSFMNWDKPILTDSGGFQVMSLADLRKLTEEGVTFRSHIDGSKHLLSPERSMEIQKLLGSD
TGT_JANMA       DIIAKFGGLHEFMGWNKPILTDSGGFQVFSLGEMRKITEEGVHFSSPINGDKLFLSPEVSMQIQRVLNSD
TGT_PROMM       GIVADAGGLHRFMGWDRPLLTDSGGFQIFSLADLNRIDDHGVVFRNPRNGSQIELTPERAIEIQMALGAD
TGT_NITSB       NVVKKLGGLHGFTGYNRSFLTDSGGFQAFSLSDISKANERGIEFQSHIDGSKHFFTPQKVLDIQYNLGSD
TGT_HERAR       DIVAKFGGLHEFMGWDKPILTDSGGFQVFSLGEMRKITEEGVHFSSPINGDKLFLSPEVSMQIQRVLNSD
TGT_FRATN       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPINGSKVFLSPEISMQVQRDLGSD
TGT_PSESM       EVIKGHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMQVQRDLGSD
TGT_XANCP       DVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPNDGARVFLGPEESMQIQKVLDSD
TGT_XANCB       DVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMQIQKVLDSD
TGT_XANC8       DVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPNDGARVFLGPEESMQIQKVLDSD
TGT_PSEPK       EVIKKHNGLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGSKVFMGPEESMQVQRDLGSD
TGT_PROM3       GIVADAGGLHRFMGWDRPLLTDSGGFQIFSLADLNRIDDHGVVFRNPRNGSQIELTPERAIEIQMALGAD
TGT_PEDPA       DIVKEGGGLHQFMNWKKGILTDSGGFQVFSLAKLRDITEEGVHFKNELNGANMFLSPEKAIQIENDLGPD
TGT_FRATW       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPINSSKVFLSPEISMQVQRDLGSD
TGT_FRATT       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPINSSKVFLSPEISMQVQRDLGSD
TGT_FRATO       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPVNSSKVFLSPEISMQVQRDLGSD
TGT_FRATH       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPVNSSKVFLSPEISMQVQRDLGSD
TGT_FRATF       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPVNSSKVFLSPEISMQVQRDLGSD
TGT_FRAT1       EIIKKHGSLHGFNGWDKPILTDSGGFQVFSLGKMRKLTEEGVTFKSPINSSKVFLSPEISMQVQRDLGSD
TGT_DESAP       ELVREAGGLHRFMHWNGPILTDSGGFQVFSLAPLRKLSDEGVEFRSHIDGSRHFFTPEKVVAVQEALGSD
TGT_CLOAB       DVVKKLGGLHKFMNWDRPILTDSGGFQVFSLAEIRKIKEEGVYFNSHIDGRKIFMGPEESMKIQSNLAST
TGT_THISH       EVIQLHGDLHDFMHWEKPILTDSGGFQVFSLADLRKITEEGVKFRSPVDGSEILLTPERSMDVQRALGSD
TGT_FUSNN       ELIARLGGLHKFMNWDRPILTDSGGFQVFSLGSLRKIKEEGVYFSSHIDGSKHFISPEKSIQIQNNLGSD
TGT_DEHSC       PIIKEMGGLHKFMNWDEVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSD
TGT_PSEAE       EVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSD
TGT_PSEAB       EVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSD
TGT_PSEA8       EVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSD
TGT_NITEU       EVIGAHGGLHRLMNWDGPILTDSGGFQVFSLGALRKICEEGVRFRSPVNGDTCFLTPEESMRIQQVLNSD
TGT_EUBE2       KIIKQLGGLHKFMNWDKPILTDSGGFQVFSLAGLRKIKEEGVTFQSHIDGHKIFMGPEESMQIQSNLGST
TGT_AZOVD       EVIRRHGDLHDFMQWHGPILTDSGGFQVFSLGALRKIREEGVYFASPVDGAKVFMGPEESMRVQRDLGSD
TGT_THIDA       EVIEAHGGLHRFMGWDKPILTDSGGFQVFSLGKLRKITEEGVKFASPTNGDKLFLTPETSMQIQRTLNSD
TGT_PSYWF       EVIDKFGGLHQFMNWNKPILTDSGGFQVFSLGAMRKITEEGVAFKSPIDGAKVFLSPEKSMQIQYSLNSD
TGT_AQUAE       EIIKKAGGLHRFISWNKPILTDSGGYQVFSLAKKVKVSDEGVEFQDHLQGDKHFFTPEKVVEIQEIFGSD
TGT_DECAR       EVIAAHKGLHDFMNWQKPILTDSGGFQVFSLGAMRKITEEGVKFSSPHDGAKLFLTPEISMQIQKVLNSD
TGT_XANAC       EVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSD
TGT_POLNA       DVVAQFGGLHKFESWHKPILTDSGGFQVWSLGEMRKISEEGVKFASPVNGDKLFLTPEISMQIQTLLNSD
TGT_DESVV       ELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRIAEEGVEFRSHLDGSKHLFTPEKVVSIQRNLNSD
TGT_DESVH       ELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRIAEEGVEFRSHLDGSKHLFTPEKVVSIQRNLNSD
TGT_AZOSE       DVVAAHGGLHRFMNWDRPILTDSGGFQVFSLGALRKISEEGVKFASPIDGAKLFLTPEESMRIQTVLNSD
TGT_AGRT5       ERVARLGGLHELIRWPHPILTDSGGFQVMSLSGLRKLDEKGVTFKSHVDGSLHHMSPERSIEIQGMLDSD
TGT_XANC5       EVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSD
TGT_MARAV       EVVKAHGDLHDFTQWQGPILTDSGGFQVFSLGEMRKITEQGVTFRSPVDGSKVELSPEIAIQVQRDLGSD
TGT_PSEA6       EIIKQHGDLHDFMHWQKPILTDSGGFQVFSLGDLRKITEEGVTFRSPINGEKILLTPEKSMQVQRDLGSD
TGT_TOLAT       DIMRKHGDLHDFMNWHGPILTDSGGFQVFSLGHIRKIKEEGVHFRNPINGEKIFLSPEKSMEIQNDL