[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV54981.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    8::236     2e-46  42%  240 aa  RESD_BACSU RecName: Full=Transcriptional regulatory protein resD;
    3::234     3e-45  40%  240 aa  PHOP_BACSU RecName: Full=Alkaline phosphatase synthesis
    1::222     1e-43  36%  226 aa  YCBL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    6::235     4e-43  40%  239 aa  YCF27_CYAPA RecName: Full=Probable transcriptional regulator
   20::250     3e-42  40%  251 aa  Y851_SYNP2 RecName: Full=Probable transcriptional regulatory
    4::233     6e-42  40%  240 aa  YCF27_PORAE RecName: Full=Probable transcriptional regulator
    3::227     1e-41  37%  233 aa  WALR_STAHJ RecName: Full=Transcriptional regulatory protein walR;
    3::227     2e-41  37%  233 aa  WALR_STAES RecName: Full=Transcriptional regulatory protein walR;
    3::227     2e-41  37%  233 aa  WALR_STAEQ RecName: Full=Transcriptional regulatory protein walR;
    6::236     2e-41  39%  239 aa  OMPR_SHIFL RecName: Full=Transcriptional regulatory protein ompR;
    6::236     2e-41  39%  239 aa  OMPR_SALTY RecName: Full=Transcriptional regulatory protein ompR;
    6::236     2e-41  39%  239 aa  OMPR_SALTI RecName: Full=Transcriptional regulatory protein ompR;
    6::236     2e-41  39%  239 aa  OMPR_ECOLI RecName: Full=Transcriptional regulatory protein ompR;
    6::236     2e-41  39%  239 aa  OMPR_ECOL6 RecName: Full=Transcriptional regulatory protein ompR;
    6::236     2e-41  39%  239 aa  OMPR_ECO57 RecName: Full=Transcriptional regulatory protein ompR;
    2::227     5e-41  38%  227 aa  YCLJ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    3::227     5e-41  36%  233 aa  WALR_STAS1 RecName: Full=Transcriptional regulatory protein walR;
   15::244     7e-41  38%  254 aa  YCF27_GUITH RecName: Full=Probable transcriptional regulator
    3::227     9e-41  36%  233 aa  WALR_STAAW RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAU RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAT RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAS RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAR RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAN RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAM RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAE RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAC RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAAB RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAA9 RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAA8 RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAA3 RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAA2 RecName: Full=Transcriptional regulatory protein walR;
    3::227     9e-41  36%  233 aa  WALR_STAA1 RecName: Full=Transcriptional regulatory protein walR;
    3::227     2e-40  38%  235 aa  YYCF_BACSU RecName: Full=Transcriptional regulatory protein yycF;
    4::237     2e-40  36%  241 aa  SRRA_STAAW RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAU RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAS RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAR RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAN RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAM RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAAC RecName: Full=Transcriptional regulatory protein
    4::237     2e-40  36%  241 aa  SRRA_STAA8 RecName: Full=Transcriptional regulatory protein
    6::235     3e-40  38%  243 aa  YCF27_PORYE RecName: Full=Probable transcriptional regulator
    6::235     3e-40  38%  243 aa  YCF27_PORPU RecName: Full=Probable transcriptional regulator
    8::237     3e-40  39%  255 aa  YCF27_GALSU RecName: Full=Probable transcriptional regulator
    1::227     8e-40  36%  228 aa  REGX3_MYCS2 RecName: Full=Sensory transduction protein regX3;
   25::255     1e-39  39%  257 aa  SPHR_SYNE7 RecName: Full=Alkaline phosphatase synthesis
    1::226     8e-39  35%  227 aa  REGX3_MYCTU RecName: Full=Sensory transduction protein regX3;
    1::226     8e-39  35%  227 aa  REGX3_MYCBO RecName: Full=Sensory transduction protein regX3;
   14::242     1e-38  36%  249 aa  YCF27_CYACA RecName: Full=Probable transcriptional regulator
    1::223     9e-38  37%  225 aa  AFSQ1_STRCO RecName: Full=Transcriptional regulatory protein afsQ1;
    4::230     5e-37  36%  231 aa  VANR_ENTFC RecName: Full=Regulatory protein vanR;
    6::235     8e-37  37%  237 aa  YVRH_BACSU RecName: Full=Transcriptional regulatory protein yvrH;
    1::216     2e-35  38%  220 aa  ARLR_STAS1 RecName: Full=Response regulator arlR;
    2::220     6e-35  36%  229 aa  IRLR_BURPS RecName: Full=Transcriptional activator protein irlR;
    6::224     1e-33  33%  228 aa  YKOG_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   25::228     2e-33  36%  231 aa  YRKP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    4::197     2e-33  36%  198 aa  REGX3_MYCLE RecName: Full=Sensory transduction protein regX3;
    2::222     3e-33  38%  225 aa  CZCR_RALME RecName: Full=Transcriptional activator protein czcR;
    7::234     3e-33  34%  235 aa  CSEB_STRAW RecName: Full=Transcriptional regulatory protein cseB;
    1::216     3e-33  36%  219 aa  ARLR_STAEQ RecName: Full=Response regulator arlR;
    1::216     4e-33  36%  219 aa  ARLR_STAES RecName: Full=Response regulator arlR;
    4::223     5e-33  33%  230 aa  MPRA_MYCSS RecName: Full=Response regulator mprA;AltName:
    4::223     5e-33  33%  230 aa  MPRA_MYCSK RecName: Full=Response regulator mprA;AltName:
    4::223     5e-33  33%  230 aa  MPRA_MYCSJ RecName: Full=Response regulator mprA;AltName:
    2::224     7e-33  35%  227 aa  COPR_PSESM RecName: Full=Transcriptional activator protein copR;
    1::216     2e-32  36%  219 aa  ARLR_STAHJ RecName: Full=Response regulator arlR;
    2::218     3e-32  35%  223 aa  YEDW_ECOLI RecName: Full=Probable transcriptional regulatory
    2::227     3e-32  33%  227 aa  CUSR_ECOLI RecName: Full=Transcriptional regulatory protein cusR;
    2::227     3e-32  33%  227 aa  CUSR_ECOL6 RecName: Full=Transcriptional regulatory protein cusR;
    2::227     3e-32  33%  227 aa  CUSR_ECO57 RecName: Full=Transcriptional regulatory protein cusR;
    1::222     4e-32  34%  226 aa  PCOR_ECOLX RecName: Full=Transcriptional regulatory protein pcoR;
    1::216     8e-32  34%  219 aa  ARLR_STAAW RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAAS RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAAR RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAAM RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAAC RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAAB RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAA8 RecName: Full=Response regulator arlR;
    1::216     8e-32  34%  219 aa  ARLR_STAA3 RecName: Full=Response regulator arlR;
    3::224     1e-31  33%  225 aa  MTRA_MYCTU RecName: Full=DNA-binding response regulator mtrA;
    3::224     1e-31  33%  225 aa  MTRA_MYCPA RecName: Full=DNA-binding response regulator mtrA;
    3::224     1e-31  33%  225 aa  MTRA_MYCBO RecName: Full=DNA-binding response regulator mtrA;
    3::224     2e-31  33%  225 aa  MTRA_MYCLE RecName: Full=DNA-binding response regulator mtrA;
    4::223     2e-31  33%  230 aa  MPRA_MYCBP RecName: Full=Response regulator mprA;AltName:
    4::223     2e-31  33%  230 aa  MPRA_MYCBO RecName: Full=Response regulator mprA;AltName:
    2::226     3e-31  35%  227 aa  PHOB_RHIME RecName: Full=Phosphate regulon transcriptional
    3::225     3e-31  34%  229 aa  PHOB_KLEPN RecName: Full=Phosphate regulon transcriptional
    4::225     3e-31  33%  232 aa  MPRA_MYCUA RecName: Full=Response regulator mprA;AltName:
    4::223     3e-31  32%  230 aa  MPRA_MYCS2 RecName: Full=Response regulator mprA;AltName:
    4::223     4e-31  33%  230 aa  MPRA_MYCTU RecName: Full=Response regulator mprA;AltName:
    4::223     4e-31  33%  230 aa  MPRA_MYCTA RecName: Full=Response regulator mprA;AltName:
    1::221     4e-31  33%  224 aa  HSSR_STAEQ RecName: Full=Heme response regulator hssR;
    2::221     5e-31  33%  228 aa  MPRA_MYCPA RecName: Full=Response regulator mprA;AltName:
    2::221     5e-31  33%  228 aa  MPRA_MYCA1 RecName: Full=Response regulator mprA;AltName:
    3::231     6e-31  36%  242 aa  GTCR_ANEMI RecName: Full=Response regulator gtcR;
    1::236     8e-31  34%  240 aa  CHVI_RHIME RecName: Full=Transcriptional regulatory protein chvI;
    1::225     1e-30  32%  228 aa  SAER_STAAW RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAS RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAR RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAN RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAM RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAE RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAC RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAAB RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAA8 RecName: Full=Response regulator saeR;AltName:
    1::225     1e-30  32%  228 aa  SAER_STAA3 RecName: Full=Response regulator saeR;AltName:
    4::217     1e-30  36%  220 aa  VANR_ENTFA RecName: Full=Regulatory protein vanRB;
    3::225     1e-30  34%  229 aa  PHOB_SHIDY RecName: Full=Phosphate regulon transcriptional
    3::225     1e-30  34%  229 aa  PHOB_ECOLI RecName: Full=Phosphate regulon transcriptional
    3::225     1e-30  34%  229 aa  PHOB_ECO57 RecName: Full=Phosphate regulon transcriptional
    4::224     1e-30  31%  231 aa  MPRA_MYCVP RecName: Full=Response regulator mprA;AltName:
    1::220     2e-30  38%  220 aa  SPAR_BACSU RecName: Full=Transcriptional regulatory protein
    1::221     2e-30  33%  224 aa  HSSR_STAES RecName: Full=Heme response regulator hssR;
    1::219     3e-30  33%  224 aa  HSSR_STAHJ RecName: Full=Heme response regulator hssR;
    2::221     4e-30  33%  228 aa  MPRA_MYCLE RecName: Full=Response regulator mprA;AltName:
    3::225     7e-30  33%  229 aa  PHOB_SHIFL RecName: Full=Phosphate regulon transcriptional
    1::237     7e-30  34%  241 aa  CHVI_RHISN RecName: Full=Transcriptional regulatory protein chvI;
    1::221     1e-29  31%  224 aa  HSSR_STAS1 RecName: Full=Heme response regulator hssR;
    6::224     1e-29  33%  229 aa  CREB_ECOLI RecName: Full=Transcriptional regulatory protein creB;
    1::221     2e-29  32%  224 aa  HSSR_STAAB RecName: Full=Heme response regulator hssR;
    7::233     3e-29  32%  234 aa  CSEB_STRCO RecName: Full=Transcriptional regulatory protein cseB;
    1::221     4e-29  32%  224 aa  HSSR_STAAW RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAAT RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAAS RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAAN RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAAM RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAA9 RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAA8 RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAA3 RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAA2 RecName: Full=Heme response regulator hssR;
    1::221     4e-29  32%  224 aa  HSSR_STAA1 RecName: Full=Heme response regulator hssR;
    4::225     5e-29  34%  229 aa  PHOB_PSEAE RecName: Full=Phosphate regulon transcriptional
    1::221     5e-29  32%  224 aa  HSSR_STAAE RecName: Full=Heme response regulator hssR;
    1::221     5e-29  32%  224 aa  HSSR_STAAC RecName: Full=Heme response regulator hssR;
    1::221     6e-29  31%  224 aa  HSSR_STAAR RecName: Full=Heme response regulator hssR;
    1::218     8e-29  33%  224 aa  CIAR_STRR6 RecName: Full=Transcriptional regulatory protein ciaR;
    1::218     8e-29  33%  224 aa  CIAR_STRPN RecName: Full=Transcriptional regulatory protein ciaR;
    2::221     1e-28  32%  224 aa  DLTR_STRA5 RecName: Full=Transcriptional regulatory protein dltR;
    2::221     1e-28  32%  224 aa  DLTR_STRA3 RecName: Full=Transcriptional regulatory protein dltR;
    1::211     1e-28  34%  214 aa  ARLR_STAAN RecName: Full=Response regulator arlR;
    1::237     2e-28  33%  241 aa  CHVI_RHIRD RecName: Full=Transcriptional regulatory protein chvI;
    2::224     1e-27  33%  228 aa  SILR_SALTY RecName: Full=Probable transcriptional regulatory
   30::228     3e-27  34%  233 aa  PRRA_MYCTU RecName: Full=Transcriptional regulatory protein prrA;
   30::228     3e-27  34%  233 aa  PRRA_MYCBO RecName: Full=Transcriptional regulatory protein prrA;
   30::228     4e-27  34%  233 aa  PRRA_MYCLE RecName: Full=Transcriptional regulatory protein prrA;
    2::227     6e-27  30%  651 aa  RCAC_FREDI RecName: Full=Protein rcaC;
    6::232     2e-26  32%  238 aa  ARCA_SHIFL RecName: Full=Aerobic respiration control protein arcA;
    6::232     2e-26  32%  238 aa  ARCA_ECOLI RecName: Full=Aerobic respiration control protein
    6::232     2e-26  32%  238 aa  ARCA_ECOL6 RecName: Full=Aerobic respiration control protein arcA;
    6::232     2e-26  32%  238 aa  ARCA_ECO57 RecName: Full=Aerobic respiration control protein arcA;
    1::228     2e-26  30%  237 aa  YVCP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   12::235     3e-26  30%  240 aa  BAER_ECOLI RecName: Full=Transcriptional regulatory protein baeR;
   12::235     3e-26  30%  240 aa  BAER_ECOL6 RecName: Full=Transcriptional regulatory protein baeR;
    2::216     1e-25  34%  217 aa  CUTR_STRLI RecName: Full=Transcriptional regulatory protein
    2::216     1e-25  34%  217 aa  CUTR_STRCO RecName: Full=Transcriptional regulatory protein
    1::226     1e-25  30%  229 aa  SAER_STAES RecName: Full=Response regulator saeR;
    1::226     1e-25  30%  229 aa  SAER_STAEQ RecName: Full=Response regulator saeR;
    9::235     1e-25  32%  236 aa  RPRY_BACFR RecName: Full=Transcriptional regulatory protein rprY;
    2::214     1e-24  33%  219 aa  QSEB_ECOLI RecName: Full=Transcriptional regulatory protein qseB;
    5::231     2e-24  29%  236 aa  ARCA_HAEIN RecName: Full=Aerobic respiration control protein arcA
    2::219     3e-24  32%  232 aa  CTRA_OCHA4 RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUSU RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUSI RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUO2 RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUME RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUC2 RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUAB RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUA2 RecName: Full=Cell cycle response regulator ctrA;
    2::219     3e-24  32%  232 aa  CTRA_BRUA1 RecName: Full=Cell cycle response regulator ctrA;
    1::223     6e-24  31%  225 aa  KDPE_ECOLI RecName: Full=KDP operon transcriptional regulatory
    2::219     6e-24  32%  231 aa  CTRA_CAUCR RecName: Full=Cell cycle transcriptional regulator
    2::219     6e-24  32%  231 aa  CTRA_CAUCN RecName: Full=Cell cycle transcriptional regulator
    2::214     8e-24  33%  219 aa  QSEB_ECO57 RecName: Full=Transcriptional regulatory protein qseB;
    9::237     1e-23  31%  237 aa  PETR_RHOCA RecName: Full=Protein petR;
    5::216     2e-23  35%  223 aa  YBDJ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::230     4e-23  29%  241 aa  VIRG_AGRRH RecName: Full=Regulatory protein virG;
   13::242     6e-23  29%  253 aa  VIRG_AGRT5 RecName: Full=Regulatory protein virG;
    5::223     6e-23  29%  230 aa  TORR_ECOLI RecName: Full=TorCAD operon transcriptional regulatory
    5::223     6e-23  29%  230 aa  TORR_ECO57 RecName: Full=TorCAD operon transcriptional regulatory
    1::222     8e-23  30%  224 aa  PHOP_SALCH RecName: Full=Virulence transcriptional regulatory
    1::228     2e-22  29%  229 aa  YXDJ_BACSU RecName: Full=Transcriptional regulatory protein yxdJ;
    2::220     3e-22  29%  224 aa  GRAR_STAAW RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAT RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAS RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAR RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAN RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAM RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAE RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAC RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAAB RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAA9 RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAA8 RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAA3 RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAA2 RecName: Full=Response regulator protein graR;AltName:
    2::220     3e-22  29%  224 aa  GRAR_STAA1 RecName: Full=Response regulator protein graR;AltName:
    1::178     7e-22  35%  227 aa  CPXR_HAEIN RecName: Full=Transcriptional regulatory protein cpxR
    2::220     9e-22  28%  224 aa  GRAR_STAES RecName: Full=Response regulator protein graR;AltName:
    2::220     9e-22  28%  224 aa  GRAR_STAEQ RecName: Full=Response regulator protein graR;AltName:
    2::214     2e-21  29%  221 aa  QSEB_HAEIN RecName: Full=Transcriptional regulatory protein qseB;
    3::223     2e-21  30%  231 aa  PHOB_HAEIN RecName: Full=Phosphate regulon transcriptional
    1::228     3e-21  30%  231 aa  BCER_BACSU RecName: Full=Sensory transduction protein bceR;
    1::226     4e-21  31%  232 aa  CPXR_SHIFL RecName: Full=Transcriptional regulatory protein cpxR;
    1::226     4e-21  31%  232 aa  CPXR_ECOLI RecName: Full=Transcriptional regulatory protein cpxR;
    1::226     4e-21  31%  232 aa  CPXR_ECO57 RecName: Full=Transcriptional regulatory protein cpxR;
    1::222     6e-21  29%  224 aa  PHOP_SALTI RecName: Full=Virulence transcriptional regulatory
    1::222     1e-20  29%  224 aa  PHOP_SALTY RecName: Full=Virulence transcriptional regulatory
    1::222     1e-20  29%  224 aa  PHOP_SALPA RecName: Full=Virulence transcriptional regulatory
    2::220     1e-20  27%  224 aa  GRAR_STAHJ RecName: Full=Response regulator protein graR;AltName:
    2::221     2e-20  28%  223 aa  PHOP_SHIFL RecName: Full=Virulence transcriptional regulatory
    2::221     2e-20  28%  223 aa  PHOP_ECOLI RecName: Full=Transcriptional regulatory protein phoP;
    2::221     2e-20  28%  223 aa  PHOP_ECOL6 RecName: Full=Transcriptional regulatory protein phoP;
   45::221     2e-20  29%  225 aa  CSSR_BACSU RecName: Full=Transcriptional regulatory protein cssR;
    3::220     4e-20  28%  224 aa  GRAR_STAS1 RecName: Full=Response regulator protein graR;AltName:
    1::239     9e-20  26%  239 aa  RSTA_ECOLI RecName: Full=Transcriptional regulatory protein rstA;
    2::221     1e-19  27%  223 aa  PHOP_ECO57 RecName: Full=Transcriptional regulatory protein phoP;
    2::218     2e-19  29%  224 aa  TCTD_SALTY RecName: Full=Transcriptional regulatory protein tctD;
    2::214     2e-19  30%  219 aa  QSEB_SALTY RecName: Full=Transcriptional regulatory protein qseB;
    2::214     2e-19  30%  219 aa  QSEB_SALTI RecName: Full=Transcriptional regulatory protein qseB;
   79::297     7e-19  29%  305 aa  PFER_PSEAE RecName: Full=Transcriptional activator protein pfeR;
    1::227     7e-19  27%  231 aa  BCER_BACHD RecName: Full=Sensory transduction protein bceR;
    9::125     1e-18  37%  135 aa  PILG_PSEAE RecName: Full=Protein pilG;
   33::219     1e-18  30%  267 aa  GLNR_STRCO RecName: Full=Transcriptional regulatory protein glnR;
    4::227     8e-18  26%  229 aa  NISR_LACLA RecName: Full=Nisin biosynthesis regulatory protein
   27::256     1e-17  30%  267 aa  VIRG_AGRT9 RecName: Full=Regulatory protein virG;
    2::214     2e-17  29%  222 aa  BASR_ECOLI RecName: Full=Transcriptional regulatory protein basR;
   27::256     3e-17  30%  267 aa  VIRG_RHIRD RecName: Full=Regulatory protein virG;
    2::214     3e-17  30%  222 aa  BASR_SALTY RecName: Full=Transcriptional regulatory protein basR;
    4::121     2e-16  34%  454 aa  PLED_CAUCR RecName: Full=Response regulator pleD;AltName:
    1::119     8e-16  36%  121 aa  PILH_PSEAE RecName: Full=Protein pilH;
    2::219     1e-14  25%  226 aa  Y4XI_RHISN RecName: Full=Probable transcriptional regulatory
    4::125     3e-14  30%  461 aa  ATOC_ECOLI RecName: Full=Acetoacetate metabolism regulatory protein
    2::214     7e-14  27%  222 aa  PMRA_PECCC RecName: Full=Transcriptional regulatory protein pmrA;
    6::116     2e-13  32%  469 aa  NTRC_ECOLI RecName: Full=Nitrogen regulation protein NR(I);
    6::116     2e-13  32%  469 aa  NTRC_ECO57 RecName: Full=Nitrogen regulation protein NR(I);
  827::926     3e-13  35%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  827::926     3e-13  35%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
    6::116     5e-13  31%  469 aa  NTRC_SALTY RecName: Full=Nitrogen regulation protein NR(I);
  660::761     5e-13  35%  777 aa  FRZE_MYXXA RecName: Full=Gliding motility regulatory protein;      
    4::122     8e-13  33%  222 aa  YCF29_PORYE RecName: Full=Probable transcriptional regulator ycf29;
    8::109     8e-13  33%  337 aa  HNR_SHIFL RecName: Full=Protein hnr;
    8::109     8e-13  33%  337 aa  HNR_ECOLI RecName: Full=Protein hnr;
    8::109     8e-13  33%  337 aa  HNR_ECO57 RecName: Full=Protein hnr;
  827::926     1e-12  35%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
   14::131     2e-12  37%  205 aa  PDTAR_MYCTU RecName: Full=Probable transcriptional regulatory
   67::219     3e-12  33%  219 aa  RSSB_SERMA RecName: Full=Swarming motility regulation protein rssB;
    6::116     3e-12  32%  473 aa  NTRC_PROVU RecName: Full=Nitrogen regulation protein NR(I);
    8::141     3e-12  30%  469 aa  NTRC_KLEPN RecName: Full=Nitrogen assimilation regulatory protein;
    4::119     5e-12  34%  120 aa  CHEY_BACSU RecName: Full=Chemotaxis protein cheY homolog;
    8::131     7e-12  27%  443 aa  ZRAR_KLEOX RecName: Full=Transcriptional regulatory protein zraR;
 1731::1848    7e-12  34% 2062 aa  DHKJ_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    7::122     9e-12  34%  226 aa  DCTR_BACSU RecName: Full=Probable C4-dicarboxylate response
   10::140     9e-12  30%  448 aa  ALGB_PSEPK RecName: Full=Alginate biosynthesis transcriptional
   29::127     1e-11  38%  444 aa  YFHA_ECOLI RecName: Full=Uncharacterized protein yfhA;AltName:
   29::127     1e-11  38%  444 aa  YFHA_ECO57 RecName: Full=Uncharacterized protein yfhA;
    4::119     1e-11  29%  124 aa  SP0F_BACSU RecName: Full=Sporulation initiation phosphotransferase
   10::140     2e-11  28%  448 aa  ALGB_PSESM RecName: Full=Alginate biosynthesis transcriptional
   32::112     3e-11  41%  350 aa  CHEB6_ANADE RecName: Full=Chemotaxis response regulator
    9::123     3e-11  32%  131 aa  YSO1_PLEBO RecName: Full=Uncharacterized 14.6 kDa protein in sodA1
    9::117     3e-11  34%  216 aa  NARL_SHIFL RecName: Full=Nitrate/nitrite response regulator protein
    9::117     3e-11  34%  216 aa  NARL_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
    9::117     3e-11  34%  216 aa  NARL_ECOL6 RecName: Full=Nitrate/nitrite response regulator protein
    9::117     3e-11  34%  216 aa  NARL_ECO57 RecName: Full=Nitrate/nitrite response regulator protein
    8::142     4e-11  31%  441 aa  ZRAR_SALTY RecName: Full=Transcriptional regulatory protein zraR;
    8::142     4e-11  31%  441 aa  ZRAR_SALTI RecName: Full=Transcriptional regulatory protein zraR;
 1841::1968    6e-11  33% 1969 aa  DHKB_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    8::122     6e-11  32%  228 aa  DCTR_BACME RecName: Full=Probable C4-dicarboxylate response
    4::118     7e-11  30%  122 aa  SP0F_BACTK RecName: Full=Sporulation initiation phosphotransferase
    5::118     1e-10  34%  210 aa  SP0A_BACCI RecName: Full=Stage 0 sporulation protein A;Flags:
    5::114     2e-10  29%  454 aa  NTRX_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
    1::115     2e-10  32%  119 aa  CHEY_LISMO RecName: Full=Chemotaxis protein cheY;
    1::115     2e-10  32%  119 aa  CHEY_LISIN RecName: Full=Chemotaxis protein cheY;
  572::682     2e-10  32% 1546 aa  DHKD_DICDI RecName: Full=Hybrid signal transduction histidine
    7::128     2e-10  33%  352 aa  CYAB_STIAU RecName: Full=Adenylate cyclase 2;       
   10::144     2e-10  27%  449 aa  ALGB_PSEAE RecName: Full=Alginate biosynthesis transcriptional
   13::120     3e-10  25%  184 aa  REGA_RHOS4 RecName: Full=Photosynthetic apparatus regulatory
    8::174     3e-10  29%  215 aa  NARP_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
    3::112     4e-10  29%  120 aa  CHEY_THEMA RecName: Full=Chemotaxis protein cheY;
    6::119     5e-10  30%  208 aa  NARP_HAEIN RecName: Full=Nitrate/nitrite response regulator protein
 3305::3416    5e-10  34% 3432 aa  DHKG_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  568::684     5e-10  32%  686 aa  CQSS_VIBCH RecName: Full=CAI-1 autoinducer sensor
    3::195     5e-10  33%  248 aa  ALGR_PSEAE RecName: Full=Positive alginate biosynthesis regulatory
    1::110     6e-10  34%  251 aa  Y2406_STAEQ RecName: Full=Uncharacterized response regulatory
    7::136     8e-10  26%  205 aa  FIXJ_BRAJA RecName: Full=Transcriptional regulatory protein fixJ;
    5::119     1e-09  35%  264 aa  SP0A_BACAN RecName: Full=Stage 0 sporulation protein A;
    5::106     1e-09  38%  360 aa  CHEB2_GEOMG RecName: Full=Chemotaxis response regulator
    1::110     1e-09  35%  251 aa  Y165_STAES RecName: Full=Uncharacterized response regulatory
    8::113     1e-09  34%  273 aa  SP0A_CLOPA RecName: Full=Stage 0 sporulation protein A homolog;
    6::115     1e-09  28%  475 aa  NTRXL_RICPR RecName: Full=Putative response regulator ntrX-like;
    8::113     2e-09  33%  281 aa  SP0A_CLOAB RecName: Full=Stage 0 sporulation protein A homolog;
    5::119     2e-09  35%  264 aa  SP0A_BACTU RecName: Full=Stage 0 sporulation protein A;
    5::119     2e-09  35%  264 aa  SP0A_BACCR RecName: Full=Stage 0 sporulation protein A;
    6::115     2e-09  28%  475 aa  NTRXL_RICTY RecName: Full=Putative response regulator ntrX-like;
    1::118     2e-09  29%  207 aa  TRPO_PSEAE RecName: Full=Putative transcriptional regulator;
    6::115     2e-09  28%  475 aa  NTRXL_RICFE RecName: Full=Putative response regulator ntrX-like;
  658::803     2e-09  32%  907 aa  GACS_PSESY RecName: Full=Sensor protein gacS;         EC=2.7.13.3;
    1::110     3e-09  35%  252 aa  Y217_STAA3 RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y214_STAAR RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y201_STAAC RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y198_STAAW RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y198_STAAS RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y184_STAA8 RecName: Full=Uncharacterized response regulatory
    1::110     3e-09  35%  252 aa  Y161_STAAB RecName: Full=Uncharacterized response regulatory
    6::115     3e-09  27%  474 aa  NTRXL_RICCN RecName: Full=Putative response regulator ntrX-like;
  735::852     3e-09  29%  857 aa  LUXQ_VIBVY RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  735::852     3e-09  29%  857 aa  LUXQ_VIBVU RecName: Full=Autoinducer 2 sensor kinase/phosphatase
   10::116     4e-09  34%  274 aa  SP0A_CLODI RecName: Full=Stage 0 sporulation protein A homolog;
    2::123     4e-09  32%  124 aa  CHEY_PSEAE RecName: Full=Chemotaxis protein cheY;
    5::106     4e-09  34%  371 aa  CHEB3_GEOSL RecName: Full=Chemotaxis response regulator
  670::777     4e-09  28%  918 aa  BARA_SHIFL RecName: Full=Signal transduction histidine-protein
  670::777     4e-09  28%  918 aa  BARA_ECOLI RecName: Full=Signal transduction histidine-protein
  670::777     4e-09  28%  918 aa  BARA_ECOL6 RecName: Full=Signal transduction histidine-protein
  670::777     4e-09  28%  918 aa  BARA_ECO57 RecName: Full=Signal transduction histidine-protein
    1::110     5e-09  36%  252 aa  Y223_STAAM RecName: Full=Uncharacterized response regulatory
    1::110     5e-09  36%  252 aa  Y215_STAAN RecName: Full=Uncharacterized response regulatory
  263::378     5e-09  26%  379 aa  PATA_ANASP RecName: Full=Protein patA;AltName: Full=PAT-1;
  961::1070    5e-09  30% 1197 aa  EVGS_ECOLI RecName: Full=Sensor protein evgS;       
    8::111     5e-09  31%  230 aa  DCTR_BACHD RecName: Full=Probable C4-dicarboxylate response
    1::95      7e-09  32%  350 aa  CHEB2_METHJ RecName: Full=Chemotaxis response regulator
   26::144     1e-08  30%  144 aa  CHEY_TREPA RecName: Full=Chemotaxis protein cheY;
   12::120     1e-08  29%  382 aa  ARR14_ARATH RecName: Full=Two-component response regulator ARR14;
  961::1070    2e-08  29% 1197 aa  EVGS_ECO57 RecName: Full=Sensor protein evgS;       
    7::142     2e-08  32%  363 aa  CHEB2_ACIBL RecName: Full=Chemotaxis response regulator
   29::121     2e-08  30%  441 aa  ZRAR_ECOLI RecName: Full=Transcriptional regulatory protein zraR;
  379::506     2e-08  26%  622 aa  SKN7_YEAST RecName: Full=Transcription factor SKN7;AltName:
   13::120     2e-08  23%  184 aa  REGA_RHOCA RecName: Full=Photosynthetic apparatus regulatory
   13::105     2e-08  37%  553 aa  HILA_SALTI RecName: Full=Transcriptional regulator hilA;       
    7::120     2e-08  32%  448 aa  DCTD_RHILE RecName: Full=C4-dicarboxylate transport transcriptional
    5::109     2e-08  33%  372 aa  CHEB_TREDE RecName: Full=Chemotaxis response regulator
    4::108     2e-08  36%  352 aa  CHEB1_SYNWW RecName: Full=Chemotaxis response regulator
    1::82      2e-08  42%  350 aa  CHEB1_SYNAS RecName: Full=Chemotaxis response regulator
   51::177     2e-08  26%  558 aa  APRR5_ARATH RecName: Full=Two-component response regulator-like
    5::132     3e-08  30%  267 aa  SP0A_BACSU RecName: Full=Stage 0 sporulation protein A;AltName:
   13::105     3e-08  37%  553 aa  HILA_SALTY RecName: Full=Transcriptional regulator hilA;       
   13::105     3e-08  37%  553 aa  HILA_SALPA RecName: Full=Transcriptional regulator hilA;       
  563::673     3e-08  26%  681 aa  CQSS_VIBHB RecName: Full=CAI-1 autoinducer sensor
    2::120     3e-08  30%  124 aa  CHEY_HELPY RecName: Full=Chemotaxis protein cheY homolog;
    2::120     3e-08  30%  124 aa  CHEY_HELPJ RecName: Full=Chemotaxis protein cheY homolog;
    9::124     3e-08  34%  403 aa  CHEB_TREPA RecName: Full=Chemotaxis response regulator
    5::109     3e-08  35%  366 aa  CHEB_NOCSJ RecName: Full=Chemotaxis response regulator
    7::128     3e-08  32%  363 aa  CHEB3_RHOPA RecName: Full=Chemotaxis response regulator
    7::125     3e-08  35%  363 aa  CHEB3_BRAJA RecName: Full=Chemotaxis response regulator
   29::121     3e-08  30%  441 aa  ZRAR_ECO57 RecName: Full=Transcriptional regulatory protein zraR;
   32::117     3e-08  34%  214 aa  YHCZ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::161     3e-08  27%  213 aa  YDFI_BACSU RecName: Full=Transcriptional regulatory protein ydfI;
    8::123     3e-08  30%  129 aa  CHEY_RHIEC RecName: Full=Probable chemotaxis protein cheY;
    4::133     4e-08  28%  259 aa  SP0A_BACST RecName: Full=Stage 0 sporulation protein A;
 1550::1666    4e-08  29% 1736 aa  DHKI_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    2::127     4e-08  30%  349 aa  CHEB_ARCFU RecName: Full=Chemotaxis response regulator
    9::135     6e-08  31%  261 aa  Y0G0_VIBCH RecName: Full=Uncharacterized response regulatory
    6::112     6e-08  29%  480 aa  NTRC_BRASR RecName: Full=Nitrogen assimilation regulatory protein;
 1517::1619    6e-08  32% 1671 aa  DOKA_DICDI RecName: Full=Hybrid signal transduction protein dokA;
    7::107     6e-08  28%  460 aa  DCTD_RHIME RecName: Full=C4-dicarboxylate transport transcriptional
    6::132     6e-08  28%  346 aa  CHEB_BACHD RecName: Full=Chemotaxis response regulator
   30::139     8e-08  33%  378 aa  RPFG_XANC8 RecName: Full=Response regulator rpfG;
    5::119     1e-07  31%  212 aa  SP0A_BACME RecName: Full=Stage 0 sporulation protein A;Flags:
   37::113     1e-07  37%  273 aa  SP0A_CLOB8 RecName: Full=Stage 0 sporulation protein A homolog;
    6::112     1e-07  29%  480 aa  NTRC_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
    7::111     1e-07  29%  129 aa  CHEY_YERPE RecName: Full=Chemotaxis protein cheY;
    7::111     1e-07  29%  129 aa  CHEY_YEREN RecName: Full=Chemotaxis protein cheY;
    9::88      1e-07  38%  355 aa  CHEB_NATPD RecName: Full=Chemotaxis response regulator
    5::125     2e-07  26%  209 aa  YCF29_PORPU RecName: Full=Probable transcriptional regulator ycf29;
    7::113     2e-07  27%  255 aa  Y8J3_VIBVU RecName: Full=Uncharacterized response regulatory
    4::134     2e-07  28%  445 aa  PILR_PSEAE RecName: Full=Type 4 fimbriae expression regulatory
    3::120     2e-07  24%  123 aa  DIVK_OCHA4 RecName: Full=Polar-differentiation response regulator
 1076::1196    2e-07  33% 1213 aa  DHKK_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    2::117     2e-07  28%  130 aa  CHEY_CAMJJ RecName: Full=Chemotaxis protein cheY homolog;
    2::117     2e-07  28%  130 aa  CHEY_CAMJE RecName: Full=Chemotaxis protein cheY homolog;
    2::117     2e-07  28%  130 aa  CHEY_CAMJ8 RecName: Full=Chemotaxis protein cheY homolog;
    1::81      2e-07  35%  347 aa  CHEB_HALSA RecName: Full=Chemotaxis response regulator
    3::108     2e-07  32%  349 aa  CHEB3_HAHCH RecName: Full=Chemotaxis response regulator
    1::82      2e-07  38%  367 aa  CHEB2_DESVH RecName: Full=Chemotaxis response regulator
    1::82      2e-07  39%  369 aa  CHEB1_DESDG RecName: Full=Chemotaxis response regulator
   23::124     2e-07  26%  194 aa  ACTR_RHIME RecName: Full=Acid tolerance regulatory protein actR;
  139::256     2e-07  24%  692 aa  YPH5_THIVI RecName: Full=Uncharacterized 76.5 kDa protein in phbC
  369::470     2e-07  26%  539 aa  PRR1_SCHPO RecName: Full=Transcription factor prr1;AltName:
    3::120     2e-07  25%  123 aa  DIVK_BRUSU RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUSI RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUO2 RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUME RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUC2 RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUAB RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUA2 RecName: Full=Polar-differentiation response regulator
    3::120     2e-07  25%  123 aa  DIVK_BRUA1 RecName: Full=Polar-differentiation response regulator
    6::108     2e-07  37%  369 aa  CHEB_HALMA RecName: Full=Chemotaxis response regulator
    7::122     2e-07  30%  357 aa  CHEB1_LEPIN RecName: Full=Chemotaxis response regulator
    7::122     2e-07  30%  357 aa  CHEB1_LEPIC RecName: Full=Chemotaxis response regulator
   18::125     2e-07  32%  596 aa  ARR12_ARATH RecName: Full=Two-component response regulator ARR12;
   12::129     2e-07  30%  521 aa  ARR11_ARATH RecName: Full=Two-component response regulator
   23::124     2e-07  26%  194 aa  ACTR_SINMW RecName: Full=Acid tolerance regulatory protein actR;
    6::112     3e-07  28%  484 aa  NTRC_RHIME RecName: Full=Nitrogen assimilation regulatory protein;
    9::124     3e-07  23%  211 aa  FIXJ_AZOC5 RecName: Full=Transcriptional regulatory protein fixJ;
    7::113     3e-07  33%  353 aa  CHEB4_MYXXD RecName: Full=Chemotaxis response regulator
    1::107     3e-07  36%  342 aa  CHEB1_METHJ RecName: Full=Chemotaxis response regulator
   18::125     3e-07  32%  552 aa  ARR10_ARATH RecName: Full=Two-component response regulator
   55::124     4e-07  38%  210 aa  YCF29_CYAPA RecName: Full=Probable transcriptional regulator ycf29;
    8::116     4e-07  25%  204 aa  FIXJ_RHIME RecName: Full=Transcriptional regulatory protein fixJ;
    6::129     4e-07  23%  230 aa  CITT_BACHD RecName: Full=Transcriptional regulatory protein citT;
  930::1040    5e-07  29% 1065 aa  TCSB_EMENI RecName: Full=Two-component system protein B;       
   51::118     5e-07  32%  210 aa  FIMZ_ECOLI RecName: Full=Fimbriae Z protein;
   51::118     5e-07  32%  210 aa  FIMZ_ECO57 RecName: Full=Fimbriae Z protein;
    7::111     5e-07  29%  129 aa  CHEY_SHIFL RecName: Full=Chemotaxis protein cheY;
    7::111     5e-07  29%  129 aa  CHEY_ECOLI RecName: Full=Chemotaxis protein cheY;
    7::111     5e-07  29%  129 aa  CHEY_ECO57 RecName: Full=Chemotaxis protein cheY;
    6::132     5e-07  28%  363 aa  CHEB2_RHORT RecName: Full=Chemotaxis response regulator
    3::114     5e-07  27% 1395 aa  AGLZ_MYXXD RecName: Full=Adventurous-gliding motility protein Z;
  731::848     6e-07  27%  857 aa  LUXQ_VIBCH RecName: Full=Autoinducer 2 sensor kinase/phosphatase
    7::111     6e-07  29%  129 aa  CHEY_ECOL6 RecName: Full=Chemotaxis protein cheY;
   35::113     8e-07  28%  263 aa  Y4021_VIBPA RecName: Full=Uncharacterized response regulatory
    5::111     8e-07  26%  256 aa  SP0A_MOOTA RecName: Full=Stage 0 sporulation protein A homolog;
   14::124     8e-07  35%  381 aa  CHEB1_MAGSA RecName: Full=Chemotaxis response regulator
  562::673     1e-06  28%  682 aa  TCSA_EMENI RecName: Full=Two-component system protein A;       
   33::142     1e-06  31%  263 aa  SP0A_BACSH RecName: Full=Stage 0 sporulation protein A;
   44::154     1e-06  27%  623 aa  PRR95_ORYSJ RecName: Full=Two-component response regulator-like
   63::173     1e-06  28%  742 aa  PRR37_ORYSJ RecName: Full=Two-component response regulator-like
   63::173     1e-06  28%  742 aa  PRR37_ORYSI RecName: Full=Two-component response regulator-like
   22::137     1e-06  23%  227 aa  NODW_BRAJA RecName: Full=Nodulation protein W;
 2308::2371    1e-06  42% 2388 aa  DHKM_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   10::123     1e-06  27%  362 aa  CHEB_SYMTH RecName: Full=Chemotaxis response regulator
    9::135     1e-06  30%  368 aa  CHEB_PYRHO RecName: Full=Chemotaxis response regulator
    1::133     1e-06  30%  352 aa  CHEB_OCEIH RecName: Full=Chemotaxis response regulator
    1::82      1e-06  30%  357 aa  CHEB_LAWIP RecName: Full=Chemotaxis response regulator
    4::108     1e-06  29%  390 aa  CHEB_ALHEH RecName: Full=Chemotaxis response regulator
   32::81      1e-06  42%  342 aa  CHEB2_BURPS RecName: Full=Chemotaxis response regulator
   32::81      1e-06  42%  342 aa  CHEB2_BURP1 RecName: Full=Chemotaxis response regulator
   32::81      1e-06  42%  342 aa  CHEB2_BURMA RecName: Full=Chemotaxis response regulator
    5::114     1e-06  29%  512 aa  CADC_ECOLI RecName: Full=Transcriptional activator cadC;
    5::129     1e-06  29%  345 aa  CHEB_CLOAB RecName: Full=Chemotaxis response regulator
    4::84      1e-06  26%  209 aa  BVGA_BORPE RecName: Full=Virulence factors putative positive
    4::84      1e-06  26%  209 aa  BVGA_BORPA RecName: Full=Virulence factors putative positive
    4::84      1e-06  26%  209 aa  BVGA_BORBR RecName: Full=Virulence factors putative positive
    5::146     2e-06  28%  212 aa  SP0A_BREPA RecName: Full=Stage 0 sporulation protein A;Flags:
  723::801     2e-06  29%  849 aa  LUXN_VIBHB RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  723::801     2e-06  29%  849 aa  LUXN_VIBHA RecName: Full=Autoinducer 1 sensor kinase/phosphatase
    7::111     2e-06  29%  129 aa  CHEY_ENTCL RecName: Full=Chemotaxis protein cheY;
    4::109     2e-06  29%  398 aa  CHEB_SHEFN RecName: Full=Chemotaxis response regulator
    6::134     2e-06  24%  481 aa  NTRC_AZOBR RecName: Full=Nitrogen assimilation regulatory protein;
  175::288     2e-06  32%  303 aa  CHEV_BACSU RecName: Full=Chemotaxis protein cheV;
   39::135     2e-06  36%  368 aa  CHEB_PYRAB RecName: Full=Chemotaxis response regulator
   32::81      2e-06  40%  342 aa  CHEB4_BURTA RecName: Full=Chemotaxis response regulator
    4::109     2e-06  34%  374 aa  CHEB1_PSEPU RecName: Full=Chemotaxis response regulator
    4::109     2e-06  34%  370 aa  CHEB1_PSEPK RecName: Full=Chemotaxis response regulator
   65::125     2e-06  46%  635 aa  ARR18_ARATH RecName: Full=Two-component response regulator ARR18;
    5::111     3e-06  32%  457 aa  NTRC_RHOCA RecName: Full=Nitrogen regulation protein ntrC;
  928::1034    3e-06  31% 1109 aa  DHKF_DICDI RecName: Full=Hybrid signal transduction histidine kinase
 2025::2094    3e-06  32% 2150 aa  DHKA_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   35::109     3e-06  39%  352 aa  CHEB_TRIEI RecName: Full=Chemotaxis response regulator
    1::106     3e-06  30%  353 aa  CHEB3_SYNWW RecName: Full=Chemotaxis response regulator
    4::109     3e-06  33%  368 aa  CHEB1_PSEAE RecName: Full=Chemotaxis response regulator
    8::110     3e-06  33%  358 aa  CHEB1_PSE14 RecName: Full=Chemotaxis response regulator
    7::113     4e-06  29%  197 aa  DCTR_RHOCA RecName: Full=C4-dicarboxylate transport transcriptional
    7::111     4e-06  27%  129 aa  CHEY_SALTY RecName: Full=Chemotaxis protein cheY;
    7::111     4e-06  27%  129 aa  CHEY_SALTI RecName: Full=Chemotaxis protein cheY;
   32::95      4e-06  40%  354 aa  CHEB_NOSP7 RecName: Full=Chemotaxis response regulator
    1::106     4e-06  33%  356 aa  CHEB3_SHEON RecName: Full=Chemotaxis response regulator
   50::125     4e-06  43%  364 aa  CHEB3_RHOPB RecName: Full=Chemotaxis response regulator
    4::107     4e-06  30%  356 aa  CHEB2_METAC RecName: Full=Chemotaxis response regulator
    8::110     4e-06  33%  358 aa  CHEB1_PSEU2 RecName: Full=Chemotaxis response regulator
    4::63      4e-06  33%  349 aa  CHEB1_ANADE RecName: Full=Chemotaxis response regulator
   13::131     5e-06  22%  135 aa  Y2151_LEPIN RecName: Full=Uncharacterized protein LA_2151;AltName:
   13::131     5e-06  22%  135 aa  Y1769_LEPIC RecName: Full=Uncharacterized protein LIC_11769;
    2::126     5e-06  26%  246 aa  LYTR_STRA5 RecName: Full=Sensory transduction protein lytR;
    2::126     5e-06  26%  246 aa  LYTR_STRA3 RecName: Full=Sensory transduction protein lytR;
   22::168     5e-06  28%  425 aa  CHEB_NITWN RecName: Full=Chemotaxis response regulator
    1::112     5e-06  27%  351 aa  CHEB_METBU RecName: Full=Chemotaxis response regulator
   35::120     5e-06  37%  401 aa  CHEB_MARMM RecName: Full=Chemotaxis response regulator
   10::74      5e-06  35%  357 aa  CHEB5_GEOMG RecName: Full=Chemotaxis response regulator
    4::109     5e-06  33%  378 aa  CHEB2_PSEPF RecName: Full=Chemotaxis response regulator
   29::145     5e-06  35%  664 aa  ARR2_ARATH RecName: Full=Two-component response regulator
   24::126     5e-06  29%  142 aa  ARR22_ARATH RecName: Full=Two-component response regulator ARR22;
   38::154     5e-06  35%  690 aa  ARR1_ARATH RecName: Full=Two-component response regulator ARR1;
   32::124     7e-06  29%  218 aa  YXJL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::180     7e-06  22%  220 aa  YFIK_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::108     7e-06  24%  238 aa  Y3287_YERPE RecName: Full=Uncharacterized response regulatory
   52::123     7e-06  31%  415 aa  PGTA_SALTY RecName: Full=Phosphoglycerate transport system
    8::134     7e-06  30%  355 aa  CHEB_PYRKO RecName: Full=Chemotaxis response regulator
    1::81      7e-06  34%  370 aa  CHEB3_RHORT RecName: Full=Chemotaxis response regulator
    4::109     7e-06  33%  386 aa  CHEB3_PSEU2 RecName: Full=Chemotaxis response regulator
    8::110     7e-06  33%  358 aa  CHEB2_PSESM RecName: Full=Chemotaxis response regulator
    4::109     7e-06  33%  373 aa  CHEB2_PSEF5 RecName: Full=Chemotaxis response regulator
    4::109     7e-06  33%  387 aa  CHEB2_PSE14 RecName: Full=Chemotaxis response regulator
    4::109     7e-06  33%  390 aa  CHEB1_PSESM RecName: Full=Chemotaxis response regulator
   31::106     9e-06  33%  292 aa  TOXR_VIBPA RecName: Full=Cholera toxin homolog transcriptional
 1089::1196    9e-06  28% 1220 aa  SLN1_YEAST RecName: Full=Osmosensing histidine protein kinase SLN1;  
    1::115     9e-06  28%  214 aa  GACA_PSEU2 RecName: Full=Response regulator gacA;AltName:
 1570::1675    9e-06  31% 1709 aa  DHKL_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   31::95      9e-06  32%  355 aa  CHEB_NITMU RecName: Full=Chemotaxis response regulator
   13::92      9e-06  36%  362 aa  CHEB5_ANADE RecName: Full=Chemotaxis response regulator
    6::108     9e-06  36%  365 aa  CHEB2_RHIL3 RecName: Full=Chemotaxis response regulator
   43::118     1e-05  32%  294 aa  TOXR_VIBCH RecName: Full=Cholera toxin transcriptional activator;
   82::192     1e-05  27%  767 aa  PRR73_ORYSJ RecName: Full=Two-component response regulator-like
   82::192     1e-05  27%  767 aa  PRR73_ORYSI RecName: Full=Two-component response regulator-like
 1508::1629    1e-05  31% 1639 aa  MAK1_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
   39::120     1e-05  28%  236 aa  DEGU_BREBE RecName: Full=Transcriptional regulatory protein degU;
   32::89      1e-05  37%  339 aa  CHEB_RHILO RecName: Full=Chemotaxis response regulator
   10::124     1e-05  30%  359 aa  CHEB3_CHRVO RecName: Full=Chemotaxis response regulator
    1::82      1e-05  34%  342 aa  CHEB3_ANADE RecName: Full=Chemotaxis response regulator
    5::108     1e-05  30%  354 aa  CHEB2_CARHZ RecName: Full=Chemotaxis response regulator
    4::79      1e-05  35%  374 aa  CHEB1_SHESR RecName: Full=Chemotaxis response regulator
    4::79      1e-05  35%  372 aa  CHEB1_SHESM RecName: Full=Chemotaxis response regulator
   38::167     1e-05  24%  468 aa  APRR9_ARATH RecName: Full=Two-component response regulator-like
   18::115     2e-05  25%  478 aa  NTRXL_RICBR RecName: Full=Putative response regulator ntrX-like;
 1078::1190    2e-05  27% 1225 aa  DHKC_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    1::118     2e-05  28%  237 aa  Y693_VIBCH RecName: Full=Uncharacterized response regulatory
    1::123     2e-05  28%  242 aa  Y503_VIBVU RecName: Full=Uncharacterized response regulatory
   33::114     2e-05  30%  229 aa  DEGU_BACSU RecName: Full=Transcriptional regulatory protein
    1::108     2e-05  26%  239 aa  DCUR_ECOL6 RecName: Full=Transcriptional regulatory protein dcuR;
    1::82      2e-05  34%  351 aa  CHEB1_XANOR RecName: Full=Chemotaxis response regulator
    1::82      2e-05  34%  351 aa  CHEB1_XANOM RecName: Full=Chemotaxis response regulator
   10::81      2e-05  33%  362 aa  CHEB1_GEOSL RecName: Full=Chemotaxis response regulator
    5::148     2e-05  31%  359 aa  CHEB1_CHRVO RecName: Full=Chemotaxis response regulator
    5::121     2e-05  29%  355 aa  CHEB1_ACIBL RecName: Full=Chemotaxis response regulator
    1::106     4e-05  33%  368 aa  YESN_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  735::842     4e-05  22%  858 aa  LUXQ_VIBPA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  736::843     4e-05  23%  859 aa  LUXQ_VIBHA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
    1::115     4e-05  29%  214 aa  GACA_PSEAE RecName: Full=Response regulator gacA;AltName:
 1574::1681    4e-05  25% 1699 aa  DHKE_DICDI RecName: Full=Hybrid signal transduction histidine kinase
    4::109     4e-05  32%  388 aa  CHEB4_HAHCH RecName: Full=Chemotaxis response regulator
    4::83      4e-05  29%  394 aa  CHEB2_PHOPR RecName: Full=Chemotaxis response regulator
   15::127     4e-05  29%  367 aa  CHEB2_METMA RecName: Full=Chemotaxis response regulator
   21::154     4e-05  33%  397 aa  CHEB2_BRAJA RecName: Full=Chemotaxis response regulator
    4::83      4e-05  31%  376 aa  CHEB1_VIBVY RecName: Full=Chemotaxis response regulator
    4::83      4e-05  31%  376 aa  CHEB1_VIBVU RecName: Full=Chemotaxis response regulator
    1::95      5e-05  31%  347 aa  CHEB4_GEOMG RecName: Full=Chemotaxis response regulator
    4::107     5e-05  32%  351 aa  CHEB2_SHESR RecName: Full=Chemotaxis response regulator
    4::107     5e-05  32%  351 aa  CHEB2_SHESM RecName: Full=Chemotaxis response regulator
    4::83      5e-05  31%  369 aa  CHEB1_VIBPA RecName: Full=Chemotaxis response regulator
   32::82      5e-05  29%  334 aa  CHEB1_BURS3 RecName: Full=Chemotaxis response regulator
   51::113     6e-05  30%  210 aa  FIMZ_SALTY RecName: Full=Fimbriae Z protein;
    1::108     6e-05  25%  239 aa  DCUR_SHIFL RecName: Full=Transcriptional regulatory protein dcuR;
    1::108     6e-05  25%  239 aa  DCUR_ECOLI RecName: Full=Transcriptional regulatory protein dcuR;
    1::108     6e-05  25%  239 aa  DCUR_ECO57 RecName: Full=Transcriptional regulatory protein dcuR;
    5::108     6e-05  33%  376 aa  CHEB_THICR RecName: Full=Chemotaxis response regulator
    6::109     6e-05  26%  367 aa  CHEB_THETN RecName: Full=Chemotaxis response regulator
    7::110     6e-05  31%  364 aa  CHEB_METBF RecName: Full=Chemotaxis response regulator
    4::109     6e-05  27%  386 aa  CHEB_IDILO RecName: Full=Chemotaxis response regulator
   32::71      6e-05  49%  338 aa  CHEB2_RALME RecName: Full=Chemotaxis response regulator
    4::79      6e-05  34%  374 aa  CHEB1_SHEON RecName: Full=Chemotaxis response regulator
    1::119     8e-05  23%  233 aa  YCCH_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::108     8e-05  29%  242 aa  Y538_VIBPA RecName: Full=Uncharacterized response regulatory
    5::108     8e-05  27%  236 aa  Y2823_SHEON RecName: Full=Uncharacterized response regulatory
  161::272     8e-05  30%  793 aa  PDE2_DICDI RecName: Full=3',5'-cyclic-nucleotide phosphodiesterase
    1::72      8e-05  35%  211 aa  LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR;
    1::105     8e-05  30%  366 aa  CHEB_SALRD RecName: Full=Chemotaxis response regulator
    7::110     8e-05  35%  354 aa  CHEB_CHRSD RecName: Full=Chemotaxis response regulator
    1::106     8e-05  30%  357 aa  CHEB_BACSU RecName: Full=Chemotaxis response regulator
    2::104     8e-05  31%  358 aa  CHEB3_VIBCH RecName: Full=Chemotaxis response regulator
    5::83      8e-05  33%  355 aa  CHEB3_GEOMG RecName: Full=Chemotaxis response regulator
    1::83      8e-05  37%  352 aa  CHEB2_XANCP RecName: Full=Chemotaxis response regulator
    1::83      8e-05  37%  352 aa  CHEB1_XANC8 RecName: Full=Chemotaxis response regulator
    4::68      8e-05  33%  377 aa  CHEB1_VIBCH RecName: Full=Chemotaxis response regulator
   20::131     8e-05  24%  618 aa  APRR1_ARATH RecName: Full=Two-component response regulator-like
   20::130     1e-04  27%  381 aa  CHEB_NITHX RecName: Full=Chemotaxis response regulator
    5::84      1e-04  29%  365 aa  CHEB_METMP RecName: Full=Chemotaxis response regulator
   32::87      1e-04  35%  337 aa  CHEB3_PSEPK RecName: Full=Chemotaxis response regulator
    1::83      1e-04  37%  352 aa  CHEB2_XANC5 RecName: Full=Chemotaxis response regulator
    1::83      1e-04  37%  352 aa  CHEB2_XANAC RecName: Full=Chemotaxis response regulator
    5::107     1e-04  33%  349 aa  CHEB2_PSEAE RecName: Full=Chemotaxis response regulator
   27::137     1e-04  27%  394 aa  CHEB2_AZOBR RecName: Full=Chemotaxis response regulator
    1::80      1e-04  31%  336 aa  CHEB1_PSEPF RecName: Full=Chemotaxis response regulator
    1::80      1e-04  32%  336 aa  CHEB1_PSEF5 RecName: Full=Chemotaxis response regulator
   54::119     1e-04  46%  361 aa  CHEB1_HAHCH RecName: Full=Chemotaxis response regulator
    1::81      1e-04  29%  342 aa  CHEB1_BORA1 RecName: Full=Chemotaxis response regulator
    1::108     1e-04  25%  239 aa  YEHT_SHIFL RecName: Full=Uncharacterized response regulatory
    1::108     1e-04  25%  239 aa  YEHT_ECOLI RecName: Full=Uncharacterized response regulatory
    1::108     1e-04  25%  239 aa  YEHT_ECOL6 RecName: Full=Uncharacterized response regulatory
    1::108     1e-04  25%  239 aa  YEHT_ECO57 RecName: Full=Uncharacterized response regulatory
   32::80      1e-04  40%  335 aa  CHEB3_PSEAE RecName: Full=Chemotaxis response regulator
    4::107     1e-04  31%  356 aa  CHEB2_CHRVO RecName: Full=Chemotaxis response regulator
    4::109     2e-04  30%  379 aa  CHEB_PSEA6 RecName: Full=Chemotaxis response regulator
    5::114     2e-04  26%  349 aa  CHEB_GEOKA RecName: Full=Chemotaxis response regulator
    8::111     2e-04  34%  358 aa  CHEB2_XANOR RecName: Full=Chemotaxis response regulator
    8::111     2e-04  34%  358 aa  CHEB2_XANOM RecName: Full=Chemotaxis response regulator
    4::107     2e-04  32%  351 aa  CHEB2_SHEON RecName: Full=Chemotaxis response regulator
   44::125     2e-04  37%  352 aa  CHEB2_SHEDO RecName: Full=Chemotaxis response regulator
    4::81      2e-04  36%  366 aa  CHEB2_RHOPB RecName: Full=Chemotaxis response regulator
    5::83      2e-04  33%  354 aa  CHEB2_GEOSL RecName: Full=Chemotaxis response regulator
    6::85      2e-04  34%  356 aa  CHEB2_DESDG RecName: Full=Chemotaxis response regulator
   32::82      2e-04  27%  334 aa  CHEB2_BURCA RecName: Full=Chemotaxis response regulator
    8::111     2e-04  34%  358 aa  CHEB1_XANC5 RecName: Full=Chemotaxis response regulator
    8::111     2e-04  34%  358 aa  CHEB1_XANAC RecName: Full=Chemotaxis response regulator
   32::80      2e-04  38%  341 aa  CHEB1_RALEJ RecName: Full=Chemotaxis response regulator
   18::123     2e-04  23%  592 aa  ARR21_ARATH RecName: Full=Putative two-component response regulator
   49::107     2e-04  33%  235 aa  MALR_BACSU RecName: Full=Transcriptional regulatory protein
    1::119     2e-04  25%  246 aa  LYTT_BACAN RecName: Full=Sensory transduction protein lytT;
    4::107     2e-04  32%  355 aa  CHEB_METFK RecName: Full=Chemotaxis response regulator
    1::80      2e-04  31%  336 aa  CHEB3_PSE14 RecName: Full=Chemotaxis response regulator
   21::131     2e-04  25%  394 aa  CHEB2_RHOCS RecName: Full=Chemotaxis response regulator
    1::80      2e-04  31%  336 aa  CHEB2_PSEU2 RecName: Full=Chemotaxis response regulator
    7::110     2e-04  33%  357 aa  CHEB1_RALME RecName: Full=Chemotaxis response regulator
    5::238     2e-04  23%  340 aa  CHEB1_CARHZ RecName: Full=Chemotaxis response regulator
    1::119     3e-04  25%  246 aa  LYTT_BACCR RecName: Full=Sensory transduction protein lytT;
    4::83      3e-04  29%  376 aa  CHEB_VIBF1 RecName: Full=Chemotaxis response regulator
    8::110     3e-04  28%  344 aa  CHEB_THEMA RecName: Full=Chemotaxis response regulator
    7::142     3e-04  33%  356 aa  CHEB2_RALEJ RecName: Full=Chemotaxis response regulator
    5::108     3e-04  32%  360 aa  CHEB1_BURCA RecName: Full=Chemotaxis response regulator
    4::61      4e-04  28%  138 aa  RRF1_DESVH RecName: Full=Protein rrf1;
 2178::2296    4e-04  33% 2310 aa  MAK2_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
    3::113     4e-04  24%  242 aa  LYTT_ENTFA RecName: Full=Sensory transduction protein lytT;
   34::106     4e-04  27%  244 aa  LYTR_STRMU RecName: Full=Sensory transduction protein lytR;
   15::125     4e-04  33%  375 aa  CHEB_ROSDO RecName: Full=Chemotaxis response regulator
    6::132     4e-04  34%  424 aa  CHEB_MOOTA RecName: Full=Chemotaxis response regulator
   39::112     4e-04  38%  392 aa  CHEB_DESHY RecName: Full=Chemotaxis response regulator
    5::108     4e-04  32%  350 aa  CHEB_BORPE RecName: Full=Chemotaxis response regulator
    5::108     4e-04  32%  350 aa  CHEB_BORPA RecName: Full=Chemotaxis response regulator
    5::108     4e-04  32%  350 aa  CHEB_BORBR RecName: Full=Chemotaxis response regulator
    1::80      4e-04  31%  336 aa  CHEB3_PSESM RecName: Full=Chemotaxis response regulator
    8::111     4e-04  32%  363 aa  CHEB3_BURS3 RecName: Full=Chemotaxis response regulator
    6::121     4e-04  31%  352 aa  CHEB2_MAGSA RecName: Full=Chemotaxis response regulator
   20::129     4e-04  27%  389 aa  CHEB1_RHOPB RecName: Full=Chemotaxis response regulator
    6::85      4e-04  31%  357 aa  CHEB1_DESVH RecName: Full=Chemotaxis response regulator
    6::109     4e-04  32%  364 aa  CHEB1_BURTA RecName: Full=Chemotaxis response regulator
    9::112     4e-04  32%  367 aa  CHEB1_BURPS RecName: Full=Chemotaxis response regulator
    6::109     4e-04  32%  364 aa  CHEB1_BURP1 RecName: Full=Chemotaxis response regulator
    6::109     4e-04  32%  364 aa  CHEB1_BURMA RecName: Full=Chemotaxis response regulator
   53::116     5e-04  25%  455 aa  LUXO_VIBCH RecName: Full=Regulatory protein luxO;
   20::129     5e-04  27%  385 aa  CHEB_RHOPS RecName: Full=Chemotaxis response regulator
    1::145     5e-04  39%  358 aa  CHEB_NITEU RecName: Full=Chemotaxis response regulator
    5::150     5e-04  30%  350 aa  CHEB_ENTCL RecName: Full=Chemotaxis response regulator
    5::108     5e-04  32%  362 aa  CHEB_BURXL RecName: Full=Chemotaxis response regulator
    2::80      5e-04  31%  349 aa  CHEB1_METAC RecName: Full=Chemotaxis response regulator
    1::111     5e-04  24%  120 aa  CCDB_BACSU RecName: Full=Protein ccdB;
    1::108     7e-04  26%  239 aa  YEHT_SALTY RecName: Full=Uncharacterized response regulatory
    1::108     7e-04  26%  239 aa  YEHT_SALTI RecName: Full=Uncharacterized response regulatory
  614::717     7e-04  28%  740 aa  ETR1_CUCSA RecName: Full=Ethylene receptor 1;       
  614::717     7e-04  28%  740 aa  ETR1_CUCMR RecName: Full=Ethylene receptor 1;       
   16::94      7e-04  36%  356 aa  CHEB4_ANADE RecName: Full=Chemotaxis response regulator
    8::111     7e-04  33%  358 aa  CHEB2_XANC8 RecName: Full=Chemotaxis response regulator
    7::106     7e-04  32%  341 aa  CHEB2_SYNWW RecName: Full=Chemotaxis response regulator
   20::129     7e-04  27%  391 aa  CHEB2_RHOPA RecName: Full=Chemotaxis response regulator
   32::71      7e-04  40%  339 aa  CHEB2_BURS3 RecName: Full=Chemotaxis response regulator
    8::111     7e-04  33%  358 aa  CHEB1_XANCP RecName: Full=Chemotaxis response regulator
    9::136     7e-04  27%  345 aa  CHEB1_MYXXD RecName: Full=Chemotaxis response regulator
    1::117     9e-04  26%  218 aa  UVRY_SHIFL RecName: Full=Response regulator uvrY;
    1::117     9e-04  26%  218 aa  UVRY_ECOLI RecName: Full=Response regulator uvrY;
    1::117     9e-04  26%  218 aa  UVRY_ECOL6 RecName: Full=Response regulator uvrY;
    1::117     9e-04  26%  218 aa  UVRY_ECO57 RecName: Full=Response regulator uvrY;
    4::68      9e-04  30%  388 aa  CHEB1_SHEDO RecName: Full=Chemotaxis response regulator
    8::88      9e-04  38%  357 aa  CHEB1_METMA RecName: Full=Chemotaxis response regulator
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
RESD_BACSU      --KILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKGLEANYDLILLDLMMPGTDGIEVCRQIREK
PHOP_BACSU      -KKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVCKQLRQQ
YCBL_BACSU      ----MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLVLLDIMLPKLNGMDFLKIIREK
YCF27_CYAPA     -KKILVVDDEISIRRILETRLSMIGYEVVTAADGEEALTIFQLEHPNLVVLDVMMPKLDGYGVCQELRKE
Y851_SYNP2      --RILVVEDEAVIRDMIVMGLEEEGYEVFFADNGRTGLNMLQNNAPDLVILDIMLPEVNGLDLCRFLRYQ
YCF27_PORAE     -EKILVIDDEASIRRILETRLSIIGYDVISAADGEEALSIFKREHPNLVVLDLMMPKLDGYGVCQELRKE
WALR_STAHJ      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAES      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAEQ      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
OMPR_SHIFL      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
OMPR_SALTY      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
OMPR_SALTI      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
OMPR_ECOLI      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
OMPR_ECOL6      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
OMPR_ECO57      --KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQ
YCLJ_BACSU      --KILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENWDLIILDIMLPSMDGVTICRKIRET
WALR_STAS1      -RKVVVVDDEKPIADILEFNLKKEGYEVFCAYDGNDAVDLIYDEEPDIVLLDIMLPGRDGMEVCREVRKK
YCF27_GUITH     -EKVLIVDDEASIRKILETRLSMIGYFVVTASDGEEALNLFHQEMPDVVILDIMMPKLDGYGVCQEIR-K
WALR_STAAW      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAU      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAT      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAS      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAR      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAN      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAM      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAE      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAC      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAAB      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAA9      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAA8      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAA3      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAA2      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
WALR_STAA1      -RKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKK
YYCF_BACSU      -KKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKK
SRRA_STAAW      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAU      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAS      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAR      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAN      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAM      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAAC      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
SRRA_STAA8      --EILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVATKLREH
YCF27_PORYE     -EKILVVDDEASXXXXXXXXXXXXGYEVITASNGEEALLVFRKEYPSLVVLDVMMPKLDGYGVCQELRKE
YCF27_PORPU     -EKILVVDDEASXXXXXXXXXXXXGYEVITASNGEEALIIFRKEYPSLVVLDVMMPKLDGYGVCQELRKE
YCF27_GALSU     -EKILIADDESSIRRILETRLSIIGYEVLTAPDGRSALFLFHKEHPNLVVLDVMMPKIDGYGVCQEIRKE
REGX3_MYCS2     MTSVLIVEDEESLADPLAFLLRKEGFEATVVGDGPSALAEFERSGADIVLLDLMLPGMSGTDVCKQLRAR
SPHR_SYNE7      --RILVVEDEAVIRDMVALVLQQEGFTVDVAADGRTALAGSVTENPDLVVLDLMLPAVNGLDFCRLLRRQ
REGX3_MYCTU     MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRAR
REGX3_MYCBO     MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRAR
YCF27_CYACA     ---LLIVDDENNIRKILQTRLTLLGYSVSTACNGEEALKIFTTHSIDLIILDVMMPKLDGYGVCQEIRKE
AFSQ1_STRCO     MPSLLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIR-R
VANR_ENTFC      --KILIVDDEHEIADLVELYLKNENYTVFKYYTAKEALECIDKSEIDLAILDIMLPGTSGLTICQKIRDK
YVRH_BACSU      ---ILIVDDEKAIVDMIKRVLEKEGYRILDAASAEEAIPVVKANKVDLIVLDVMMGGMSGFEACTLIREY
ARLR_STAS1      MTKILIVEDEQNLARFIELELEHENYDVDIEYDGKPGLEKALSNTYDLILLDLMLPNINGLEICRQIRQN
IRLR_BURPS      --RILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEYDLIILDVMLPGHDGWTVLERLR-R
YKOG_BACSU      ---ILIVEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAAAEGGYSLVLLDVMLPGLSGLEVLRRLRKT
YRKP_BACSU      -----------------------AGYEVLRAKDGKRALQLVN-DSLDLVILDIMMPGISGIETCQHIRKS
REGX3_MYCLE     --------------------------------DGPAALAEFDRSGADIVLLDLMLPGMSGTDVYKQLRVR
CZCR_RALME      --RVLVVEDEPRTAEYLQKGLSESGFVVDIANNGGDGLHMAEETDYDVIILDVMLPGMDGWTVIKSIRSK
CSEB_STRAW      ---VLFVEDDDVIREATQLALERDGFAVTAMPDGLSGLEAFRANRPDIALLDVMVPGLDGVSLCRRIRDE
ARLR_STAEQ      MTNILIVEDEQNLARFIELELTHENYTVDIENDGKAGLDKALSKPYDLYILDLMLPNINGLEICRQIRQK
ARLR_STAES      MTNILIVEDEQNLARFIELELTHENYTVDIENDGKVGLDKALSKPYDLYILDLMLPNINGLEICRQIRQK
MPRA_MYCSS      --RILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVCRQLRST
MPRA_MYCSK      --RILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVCRQLRST
MPRA_MYCSJ      --RILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVCRQLRST
COPR_PSESM      --KLLVAEDEPKTGIYLQQGLREAGFNVDRVVTGTDAVDQALNEAYDLLILDVMMPGLDGWEVIRRLRTA
ARLR_STAHJ      MTNILIVEDEQNLARFLELELTHDNYSVDIEYEGQAGLDKALSNNYDLIILDLMLPNINGLEICRRVRQE
YEDW_ECOLI      --KILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTA
CUSR_ECOLI      --KLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSA
CUSR_ECOL6      --KLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSA
CUSR_ECO57      --KLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSA
PCOR_ECOLX      MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQIISALRES
ARLR_STAAW      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAAS      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAAR      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAAM      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAAC      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAAB      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAA8      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
ARLR_STAA3      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
MTRA_MYCTU      -QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVCRVLRDS
MTRA_MYCPA      -QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVCRVLRDS
MTRA_MYCBO      -QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVCRVLRDS
MTRA_MYCLE      -QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVCRVLRDS
MPRA_MYCBP      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRST
MPRA_MYCBO      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRST
PHOB_RHIME      LPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVSGIELCRRLRQR
PHOB_KLEPN      -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGLQFIKLLKRE
MPRA_MYCUA      --RILVVDDDRAVRESLRRSLSFNGYTVELAHDGVEALEMIASDRPDALVLDVMMPRLDGLEVCRQLRST
MPRA_MYCS2      --RILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDALILDVMMPRLDGLEVCRQLRST
MPRA_MYCTU      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRGT
MPRA_MYCTA      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRGT
HSSR_STAEQ      MINCLIVDDDKKLLQYVSSHLERESIQTHTFTSGEASLDFLENKNVDIAIVDIMMSGMDGFELCQTLKD-
MPRA_MYCPA      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRST
MPRA_MYCA1      --RILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVCRQLRST
GTCR_ANEMI      -KTILIADDEPEIIELLKLFLERESYRIIEAYDGEQAWNYIRQHPVDLAIIDIMMPALDGFQLIKRLTNE
CHVI_RHIME      MQTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALEGLLARPPQLAIFDIKMPRMDGMELLRRLRQK
SAER_STAAW      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAS      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAR      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAN      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAM      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAE      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAC      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAAB      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAA8      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
SAER_STAA3      MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI-DIMVLDIMMPEVNGYDIVKEMKRQ
VANR_ENTFA      --RILLVEDDDHICNTVRAFLAEARYEVDACTDGNEAHTKFYENTYQLVILDIMLPGMNGHELLREFRAQ
PHOB_SHIDY      -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
PHOB_ECOLI      -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
PHOB_ECO57      -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
MPRA_MYCVP      --RILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVLDVMMPRLDGLEVCRQLRST
SPAR_BACSU      MAKILAVDDEKDILVLIQNILRRDQHQVDIL-DHVHGQPPDVFQGYDLILLDVMMPDIDGFELCKQIRPL
HSSR_STAES      MINCLIVDDDKKLLQYVSSHLERESIQTHTFTSGEASLDFLENKNVDIAIVDIMMSGMDGFELCQTLKD-
HSSR_STAHJ      MVKCLIVDDDYKILHYVSQHLEAAQIQTVTQASGESAIAYLANNKVDIAVVDIMMTGMDGFELCQLLKN-
MPRA_MYCLE      --RILAVDDDRAVRESLRRSLSFNGYSVELANDGVEALEMVARDRPDALVLDVMMPRLDGLEVCRQLRST
PHOB_SHIFL      -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
CHVI_RHISN      MQTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALEGLLARPPHLAIFDIKMPRMDGMELLRRLRQK
HSSR_STAS1      MTTCLIVDDDPKILEYVSKYIEREHFETIVQSSAENALSYLETHQVDIAIVDVMMGKMSGFELCKILKE-
CREB_ECOLI      ---VWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARKQVPDVMILDVGLPDISGFELCRQLLAL
HSSR_STAAB      MVQCLVVDDDSRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVIDIMMDGMDGFQLCNTLKN-
CSEB_STRCO      ---VLFVEDDDVIREATQLALERDGFAVTAMPDGLSGLESFRADRPDIALLDVMLPGLDGVSLCRRIRDE
HSSR_STAAW      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAT      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAS      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAN      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAM      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAA9      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAA8      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAA3      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAA2      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAA1      MVQCLVVDDDPRILNYIASHL-QTEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
PHOB_PSEAE      -KTILIVDDEAPIREMIAVALEMAGYECLEAENTQQAHAVIVDRKPDLILLDWMLPGTSGIELARRLKRD
HSSR_STAAE      MVQCLVVDDDPRILNYIASHL-QIEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAC      MVQCLVVDDDPRILNYIASHL-QIEHIDAYTQPSGEALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
HSSR_STAAR      MVQCLVVDDDPRILNYIASHLQTEHIDAFTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKN-
CIAR_STRR6      MIKILLVEDDLGLSNSVFDFLDDFADVMQVF-DGEEGLYEAESGVYDLILLDLMLPEKNGFQVLKELREK
CIAR_STRPN      MIKILLVEDDLGLSNSVFDFLDDFADVMQVF-DGEEGLYEAESGVYDLILLDLMLPEKNGFQVLKELREK
DLTR_STRA5      --RLLVVEDEKSIAEAIQALLADKGYSVDLAFDGDDGLEYILTGLYDLVLLDIMLPKRSGLSVLKRVREA
DLTR_STRA3      --RLLVVEDEKSIAEAIQALLADKGYSVDLAFDGDDGLEYILTGLYDLVLLDIMLPKRSGLSVLKRVREA
ARLR_STAAN      MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQ
CHVI_RHIRD      MQTIALVDDDRNILTSVSIALEREGYRVETYTDGASAVDGLIARPPQLAIFDIKMPRMDGMELLRRLRQK
SILR_SALTY      --KILIVEDDIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAEYDLVILDIMLPDVNGWDIIRMLRSA
PRRA_MYCTU      -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
PRRA_MYCBO      -----------------------SGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAM
PRRA_MYCLE      -----------------------SGFEVSTAIDGAEALRNATETRPDAIVLDINMPVLDGVSVVTALRAM
RCAC_FREDI      --KILLVEDDDVLIKVLTKNLTTHHYIVDVVKDGEMGWTYGSTFEYDLIILDIMLPNLDGISLCKRFRAQ
ARCA_SHIFL      ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
ARCA_ECOLI      ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
ARCA_ECOL6      ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
ARCA_ECO57      ---ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQ
YVCP_BACSU      MYRILLVEDDERIASLLGGHLQKYGYEVKIAEQLNDIKLEFAEMKPDLVLLDINLPFFDGFYWCRQIRTI
BAER_ECOLI      --RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTXXXXXXXXXXXXXXXGLTLCREIR-R
BAER_ECOL6      --RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTXXXXXXXXXXXXXXXGLTLCREIR-R
CUTR_STRLI      --RVLVVEDEQLLADAVATGLRREAMAVDVVYDGAAALERIGXXXXXXXXXXXXXXXXHGDDVCRKIVEL
CUTR_STRCO      --RVLVVEDEQLLADAVATGLRREAMAVDVVYDGAAALERIGXXXXXXXXXXXXXXXXHGDDVCRKIVEL
SAER_STAES      MTHLLIVDDEKDIVDICQTYFEYEGYQVTTTTCGKEALKXXXXXXXXXXXXXXX-PEVSGYDIVKKMKDM
SAER_STAEQ      MTHLLIVDDEKDIVDICQTYFEYEGYQVTTTTCGKEALKXXXXXXXXXXXXXXX-PEVSGYDIVKKMKDM
RPRY_BACFR      --RILLCEDDENLGMLLREYLQAKGYSAELYPDGEAGFKAFLKNKYDLCVFDVMMPKKDGFTLAQEVRAA
QSEB_ECOLI      --RILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREK
ARCA_HAEIN      --KILVVEDEIVTRNTLKGIFEAEGYDVFEAENGVEMHHILANHNINLVVMDINLPGKNGXXXXXXXXXX
CTRA_OCHA4      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUSU      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUSI      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUO2      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUME      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUC2      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUAB      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUA2      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
CTRA_BRUA1      --RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVLRTLRLS
KDPE_ECOLI      MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFIRDLRQW
CTRA_CAUCR      --RVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVXXXXXXXXXXXXXXXXXXXMSGIDVLRTLRVA
CTRA_CAUCN      --RVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVXXXXXXXXXXXXXXXXXXXMSGIDVLRTLRVA
QSEB_ECO57      --RILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREK
PETR_RHOCA      ---LLIVDDDERIRGLLQKFLIRNGFLVTAGRDAAHARRLLSGLEFNLIVLDVMMPGEDGLSLTRDLRTK
YBDJ_BACSU      --RILIVEDDVMIGDLLQKILQREGYRVIWKTDGADVLSVIQKV--DLVIMDVMLPGEDGYQMSAKIKKL
VIRG_AGRRH      MKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLSSETVDVAVVDLNLGREDGLEIVRTLATK
VIRG_AGRT5      LKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLCSETVDVVVVDLNLGREDGLEIVRSLATK
TORR_ECOLI      ---IVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRER
TORR_ECO57      ---IVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQPVDLILLDINLPDENGLMLTRALRER
PHOP_SALCH      MMRVLVVEDNALLRHHLKVQLQDSGHQVDATEDAREADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSS
YXDJ_BACSU      MNKIMIVEDSEDIRGLLQNYLEKYGYQTVVAADFTAVLDVFLREKPDVVLLDINLPAYDGYYWCRQIRQH
GRAR_STAAW      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAT      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAS      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAR      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAN      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAM      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAE      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAC      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAAB      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAA9      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAA8      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAA3      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAA2      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
GRAR_STAA1      --QILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREV
CPXR_HAEIN      MSKLLLVDDDIXXXXXXXXXXXXXGFDVETANNGLEALQKLN-ESYKLVLLDVMMPKLNGIETLKEIRKV
GRAR_STAES      --QILLVEDDNTLFQELKKELEQWDFNVVGVEDFSHVMETFETFNPEIVILDVQLPKYDGFYWCRKMRQQ
GRAR_STAEQ      --QILLVEDDNTLFQELKKELEQWDFNVVGVEDFSHVMETFETFNPEIVILDVQLPKYDGFYWCRKMRQQ
QSEB_HAEIN      --RILLIEDDNLIGNGLQIGLTKLGFAVDWFTDGKTGMAALTSAPYDAVVLDLTLPKLDGLEVLQQWRSN
PHOB_HAEIN      -RKILIVEDECAIREMIALFLSQKYYDVIEASD-FKTAINKIKENPKLILLDWMLPGRSGIQFIQYIKES
BCER_BACSU      MFKLLLIEDDESLFHEIKDRLTGWSYDVYGIQDFSQVLQEFAAVNPDCVIIDVQLPKFDGFHWCRLIRSR
CPXR_SHIFL      MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDG-EQAXXXXXXXXXXXXXXVMMPKKNGIDTLKALRQT
CPXR_ECOLI      MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDG-EQAXXXXXXXXXXXXXXVMMPKKNGIDTLKALRQT
CPXR_ECO57      MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDG-EQAXXXXXXXXXXXXXXVMMPKKNGIDTLKALRQT
PHOP_SALTI      MMRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSS
PHOP_SALTY      MMRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSS
PHOP_SALPA      MMRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSS
GRAR_STAHJ      --QVLLVEDDQTLFQELKKELEHWDFFVTGIDDFSAVMDIYEETNPEIVIMDVQLPKYDGFYWCRKIRQV
PHOP_SHIFL      --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSN
PHOP_ECOLI      --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSN
PHOP_ECOL6      --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSN
CSSR_BACSU      --------------------------------------------SPHLWILDIMLPDTDGYTLIKEIKAK
GRAR_STAS1      ---ILLVEDDMTLFKELSEELEQWDFNVNGIDDFNDVMTKFESVNPAIVIMDVKLPKYDGFYWTRKIREV
RSTA_ECOLI      MNTIVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDQAEETILRENPDLVLLDIMLPGKDGMTICRDLRAK
PHOP_ECO57      --RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLICRWRSN
TCTD_SALTY      --RLLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLHSEMYALAVLDINMPGMDGLEVVQRLRKR
QSEB_SALTY      --RILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREK
QSEB_SALTI      --RILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREK
PFER_PSEAE      --RLLLVEDDPRLREDLDAHFRRRGFRVTVCGDGSHGLEAAGREAFDLVLLDIMLPGLDGLALLESLRRE
BCER_BACHD      MFKIMLIEDDHTLFSEIKERLSQWSYDVFGVSNFEKVIEEFTSLKPDLVIIDIQLPKFDGFHWCRMIRQH
PILG_PSEAE      --KVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALAKIADTHPNIIFVDIMMPRLDGYQTCALIKNN
GLNR_STRCO      ----------------------------------AEGPALVDTPGADVILVDGRRDLPQIRSLCQLLRST
NISR_LACLA      --KILIVDDDQEILKLMKTALEMRNYEVATHQNISLPLDITDFQGFDLILLDIMMSNIEGTEICKRIR-R
VIRG_AGRT9      LKHVLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATXXXXXXXLNLGREDGLEIVRNLAAK
BASR_ECOLI      --KILIVEDDTLLLQGLILAAQTEGYACDSVTTARMAEQSLEAGHYSLVVLDLGLPDEDGLHFLARIRQK
VIRG_RHIRD      LKHVLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATXXXXXXXXXXXREDGLEIVRNLAAK
BASR_SALTY      --KILIVEDDTLLLQGLILAAQTEGYAC----DGVSTARAAEHSLESLMVLDLGLPDEDGLHFLTRIRQK
PLED_CAUCR      --RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDD
PILH_PSEAE      MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEKPDVVLMDIVMPGLNGFQATRQLTKD
Y4XI_RHISN      --RTLLVDTD--LTRAVRGALGDGGFAVDVVGTLEQASSAFFSASYEILLLELVLPDGDGLDWLRQLRSD
ATOC_ECOLI      INRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSH
PMRA_PECCC      --KLLIVEDDKLLQEGLLLALSHEGYACDCAGTAKEADALIGSAHYSLVIXXXXXXXXXXXXXXSRWRKN
NTRC_ECOLI      ---VWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQR
NTRC_ECO57      ---VWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQR
RCSC_SALTY      ---ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNAIDIVLSDVNMPNMDGYRLTQRIRQL
RCSC_SALTI      ---ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNAIDIVLSDVNMPNMDGYRLTQRIRQL
NTRC_SALTY      ---VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQR
FRZE_MYXXA      --RVLLVDDSPIARATEGALVKALGHSVEEAQDGEEAYVKVQNNTYDLILTDVQMPKLDGFSLARRLKST
YCF29_PORYE     --KLMLVENDIVLSKAIQEYLIDQGFNVYIANNGLEALNLAYQYNFDLIISDIMMPLVNGYEXXXXXXXX
HNR_SHIFL       -KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNR
HNR_ECOLI       -KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNR
HNR_ECO57       -KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNR
RCSC_ECOLI      ---ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQL
PDTAR_MYCTU     -RRVLIAEDEALIRMDLAEMLREEGYEIVEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASK
RSSB_SERMA      -------------------------------------------------------------------RAA
NTRC_PROVU      ---VWVVDDDSSIRWVLERAITREGMLCRAFEHANDVLKALNSEQPDVLLSDIRMPDMDGLSLLKIIKEQ
NTRC_KLEPN      -----IVDDDSSIRWVLERALTGAGLSCTTFESGNEVLDALTTKTPDVLLSDIRMPGMDGLALLKQIKQR
CHEY_BACSU      --RILIVDDAAFMRMMIKDILVKNGFVVAEAENGAQAVEKYKEHSPDLVTMDITMPEMDGITALKEIKQI
ZRAR_KLEOX      ---ILVVDDDISHCTILQALLRGWGYRVALANNGLQALEKVREKVFDLVLCDIRMAEMDGIETLKEIKTF
DHKJ_DICDI      ---ILLAEDNAVNQRLAIRLLEKFGHRVQLAENGLQAVASSQLRKFDLILMDVQMPHCGGFEATAQIREQ
DCTR_BACSU      --KVLLIEDDPMVQEVITTVKGVT--VCATAGNGEEGMKLIKEEQPDLVILDVYMPKKDGIKTLQEIRKQ
ALGB_PSEPK      --RILLVDDESAILRTFRYCLEDEGYSVATANSAAQAETLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQ
YFHA_ECOLI      ------------------------GYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLFAEIQKV
YFHA_ECO57      ------------------------GYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLFAEIQKV
SP0F_BACSU      -EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
ALGB_PSESM      --RILLVDDESAILRTFRYCLEDEGYSVATANSAAQADTLMQRQVFDLCFLDLRLGEDNGLDVLAQMRIQ
CHEB6_ANADE     ---------------------GDGLVVAGTAADGEQGLAEALRLEPDVVVLDLQMPRMDGFTFLRLLMAR
YSO1_PLEBO      ---ILVVDDDPDTRDLLRFMLEDEGAIVTVAPNAKEAXXXXXXXXXXXXVSDVAMPEMDGFELIGRVREK
NARL_SHIFL      ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
NARL_ECOLI      ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
NARL_ECOL6      ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
NARL_ECO57      ---ILLIDDHTGVKQLI-SMAPDITVV-GEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
ZRAR_SALTY      ---ILVVDDDVSHCTILQALLRGWGYNVALAYSGHDALAQVREKVFDLVLCDVRMAEMDGIATLKEIKAL
ZRAR_SALTI      ---ILVVDDDVSHCTILQALLRGWGYNVALAYSGHDALAQVREKVFDLVLCDVRMAEMDGIATLKEIKAL
DHKB_DICDI      ---ILLVEDNFVNVKIFSKLLKDSGYIFDVAHNGVEAVECVKKGAYDLILMDCQMPEMDGFEATTAIREN
DCTR_BACME      ---VLLIEDDPMVQEVNRQFIEQVGFTIAAASNGLEGVQLIKQHQPDLTIIDMYMPSQDGLTTLQQIRAN
SP0F_BACTK      --KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIEIFKACKEI
SP0A_BACCI      --KVCIVDDNRELVGLLEEYAQDDMEVIGVAHNGQECLELVEQLEPDVMVLDIIMPHIDGLAVLERMRQM
NTRX_AZOC5      ---ILIVDDEPDISGLVAGILEDEGYSARTARDADGALAEIAARRPNLIFLDIWLSRLDGLELLDIIKRE
CHEY_LISMO      MLKLLIVDDAMFMRTMIKNIVKDSDFVVAEAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEALAQIMAK
CHEY_LISIN      MLKLLIVDDAMFMRTMIKNIVKDSDFVVAEAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEALAQIMAK
DHKD_DICDI      ---VLVVEDNPEMNRFIAELLSKY-YFVVTAFDGVEGIEKTRAITPDLIVTDCMMPRMSGDEMVEQLREQ
CYAB_STIAU      --RVMVVDDSPLACDFVGLEALGLGYEVMCFQDPYEALEQVGKVQPAIVLSDLDMPGIDGLELCRLKESP
ALGB_PSEAE      --RILLVDDESAILRTFRYCLEDEGYSVATASSAPQAEALLQRQVFDLCFLDLRLGEDNGLDVLAQMRVQ
REGA_RHOS4      -RSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRER
NARP_ECOLI      --QVMIVDDHPLMRRGVRQLLEDPGSVVAEAGDGASAIDLANRLDIDVILLDLNMKGMSGLDTLNALRRD
CHEY_THEMA      -KRVLIVDDAAFMRMMLKDIITKAGYEVAEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKI
NARP_HAEIN      --KVLLIDDHPLMRRGIKQLVDDNFEVVADVSSGTEGISVALQTSPDVIILDLNMKGLSGLDTLKGLRAE
DHKG_DICDI      --KILIVEDNEMNANIMFKMLAKLGIQCELALNGLEGVKKAKNEEYDLIIMDIQMPVMCGLTATSLIRKH
CQSS_VIBCH      -RRILVVDDNQSIRTFTAILLEQQGYEVVQANDGSEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRHE
ALGR_PSEAE      ---VLIVDDEERLARLVGQLDGYRVLEPS-ASNGEEALTLIDSLKPDIVLLDIRMPGLDGLQVAARLCER
Y2406_STAEQ     MFKVIICDDERIIREGLKQMVPWEDYHFTTAKDGVEALSLIRQHQPELVITDIRMPRKNGVDLLDDIKD-
FIXJ_BRAJA      ---IYVIDDDAAMRDSLNFLLDSAGFGVTLFDDAQAFLDALPGLSFGCVVSDVRMPGLDGIELLKRMKAQ
SP0A_BACAN      --KVCLVDDNKELVSMLESYAQDDMEVIGTAYNGQECLNLLKDKQPDVLVLDIIMPHLDGLAVLEKMRER
CHEB2_GEOMG     --RVVVIDDSRAIIKMLESMPEVV--VAGYANDGEEGIRKVIDLKPDLVTLDLEMPKMDGFTLLRIIMGY
Y165_STAES      MFKVVICDDERIIRQGLKQMIPWKEYHFTTATDGVEALSLIRQHQPELVITDIRMPRKNGVDLLDDIKD-
SP0A_CLOPA      ---VLIADDNKEFCNILNDYLLNQSVVVGIAKDGIEALKLIEEKKPDLVILDIIMPNMDGLVVLEKLANI
NTRXL_RICPR     ---VLIVDDEESIRNLIAANLKDEGFNPKIAANSTQALKIISEKPVSAVILDIWLSEIDGLGVLEIIKKR
SP0A_CLOAB      ---VLIADDNKEFCNILNDYLLNQSIVVGIAKDGVEALKLIENKKPDLVVLDIIMPRLDGLGVLKLNNKD
SP0A_BACTU      --KVCLVDDNKELVSMLESYAQDDMEVIGTAYNGQECLNLLTDKQPDVLVLDIIMPHLDGLAVLEKMRER
SP0A_BACCR      --KVCLVDDNKELVSMLESYAQDDMEVIGTAYNGQECLNLLTDKQPDVLVLDIIMPHLDGLAVLEKMRER
NTRXL_RICTY     ---VLILDDEESIRNLIAANLKDEGFNPKVAANSTQALKIISEKPVSAVILDIWLSEIDGLGVLEIIKKR
TRPO_PSEAE      MSKVLIVDDHPAIRLAVRLLFERDGFTIVEADNGAEALQVARKKSPDLAILDIGIPKIDGLEVIARLKSL
NTRXL_RICFE     ---VLIVDDEESIRNLIAANLKDEGFNPKVAANSTQALKILSEKPVSAVILDIWLSEIDGLGILEIIKKR
GACS_PSESY      --RVLCVDDNPANLLLVQTLLEDMXXXXXXXXXXXXXXXXXQQEAFDLVLMDVQMPGMDGRQATEAIRER
Y217_STAA3      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y214_STAAR      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y201_STAAC      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y198_STAAW      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y198_STAAS      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y184_STAA8      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
Y161_STAAB      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAH-
NTRXL_RICCN     ---VLIVDDEESIRNLIAANLKDEGFNPKVAANSTQALKILSEKPVSAVVLDIWLSEIDGLGILEIIKKR
LUXQ_VIBVY      --KVLLVEDNHTNAFILKAFCQKYQMSVEWVQDGTQALEKLKEHAFDLILMDNQLPKMGGIEATREIRET
LUXQ_VIBVU      --KVLLVEDNHTNAFILKAFCQKYQMSVEWVQDGTQALEKLKEHAFDLILMDNQLPKMGGIEATREIRET
SP0A_CLODI      --KIVLADDNKDFCQVLKEYLSDDIDILGIAKDGIEALDLVKKTQPDLLILDVIMPHLDGLGVIEKLNTM
CHEY_PSEAE      --KILIVDDFSTMRRIIKNLLRDLGFTTAEADDGTTALPMLHSGNFDFLVTDWNMPGMTGIDLLRAVRER
CHEB3_GEOSL     --RVVVIDDSAYSRRAITKMLESMPEVIGYATDGEEGIRKIIDLKPDLVTLDLEMPRMDGFTLLRIVMEY
BARA_SHIFL      ---VMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQH
BARA_ECOLI      ---VMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQH
BARA_ECOL6      ---VMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQH
BARA_ECO57      ---VMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQMPDMDGIRACELIHQH
Y223_STAAM      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVD---LLNDI
Y215_STAAN      MFKVVICDDERIIREGLKQIIGDYHFNTIYAKDGVEALSLIQQHQPELVITDIRMPRKNGVD---LLNDI
PATA_ANASP      ---IFCIDENPIVLNNIKNFLDDQIFAVIGVTDSLKALMEILCTKPDIILINVDMPDLDGYELCSLLRKH
EVGS_ECOLI      ---ILIADDHPTXXXXXXXXXXXXGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKLREQ
DCTR_BACHD      --RVLLIEDDPMVQEVVEKLSGFT--IVGTTATGEEGMVKTRELQPDLILLDIFMPKQDGLSFIKQIREQ
CHEB2_METHJ     MIRVLLVDDSPVTLMVLQSILEKEPSVIGQAKNGKEAIILASRLAPDIITMDINMPDLDGFATTRQIMER
CHEY_TREPA      --RVLVVDDSMFVSKQIGQILTSEGYEXXXXXXXXXXXXEAMSPGVDLVTMDITMPKMDGITALEKILEF
ARR14_ARATH     --RILVVDDDTSCLFILEKMLLRLMYQVTICSQADVALTILRKDSFDLVLSDVHMPGMNGYNLLQQVGLL
EVGS_ECO57      ---ILIADDHPTXXXXXXXXXXXXGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNVDGFELTRKLREQ
CHEB2_ACIBL     --RVLVVDDSALMRKMITQMLDPAIEVIGTAMDGAFGLKKIEELRPDVVTLDLEMPNMDGMEMLRHITKR
ZRAR_ECOLI      ------------------------GYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKAL
SKN7_YEAST      ---VLLVEDDAVSIQLCSKFLRKYGCTVQVVSDGLSAISTLEKYRYDLVLMDIVMPNLDGATATSIVRSF
REGA_RHOCA      -RSLLLVDDDNAFLTRLARAMEKRGFQTEIAETVSAGKAIVQNRAPAYAVIDLRLEDGNGLEVVEALRER
HILA_SALTI      ----------------------------------------------------------------------
DCTD_RHILE      ---VALIDDDKDLRRATAQTLELAGFSVS-AYDGAKAALAADFAGP--VVTDIRMPEIDGLQLFATLQGM
CHEB_TREDE      --RVLIVDDSALMRNLIGKIV-DATPGLKIADKAMNGLQKLERVAPDVIVLDLEMPEMNGIEFLRELKKQ
CHEB1_SYNWW     -KKVLVVDDSAFMRKMIGDMSDDELEIVGKAGNGQEALEKIRELQPDVVVMDIEMPVLDGLSTSRIMESQ
CHEB1_SYNAS     MIKVLIVEDSPVVRELLSHILHSDPQVVGVAESGEEALKEVVRLRPDLITMDVNLPRMDGFTTRRIMEE-
APRR5_ARATH     --RVLLVEADDSTRQIIAALLRKCSYRVAAVPDGLKAMLKGKPESVDLILTEVDLPSISGYALLTLIMEH
SP0A_BACSU      --KVCVADDNRELVSLLSEYGQEDMEVIGVAYNGQECLSLFKEKDPDVLVLDIIMPHLDGLAVLERLRES
HILA_SALTY      ----------------------------------------------------------------------
HILA_SALPA      ----------------------------------------------------------------------
CQSS_VIBHB      -RTIMVVDDNESLRKFTAMLLEKQGFEVIQTEDGLQAINALNENNVDLILMDIEMPVMDGVEASRQIRKA
CHEY_HELPY      --KLLVVDDSSTMRRIIKNTLSRLGYEDVLAEHGVEAWEKLDANADTKVLIDWNMPEMNGLDLVKKVRSR
CHEY_HELPJ      --KLLVVDDSSTMRRIIKNTLSRLGYEDVLAEHGVEAWEKLDANADTKVLIDWNMPEMNGLDLVKKVRNR
CHEB_TREPA      ---VLIVDDSALMRKVIGKVIGAPGLSIAKAMNGRFALDMLERVQPDVILLDLEMPHMNGLQFLEQRKRL
CHEB_NOCSJ      --RVLVVDDSVVIRKLVSDLADPDIEVVGTAVNGRAALQKVAQLRPDLVTMDIEMPEMDGIESVRAIRAT
CHEB3_RHOPA     --RVLIVDDSASVRQVLGTILAEDPEVIGTASDPFVAAKRLQNELPDVILLDIEMPRMDGITFLRIMAQH
CHEB3_BRAJA     --RVLIVDDSASVRQILQTILNDDPEVMGTASDPFAAARRLQNEIPDVMILDIEMPRMDGMTFLRIMAQR
ZRAR_ECO57      ------------------------GYNVALANSGRQALEQVRERVFDLVLCDVRMAEMDGIATLKEIKAL
YHCZ_BACSU      ------------------------------AATGLEALRVIEETKPDLVLMDLSMPEMDGIQAIKKAIQQ
YDFI_BACSU      MNKVLIVDDHLVVREGLKLLTNDQYTIIGEAENGKVAVRLADELEPDIILMDLYMPEMSGLEAIKQIKEK
CHEY_RHIEC      --KVLIVDDQVTSRLLLSDALTQLGFKITSAGDGEQGMKIMTEQPHHLVISDFNMPKMDGIGFLQAVRTN
SP0A_BACST      --KVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAG
DHKI_DICDI      -QKVLVAEDNTMNQKLIKTLLTKRGFDITIAKDGKQALDFYHESKNDCILMDIQMPILSGLEATCAIREE
CHEB_ARCFU      --RVLVVDDSALVRMAVTDILTKAGIEVVTAKNGREAVEKALKLKPDVITLDINMPEMDGLTALKLIMEK
Y0G0_VIBCH      ----VLADDEPLLRHHLNKLLAELWPALASAENGQIALQAIEQHQPDVVFLDIRMPKMDGIEVARRLLQQ
NTRC_BRASR      ---ILVADDDTAIRTVLNQALSRAGYEVRLTGNAATLWRWVSQGEGDLVITDVVMPDENAFDLLPRIKKM
DOKA_DICDI      -KKYILVAEDNDIIKVVVRQLEKLGYTAIVGINGLKALEIIGSFPICLILLDCQMPQMDGFTCSTILRQT
DCTD_RHIME      ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
CHEB_BACHD      --KVLVVDDSAFMRKVITSMSDPRLEVVGTARNGEDALKKRKTLAPDVMTLDVEMPVMDGIETLRLMSEN
RPFG_XANC8      ---IVIVDDQMSARTMLRHVIEDIAPELKVYDDPLDALSWCEAGRVDLLLLDYRMPGMDGLEFARRLRRR
SP0A_BACME      --KVCLVDDNRELIGLLEDYISEQEEVIGVAYNGQECLSILKDKNPDVLVLDIIMPHLDGLAVLGQLKEK
SP0A_CLOB8      ------------------------------AKDGREALELIVERKPDLVILDIIMPHLDGLGVLEKLNTM
NTRC_AZOC5      ---ILVADDDAAIRTVLNQALSRAGYEVRSCGNAATLWRWVSQGDGDLVITDVVMPDENAFDLLPRIKKA
CHEY_YERPE      --RFLVVDDFSTMRRIVRNLLKELGFHVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTD
CHEY_YEREN      --RFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLRTGGFDFVVSDWNMPNMDGLDLLKTIRAD
CHEB_NATPD      ----VVVDDSQFMRTVISDMLDDAGITVATASNGESGVEAVRTHEPDVVTMDLKMPGMDGIATGRIMDE-
YCF29_PORPU     ---LMLVENDTVLSKAIQEYLIDQGFNVDIALNGLEAFQLANKYKFXXXXXXXXXXXXXGYELLEKLRDK
Y8J3_VIBVU      ----LIADDEPLLRHHLNRMLADVWEVVALVGDGQQALTSIEQLQPDIVFLDIRMPELDGIAVAKQLNRG
PILR_PSEAE      -QKALIVDDEPDIRELLEITLGRMKLDTRSARNVKEARELLAREPFDLCLTDMRLPDGSGLDLVQYIQQR
DIVK_OCHA4      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRNGLEALDLAREHRPDLILMDIQLPEVSGLEVTKWLKDD
DHKK_DICDI      --KVLIAEDNIINQRVAVKFLEKIGIKAEVAGNGNEVLEILERQHYDLIFMDFQMPILDGLRCSKTIREW
CHEY_CAMJJ      --KLLVVDDSSTMRRIIKNTLTRLGHDDVLAEHGVEAWLLTKNEDVKVLITDWNMPEMNGLELVKKVRKK
CHEY_CAMJE      --KLLVVDDSSTMRRIIKNTLTRLGHDDVLAEHGVEAWLLTKNEDVKVLITDWNMPEMNGLELVKKVRKK
CHEY_CAMJ8      --KLLVVDDSSTMRRIIKNTLTRLGHDDVLAEHGVEAWLLTKNEDVKVLITDWNMPEMNGLELVKKVRKK
CHEB_HALSA      MTEALVVDDSHFMRTVISDILEDGGVVVGTAENGARALDAVTDVQPDVITMDVEMPEMDGIATAEIMREQ
CHEB3_HAHCH     ---VLIVDDSPVIRQLLRHIIEEGGMVIGEASNGVEALRCIARRRPDVITMDIHMPVMDGLEASRRIMEE
CHEB2_DESVH     MISVVVVDDSAFMRKALSTMLEKDPEVVATARDGEEGLQVIRQHNPDVVTLDIEMPRMDGLTTLRIMME-
CHEB1_DESDG     MIKVVVVDDSAFMRKALSSMLEDPGISVATARNGEEGLEQIRKHDPDVVTLDIEMPRMDGLTALRIMME-
ACTR_RHIME      -KSLLIVDDDTAFLRRLARAMEARGFAVEIAESVAEGIAKAKTRPPKHAVIDLRLSDGSGLDVIEAIRGR
YPH5_THIVI      --RILILEQDASHAKKIASLLATIGMETLVVDDPMKILARMQAFRPNLVLMDLYLPGATGSELTTIIRDH
PRR1_SCHPO      --RILLVEDDELSRRMTIKFLTSFDCQVDVAVDGIGAVNKANAGGFDLILMDFILPNLDGLSVTCLIRQY
DIVK_BRUSU      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUSI      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUO2      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUME      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUC2      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUAB      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUA2      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
DIVK_BRUA1      -KSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKEE
CHEB_HALMA      --RAVVADDSHFMRSVISDILSDGGIVVAQARDGEEAVSAVIEHRPDVVTMDVEMPVMNGIATERIMAES
CHEB1_LEPIN     --RAVIIDDSLLVRNIISDQIQKDSHVVATGKTGMDCIDLAQKMNPDVIILDVEMPVMDGLTALHELQKK
CHEB1_LEPIC     --RAVIIDDSLLVRNIISDQIQKDSHVVATGKTGMDCIDLAQKMNPDVIILDVEMPVMDGLTALHELQKK
ARR12_ARATH     --RVLAVDDDQTCLKILESLLRHCQYHVTTTNQAQKALELLRENKNDLVISDVDMPDMDGFKLLELVGLE
ARR11_ARATH     --RVLVVDDDPTWLKILEKMLKKCSYEVTTCXXXXXXXXXXXKDGYDIVISDVNMPDMDGF---KLLEHV
ACTR_SINMW      -KSLLIVDDDTAFLRRLARAMEARGFAVEIAESVAEGIAKAKTRPPKHAVIDLRLGDGSGLDVIEAIRGR
NTRC_RHIME      ---ILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIAAGDGDLVVTDVVMPDENAFDLLPRIKKA
FIXJ_AZOC5      -----VIDDDDAVRESLAFLLESSGLAVTQHTSAAAFLDAGVPLDRGCIVTDVRMPGISGLELLKELNAR
CHEB4_MYXXD     --RILVAEDSPTARRLLVEIADPALTVVGEARDGVEAVELAQRLRPSLVTMDIQMPRMDGLATRRIMXXX
CHEB1_METHJ     MIRVLVIDDSLFIRTVVQDMLSDDPQIVGVASDGLEALDKIRELKPDLITLDIEMPRLDGLS--MLERKK
ARR10_ARATH     --RVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENKNDLVISDVDMPDMDGFKLLELVGLE
YCF29_CYAPA     ------------------------------------------------------MPGMGGFNFLHQLRLN
FIXJ_RHIME      -----IVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
CITT_BACHD      --KVLIIEDDFRVAQIQEQMVNDHPYVISTCRTGGEALDYLSEKAADLILLDVYIPDVKGLELLWAIREK
TCSB_EMENI      LKKIRALVAEDNVVNVLRMLALEDVYDVTVVKDGQEAYDTVEGKVFDLIFMDIQMPNLDGIESTRLIRQM
FIMZ_ECOLI      ----------------------------------------------DLIIMDIDLPGTDGFTFLKRIKQI
FIMZ_ECO57      ----------------------------------------------DLIIMDIDLPGTDGFTFLKRIKQI
CHEY_SHIFL      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
CHEY_ECOLI      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
CHEY_ECO57      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
CHEB2_RHORT     --RVLIVDDSASVRQTMTELESDPGIVIGTAPDPYVAARRIQQEVPDVITLDVEMPRMDGITFLRIMAQR
AGLZ_MYXXD      -RRVLIVESEHDFALSMATVLKGAGYQTALAETAADAQRELEKRRPDLVVLRAELKDQSGFVLCGNIKKG
LUXQ_VIBCH      --RVLLVEDNHTNAFIAQAFCRKYGLDVSWVTDGLQAIEELKIHDYDLVLMDNQLPYLDGVETTRTIK-K
CHEY_ECOL6      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGLDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
Y4021_VIBPA     ----------------------------AKVADGEQALLAIEQSQPDIAFLDIRMPVLDGMSLAQKLNRL
SP0A_MOOTA      --KVLIADDNREFCEVLEEYFNEQEVLSGVAHNGQETLELIQEQEPDIVILDIIMPHLDGIGVLEKLQVL
CHEB1_MAGSA     --RVMLVDDSAVVRGLVTRLEGEAGIVVASVGNGQMALASLERNEIDVVILDIEMPVMDGLTALPKLLQI
TCSA_EMENI      -KHVLLVEDNIVNHTVMLKLLHTIGFQIDGAWNGAEAVRMVRQKSYDIILMDVSMPVLDGLAATEQIRDM
SP0A_BACSH      ----------------------------ATASNGKVCLQMLEEYTPDILLLDIIMPHLDGLAVLEAMNDR
PRR95_ORYSJ     --RVLLAEGDDSTRHIICALLRKCGYRVAAASDGVKAWDILKEKSIDLVLTEVELPLMSGFLLLSTIMEH
PRR37_ORYSJ     --KVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEQNSIDLVLTEVVMPGVSGISLLSRIMNH
PRR37_ORYSI     --KVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEQNSIDLVLTEVVMPGVSGISLLSRIMNH
NODW_BRAJA      ---VFVVEDDISMRRSLTNLFRSVGLEVVAFGSAREMLQSTMPDVTSCLVLDVRLPGLSGLDYQTELARL
DHKM_DICDI      ----------------------------------------------DLILMDIHMPVMDGITCSKLTREH
CHEB_SYMTH      --RVLVVDDSAFMRKVLTELLESDPLVVGTARDGQDGLEKVLQLQPDVVTLDIEMPRLDGYGTLREIMAR
CHEB_PYRHO      --KVLVVDDSAFMRKVLKDIINSDPEVCGEARDGIEAIEMVQKCRPDVVTLDVEMPRMNGLDALRVIMKR
CHEB_OCEIH      MRKVIVIDDSAFMRKIISDILDNDPRVVAVARNGEDGLNKVIQLSPDVVTLDVHMPKMDGMQALRIMNEH
CHEB_LAWIP      MTRVIVVDDSAFFRSSITKMLTQDSEVIGVAKDGIEGLEKIKNLKPDVVTMDIEMPKLDGISTLKIIMDE
CHEB_ALHEH      --RALVVDDSGFFRRRIKSMLEEHPEVVGEAANGRQAVEQAQKLRPDVITMDIEMPEMDGITAVREIMRR
CHEB2_BURPS     ------------------------------ATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMER
CHEB2_BURP1     ------------------------------ATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMER
CHEB2_BURMA     ------------------------------ATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMER
CADC_ECOLI      ----------------------------------------------------------------------
CHEB_CLOAB      --KVIVVDDSVLMRRLICDMSNDNIEVIGTAINGQDLLNKLKVMKPDVITLDIEMPVMNGIETLKAVKSL
BVGA_BORPE      --KVLIIDDHPVLRFAVRVLMEKEGFVIGETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSL
BVGA_BORPA      --KVLIIDDHPVLRFAVRVLMEKEGFVIGETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSL
BVGA_BORBR      --KVLIIDDHPVLRFAVRVLMEKEGFVIGETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSL
SP0A_BREPA      --EVLLADDNREFVSLLEEYISSQYNVIGVAYNGNEVVRLLQERVPDVLILDIIMPHLDGLAVLEQIQAM
LUXN_VIBHB      ---VLIVDDKEVQRALVQMYLNQLGVNSLQANNGENAVEVFKANHVDLILMDVQMPVMNGFDASQRIKEL
LUXN_VIBHA      ---VLIVDDKEVQRALVQMYLNQLGVNSLQANNGENAVEVFKANHVDLILMDVQMPVMNGFDASQRIKEL
CHEY_ENTCL      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRDA
CHEB_SHEFN      --KVLVVDDSSFFRRRVSEIVNQDPEVVAVAVNGKEAVEMAAKLKPQVITMDIEMPVMDGITAVREIMAN
NTRC_AZOBR      ---ILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDENGLDLIPRIKKI
CHEV_BACSU      -KKLIIVEDSPLLMRLLQDELKEAGYNIASFENGKEAMNLAENETDDMIITDIEMPKMDGHRLTKLLKEK
CHEB_PYRAB      ------------------------------ARDGIEAIEMVQKCRPDVVTLDVEMPRMNGLDALRVIMKK
CHEB4_BURTA     ------------------------------ATDGAQAVDFCVAQPPDLVLMDLVMPRIDGVSATRSIMER
CHEB1_PSEPU     --KVLVVDDSGFFRRRVSEIADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQR
CHEB1_PSEPK     --KVLVVDDSGFFRRRVSEIADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQR
ARR18_ARATH     ----------------------------------------------DLVISDVEMPDTDGFKLLEIGLEM
NTRC_RHOCA      ---VLVADDDRTIRTVLTQALTRAGCKVHATASLMTLMRWVEEGKGDLVISDVVMPDGNGLALARIARER
DHKF_DICDI      --RILLVDDNAVNRKVVKLQLKKLGYDCDTATNGFEGFEMQKKDNYELIFMDLNMPLCDGSMASKLIRSH
DHKA_DICDI      -KKALIVEDNELNRKVLAQLFKKIDWTISFAENGREALITGER-CFDIVFMDCQMPVLDGFQTTKIIRSK
CHEB_TRIEI      ------------------------------APSGQIALAKIPQVNPDLIILDVEMPEIDGLETLKRIRQT
CHEB3_SYNWW     MIKVLIADDSALMRKMLKQISDPEIQVVGAARDGEDVVIKAREYRPDVVTMDVNMPKQDGITALQYIVNE
CHEB1_PSEAE     --KVLVVDDSGFFRRRVSEILSADGQVVGTGTNGREAIEQALALRPDVITMDYEMPLMDGITAVRNIMQR
CHEB1_PSE14     ---VLLVDDSAVVRQVLVAILNDTPHVMGAATDPIFAMAKLAQEWPDVIVLDVEMPRMDGITFLKIMSER
DCTR_RHOCA      -----IVDDEESLRDSLGFLFASRGIATRTWAAGADLLAEWPLADCGCLILDVRMEGMSGPQLLDALQAR
CHEY_SALTY      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRAD
CHEY_SALTI      --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRAD
CHEB_NOSP7      ------------------------------ARDGTEAVARCARDTPDLILMDLFMPVMDGVEATRQIMKQ
CHEB3_SHEON     MIKVAIVDDSAVVRQVLSSMLENQPTLLGCARDPLFALKLFEQQWPDVIILDIEMPRMDGITFLKVMAEK
CHEB3_RHOPB     -------------------------------------------EIPDVIILDIEMPRMDGITFLRIMAQR
CHEB2_METAC     --RALVVDDSALIRKVLSDILNEDPKVVGTAVNGKDGLEKVIKLRPDVVLLDNVMPVLDGLTLARIMKEQ
CHEB1_PSEU2     ---VLLVDDSAVVRQVLVAILNDTPHVMGAASDPIFAMSKLAQEWPDVIVLDVEMPRMDGITFLKIMSER
CHEB1_ANADE     --RILVVDDSAVVRMALSQILGRAGLEVETAIDPLVAMDKMRRARPDAIVLDIEMPRMDGLT--------
Y2151_LEPIN     --QVLIAENSRFQAKQLAQILESEGYVIGFAENGKELVLYDEHRLVDLITLDLNLPVMDGYATFFEIKGK
Y1769_LEPIC     --QVLIAENSRFQAKQLAQILESEGYVIGFAENGKELVLYDEHRLVDLITLDLNLPVMDGYATFFEIKGK
LYTR_STRA5      --KILILDDEQELSFLVEHSQEVDNPEIFQAEDISEAEKILFRQQIDLIFLDISLSEENGFTLANQLSQL
LYTR_STRA3      --KILILDDEQELSFLVEHSQEVDNPEIFQAEDISEAEKILFRQQIDLIFLDISLSEENGFTLANQLSQL
CHEB_NITWN      --RVMVVDDSVVIRGLISRWAEPDMMVAASLRTGRDAVSQVERADPDVVVLDIEMPELDGISALLLAKKR
CHEB_METBU      MIKTLVVDDSALMRRAIRDMSADDIEVIGTAKNGKEAVENTNKLKPEVIVMDVNMPIMDGLAAVKAIM-K
CHEB_MARMM      --------EEDSDLTLIGS-----------AVDGEQGLRKAEELKPDLIVLDVEMPKMDGXXXXXXXXXX
CHEB5_GEOMG     --RVLVVDDSSFMRMVIRSVLDPAIEVIAVAMDGVEGVEKALALRPDLITMDIEMPRLDGISALK-----
CHEB2_PSEPF     --KVLVVDDSGFFRRRVSEIADPSIQVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQR
ARR2_ARATH      --RVLVVDDDPTCLMILERMLMTCLYRVTKCNESALSLLRKNKNGFDIVISDVHMPDMDGF---KLLEHV
ARR22_ARATH     ---VLIVDDDPLNRRLHEMIIKTIGGISQTAKNGEEAVILRDGEASDLILMDKEMPERDGVSTTKKLREM
ARR1_ARATH      --RVLVVDDDPTCLMILERMLRTCLYEVTKCNEMALSLLRKNKHGFDIVISDVHMPDMDGF---KLLEHV
YXJL_BACSU      ------------------TVSGEAG-------DGHDIIALAKQTKPDVILMDVQMPRCSGIEAAKDIMSA
YFIK_BACSU      MIKIIITDDQDIVREGLASLLQEELDVIATARNGQEAFEKAKELEPDIVLMDIRMPVSNGVEGTKLITSS
Y3287_YERPE     MLRVIIVDDEQPAREDLRERLNEEHGIEIVAENALEAIPAIQRLQPDVVFLDIQMPRINGLELASMLNPE
PGTA_SALTY      -----------------------------------------------IVLSDVCMPGCSGIDLMTLFHQD
CHEB_PYRKO      --RVMVVDDSAFMRRILRDLESDPDIEVCCARDGIEAIEKVKTEKPDVITLDIEMPRMNGLDALKFIMSK
CHEB3_RHORT     MTKVLIVDDSALMRRLKEILEVHGGFEVMVARNGIEALAGLESFDPDVITLDINMPEMDGLTLSRIMATK
CHEB3_PSEU2     --KVLVVDDSGFFRRRVTELSSDPNIVVVTATNGKEAIEQALALKPDVITMDYEMPMMDGITAVRHIMQR
CHEB2_PSESM     ---VLLVDDSAVVRQVLVAILNETPHVMAAASDPIFAMGKLAHEWPDVIVLDVEMPRMDGITFLKIMSER
CHEB2_PSEF5     --KVLVVDDSGFFRRRVSELSADSNIVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQR
CHEB2_PSE14     --KVLVVDDSGFFRRRVTELSSDPNIVVVTATNGKEAIEQALALKPDVITMDYEMPMMDGITAVRHIMQR
CHEB1_PSESM     --KVLVVDDSGFFRRRVTELSSDPNIVVVTATNGKEAIEQALALKPDVITMDYEMPMMDGITAVRHIMQR
TOXR_VIBPA      ----------------------------------------------------------------------
SLN1_YEAST      --KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFLTSKGENYNMIFMDVQMPKVDGLLSTKMIRDL
GACA_PSEU2      MIKVLVVDDHDLVRTGITRMLADIDQVVGQADSGEESLKKARELKPDVVLMDVKMPGIGGLEATRKMLRS
DHKL_DICDI      --KVLVVDDNHINIQILSKMLQTVGCEVDSVLSGADALAKINQDSYDAIFLDIQMPDMDGFQVSRKIRER
CHEB_NITMU      ----------------------------ATAGDGEEAIDALRNHRPDVITMDIHMPKLNGVEATQLIMET
CHEB5_ANADE     --RVLVVDDSALVRELAAVLASDPGIVIGAAGDPYAAVERMRRQAPDVITLDIEMPRMDGLTFLRLMAQH
CHEB2_RHIL3     --RVLIIDDSASIRQLTHVLEQDPDIEIAVASDPFMAARKLQEEIPDVITLDVEMPRMDGITFLRLMSQR
TOXR_VIBCH      ----------------------------------------------------------------------
PRR73_ORYSJ     --RVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEQNHIDLVLTEVVMPRLSGIGLLSKITSH
PRR73_ORYSI     --RVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEQNHIDLVLTEVVMPRLSGIGLLSKITSH
MAK1_SCHPO      ---VLLAEDNIINIKVISRYLERIGVKFKVTMDGLQCVEEWKREKPNLILMDLQMPVMDGYQACNEIRKY
DEGU_BREBE      ----------------------------ADGEDGENAVELVEKYNPDVILMDINMPKVNGVEATRDLIQR
CHEB_RHILO      ------------------------------ATNGREAVEVCRRDLPDLILMDLAMPVMDGVATRRIMAET
CHEB3_CHRVO     --RVVVVDDSALVRSLLTAIVNEAPEVVATASDPIIAREKIRETSPDVVTLDVEMPRMDGLEFLRLMRLR
CHEB3_ANADE     MIRVLVVEDMPTARQLVGILSADPELVVGQASDGAEALALVRALRPDAITMDVMMMPVDGIATAQIMAER
CHEB2_CARHZ     --RVLIVDDSALMRKYLREILEQDPEVIAVARNGREAVEKALELSPDVITMDINMPEMDGLTAIQYIMLH
CHEB1_SHESR     --KVLVVDDSSFFRRRVSEIVNQDPEVIATASNGAEAVKMAAELNPQVITMDIEMPVMDGITA---VREI
CHEB1_SHESM     --KVLVVDDSSFFRRRVSEIVNQDPEVIATASNGAEAVKMAAELNPQVITMDIEMPVMDGITA---VREI
APRR9_ARATH     --RVLLVESDYSTRQIITALLRKCCYKVVAVSDGLAAWEVLKEKSHDLILTELDLPSISGFALLALVMEH
NTRXL_RICBR     ---------------IIAAILKDEGFNPKVAANSTQALKILAEKPVSAVILDIWLQEMDGLGILEVIKKR
DHKC_DICDI      --KIMILDDNPVSLKLMQRILESRGFECYPFDCSEKAVAQLDQVNPAIIFMDCEMPKMNGFECTQLIRKR
Y693_VIBCH      MLSALLIDDXXXXXXXXXXXXXXSGQVIGQASNAIEGLKKINQLKPDVVFLDIQMPQISGIELLSMLDPE
Y503_VIBVU      MLTALVIDDEPFAREELTDLLSETGDVIGDAANAIVGLKKINELKPDVVFLDIQMPQVTGIELLGMMDPD
DEGU_BACSU      ----------------------------AEGDDGDEAARIVEHYHPDVVIMDINMPNVNGVEATKQLVEL
DCUR_ECOL6      MINVLIIDDDAMVAELVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNA
CHEB1_XANOR     -----MVDDSAVVRQVLVNVLNDAAEVIATAADPLLAIEKMRKQWPDVIVLDVEMPRMDGITFLRIMSER
CHEB1_XANOM     -----MVDDSAVVRQVLVNVLNDAAEVIATAADPLLAIEKMRKQWPDVIVLDVEMPRMDGITFLRIMSER
CHEB1_GEOSL     --RVLVVDDSSFMRMVIRSVLDPAIEVVGIAVDGMEGVEKALALKPDLITMDIEMPRLDGISALKQVMAK
CHEB1_CHRVO     ---VLIVDDSAVVREVLSQMLSSAPEVLGAAPDPIFAMTRMKQRWPDVIVLDIEMPRMDGLTFLRIMDER
CHEB1_ACIBL     --RVLIVDDSRSLLRQILAQEADLEVA-GVAANGHIALRMLDQLAPDVVTLDIEMPEMNGXXXXXXXXXX
YESN_BACSU      MYKILLADDERII---LDGMAGIIEWEIGKAQNGHEAYEKIVHKQPHIVITDVKMPGMDGLELIKKVSAV
LUXQ_VIBPA      --KVLLVEDNHTNAFILKAFCTKYKMQVDWAKDGLEAMEFLKDHSYDLILMDNQLPHLGGIETTKEIRQN
LUXQ_VIBHA      --KVLLVEDNHTNAFILQAFCKKYKMQVDWAKDGLDAMELLSDTTYDLILMDNQLPHLGGIETTHEIRQN
GACA_PSEAE      MIKVLVVDDHDLVRTGITRMLADIEQVVGQADCGEDCLKLARELKPDVVLMDVKMPGIGGLATRKLLRSQ
DHKE_DICDI      -RNALIVDDTELNRKVLAQLLRRMDWSVSFAENGIEALKITSERCFDIIFMDCQMPILDGFETTKXXXXX
CHEB4_HAHCH     --KVLVVDDSGFFRRRLCEILSSISDVVGTASNGREGVEMALKLKPDVITMDYEMPVMDGITAVKIMRVQ
CHEB2_PHOPR     --KVLVVDDSSFFRRRVSEIADPRLEVIGNAVNGKEAVELVKKLQPDVITMDIEMPVMDGITAVREIM-K
CHEB2_METMA     --RALIVDDSALIRKVLSDILNDPKIAIGTAINGEDGLEKVRKLKPDVVLLDNIMPVLDGLKTLSHIMEE
CHEB2_BRAJA     --RVMIVDDSVVIRGLISRWVGDMEVA-ASLRTGLEAVNQLERINPDVAVLDIEMPELDGISALLLAKKR
CHEB1_VIBVY     --KVLVVDDSSFFRRRVSEIAESRLEVIDVAVNGKEAVEKAKRLKPDVITMDIEMPVMDGISAVREIM-A
CHEB1_VIBVU     --KVLVVDDSSFFRRRVSEIAESRLEVIDVAVNGKEAVEKAKRLKPDVITMDIEMPVMDGISAVREIM-A
CHEB4_GEOMG     MVKVLIVDDSASVRLLQGLLAADPGIVIXXXXXXXXXXXXXXRLNPDVVTMDIYMPRMNGLLATRRIMET
CHEB2_SHESR     --KVLVVDDSALIRNLLGKMADSELSLVGMAADAYMAKDMVNQHRPDVITLDIEMPKVDGLTFLRLMKAR
CHEB2_SHESM     --KVLVVDDSALIRNLLGQMADSELSLVGMAADAYMAKDMVNQHRPDVITLDIEMPKVDGLTFLRLMKAR
CHEB1_VIBPA     --KVLVVDDSSFFRRRVSEIINSESRVIDVAVNGREAVEKAKALKPDVITMDIEMPVMDGITAVREIMAA
CHEB1_BURS3     ------------------------------ATDGAQAVELCAAQPPDVVLMDLIMPKFDGIEATRRIMRS
FIMZ_SALTY      ----------------------------------------------DLVILDIELPGTDGFTLLKRIKSI
DCUR_SHIFL      MINVLIIDDDAMVAELVAQIPGFQCCGTASTLEKAKEIIFNSDAPIDLILLDIYMQKENGLDLLPVLHNA
DCUR_ECOLI      MINVLIIDDDAMVAELVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNA
DCUR_ECO57      MINVLIIDDDAMVAELVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNA
CHEB_THICR      --KVLIVDDSALVRQMLQEMSDPEIEVVGTASDPYDAREKVKQLHPDVLTLDVEMPRMDGVTFLKLMRLH
CHEB_THETN      --RVLVVDDSAFMRRCLKDILENEEEVIDTARDGNEAVKKAVELRPDVITLDINMPVMDGLTALQYIMSL
CHEB_METBF      --RALIVDDSALIRKLLSDILSQIGTAF----NGKDGLEKIKKLRPDVVLLDNIMPVFDGLKTLAWIVKE
CHEB_IDILO      --KVLVVDDSAFFRRRVTEILEDNTNVIGSANNGEEAVEQSRTLKPDVITMDIEMPVMNGIDAVKAIMSS
CHEB2_RALME     ------------------------------AGDGEEAVRMAATQTPDLILMDLLMPVMDGVATRRIMAE-
CHEB1_SHEON     --KVLVVDDSSFFRRRVSEIVNQDPEVIATASNGAEAVKMTADLNPQVITMDIEMPVMDGITA---VREI
YCCH_BACSU      MVKVGLVDDYRDLEKLEAIVSRMQDVEIVFSTDSAKEAYRRVKNGDDLLLADIEMPHMSGYELADLIKSH
Y538_VIBPA      MLTALVIDDEQFAREELAELLDETGQVEVVASNAILGLKKINELKPDVVFLDIQMPQVTGIELLGMLDPE
Y2823_SHEON     ----LIVDDELAREELADSLSQEADIEIGQCSNAIEALQTITKEKPQLVFLDIQMPRISGMELIAML-DP
PDE2_DICDI      --RILVADDDDVQRKILNNLLKKFHYNVTLVPNGAWEYINKGQQKYDLVLTDVMMPHITGFDLLQRINDH
LIAR_BACSU      MIRVLLIDDHEMVRMGLAAFAQPDIEVIGEASDGSEGVRLAVELSPDVILMDLVMEGMDGIATKQICRE-
CHEB_SALRD      MIRVLVVDDSLVMRKAISRIQXXXXXXXXXXXNGEAGVEKARRLEPDVVTMDVEMPKMNGIEAVRHIMEA
CHEB_CHRSD      --KVLCVDDSALIRDLMSKIIDSQPEVVATAPDPLVARDLIKRTNPDVLTLDVEMPRMDGLDFLRLMRLR
CHEB_BACSU      MIRVLVVDDSAFMRKMISDFLTEEKQVIGTARNGEEALKKIELLKPDVITLDVEMPVMNGTDTLRKIIEI
CHEB3_VIBCH     --KILVVDDSALMRTTISDILQNIPNAIKTARDGMDAIDKVMKWQPDVMTLDINMPNMDGLTLTQIMVER
CHEB3_GEOMG     --KVLIVDDSAVVRQTMADILASDPHIEVMAP-AADPFIAAERQVPDVITLDVEMPRMDGITFLKIMSQH
CHEB2_XANCP     -----MVVDDSAVVRLVGVLNEAPGIVIATAADPLLAIEKMRQQWPDVIVLDVEMPRMDGITFLRIMSER
CHEB1_XANC8     -----MVVDDSAVVRLVGVLNEAPGIVIATAADPLLAIEKMRQQWPDVIVLDVEMPRMDGITFLRIMSER
CHEB1_VIBCH     --KVLVVDDSSFFRRRVSEIINSESRVIDVAVNGKEAVEKAARLKPDVITMDIEMPVMDGISAVR-----
APRR1_ARATH     --RILLCDNDSTSLGEVFTLLSECSYQVTAVKSARQVIDALNAEGPDIILAEIDLPMAKGMKMLRITRDK
CHEB_NITHX      --RVMVVDDSVVIRGLISRWAEPDMVVAASLRTGLDAVNQVERANPDVVVLDIEMPELDGISALLLAKKR
CHEB_METMP      --KVLIVDDSAFMRKVLEDISDDEIEVVATAKDGKEAFELVKKLEPNVITMDVEMPIMNGIDATKQIMAY
CHEB3_PSEPK     ------------------------------ASNGAEAVQRCTEQLPDLILMDLIMPVMDGVATRRIMAET
CHEB2_XANC5     -----MVVDDSAVVRLVGVLNDAPGIVIATAADPLLAIEKMRQHWPDVIVLDVEMPRMDGITFLRIMSER
CHEB2_XANAC     -----MVVDDSAVVRLVGVLNDAPGIVIATAADPLLAIEKMRQHWPDVIVLDVEMPRMDGITFLRIMSER
CHEB2_PSEAE     ---VLVVDDSALIRSLLKEIADPELRLVGCAPDAFVARDLIKQHAPDVISLDVEMPRMDGLTFLKLMKAR
CHEB2_AZOBR     --RVMVVDDSAVIRGLLTALEGDTEIVVASVGDGQMAVNALQRNSLDVIVLDIEMPVMDGLTAIPKLLAV
CHEB1_PSEPF     MKIAIVNDMPLAVEALRRALAFEPAHQVVWASNGAEAVRLCAENTPDLILMDLIMPVMDGVATRRIMAES
CHEB1_PSEF5     MKIAIVNDMPMAVEALRRALAFDPSHEVVWATNGAEAVKYCAELTPDLILMDLIMPVMDGVATRRIMAES
CHEB1_HAHCH     --------------------------------------------SPDVITLDVEMPRMDGLTFLRLMRLR
CHEB1_BORA1     MRVAIVNDMPLAVEALRRSLAHDPELSLAWASDGLQAVRRCAADLPDVILMDLMMPVMNGVEATRLIMAE
YEHT_SHIFL      MIKVLIVDDEPLARENLRIFLQEQSDIEIVGENAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPE
YEHT_ECOLI      MIKVLIVDDEPLARENLRVFLQEQSDIEIVGENAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPE
YEHT_ECOL6      MIKVLIVDDEPLARENLRVFLQEQSDIEIVGENAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPE
YEHT_ECO57      MIKVLIVDDEPLARENLRVFLQEQSDIEIVGENAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPE
CHEB3_PSEAE     ------------------------------ASNGAEAVTQCAADTPDVVLMDLLMPVMDGVATRRIMAES
CHEB2_CHRVO     --KVLIVDDSAVVRQVLSQVAASGIEVMDVANDPYMAMDKMKARWPDVIVLDVEMPRMDGITFLKLMASR
CHEB_PSEA6      --KILVVDDSIFFRRRVKEILEQSLQVIGEARNGQEAIEMVATLNPDVVTMDVEMPIMDGITAVKKIMAR
CHEB_GEOKA      --KVLVVDDSAFMRKWISDFLSEHPRVIGTARNGREALEKIAALRPDVVTLDVEMPVMNGLETLRIMRDH
CHEB2_XANOR     --RVLIVDDSAVVRQMLTELSRDAG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB2_XANOM     --RVLIVDDSAVVRQMLTELSRDAG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB2_SHEON     --KVLVVDDSTLIRSLLGKMISDPELSLVMAADAYMAKDMVNQFRPDVITLDIEMPKVDGLTFLRLMKAR
CHEB2_SHEDO     ---------------------------------------------PDVIVLDIEMPRMDGVTFLRIMAER
CHEB2_RHOPB     ----LLIADDSALVRLEGVFLEEGDFEIRTARTGLEALDMVRAFDPHVVTLDVQMPGMDGLTCLRIMLE-
CHEB2_GEOSL     --KVLIVDDSAVVRQTMADILASDPQIEVMAT-AADPFIAAERDVPDVITLDVEMPRMDGITFLKIMSQH
CHEB2_DESDG     --KVLIVDDSALVRQTLTDIADPELEVVGTASDPFVAVKRMETVVPDVILLDVAMPRMDGLTFLRIMSQH
CHEB2_BURCA     ------------------------------ATDGPQAVELCAAQPPDIVLMDLIMPKFDGIEATRRIMRP
CHEB1_XANC5     --RVLIVDDSAVVRQMLTELSRDAG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB1_XANAC     --RVLIVDDSAVVRQMLTELSRDAG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB1_RALEJ     ------------------------------AGDGEQAVQLAASHTPDVILMDLLMPVMDGVATRRIM--A
ARR21_ARATH     ---VMVVDDDHVFLDIMSRMLQHSKYRVIAVDDPKKALLKIQRDNIDLIITDYYMPGMNGLQLKKQITQE
MALR_BACSU      ----------------------------------------------DLILLDIYMPGKNGLELLTELRAQ
LYTT_BACAN      MLKVLVVDDEDELKYLLEEIIGEADCV----EDALEELM---KNKPDIVFLDIQLSDDNGFEIANILKKM
CHEB_METFK      --KVLIIDDSALIRSLLTEIINQQPEVVGTAPDPLIAREMIKQKNPDVLTLDVEMPKMDGLDFLRLMRLR
CHEB3_PSE14     MKIAIVNDMPMAIEALRRALAFEPAHQIIWASNGADAVQRCVEQTPDLILMDLIMPVMDGVATRRIMAE-
CHEB2_RHOCS     --RVMVVDDSAVIRGLITALESDPEIVVASVANGQMAINTLSRQPIDVIVLDIEMPVLDGLSALPHLLQA
CHEB2_PSEU2     MKIAIVNDMPMAIEALRRALAFEPAHQIIWASNGADAVQRCVEQTPDLILMDLIMPVMDGVATRRIMAE-
CHEB1_RALME     --KVLCVDDSALIRSLMSEIINSQPEVVGTAPDPLVARDLIKRVNPDVLTLDVEMPRMDGLDFLRLMRLR
CHEB1_CARHZ     --KLFIVDDSALIRRLKTSLAWPEIQIVGEAENGQEALKKIPLVKPDVVTLDLEMPVLDGLSTLKEL-NK
LYTT_BACCR      MLKVLVVDDEDELKYLLEEIIGEADCV----EDALEELM---QSRPDIVFLDIQLSDDNGFEIANILKKM
CHEB_VIBF1      --KVLVVDDSSFFRRRVSEIINSDPRVIDVAVNGKEAVEKAKSLKPDVITMDIEMPVMDGISAVREIMKA
CHEB_THEMA      ----VLVVDDSAFMRMVLKDIIDSQKVVGFAKDGLEAVEKAIELKPDVITMDIEMPNLNGIEALKLIMKK
CHEB2_RALEJ     --KVLCVDDSALIRSLMTEIINSQPEVVGTAPDPLVAREMIKQLNPDVLTLDVEMPRMDGLDFLRLMRLR
CHEB1_BURCA     --KVLCVDDSALIRSLMTEIINSQPTVVATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
RRF1_DESVH      --RILVVQEDPDIAAYLVSLFRQAGYKADAATEGPDAVEMVQASRPDVVFLDLALPQRWG----------
MAK2_SCHPO      -KKYALIAEDNLIARLLTKQLSNLGFQVHAAVDGVELVKMYEAKQYSVIFADYHMPIRDGAEAVMDIRER
LYTT_ENTFA      ---VLIVDDEPLAREELSYLVSQHPQSVAEADSVAEAMEEMMDQKPDLLFLDIHLTDESGFDLAEKLTHL
LYTR_STRMU      ------------------------------AEDISSAEKILFRQQIDLIFLDISLSEENGFTLANQLEQL
CHEB_ROSDO      -KKVLIVDDSRVIRMWLRTLASDRRLVVGEASDAVEARDYIRANPADVITLDIEMPGMSGLELTRLMRAR
CHEB_MOOTA      --RVLVVDDSAFSRRLVTDIADPDIQVVGYARNGREALEKVASLQPRVVTLDQEMPVMDGLTTLTALM-A
CHEB_DESHY      ------------------------------ARDGKEGIEKLQALRPQVVTMDIEMPQIDGLQALEIMRWQ
CHEB_BORPE      --KVLCVDDSALVRGLMTEIINSHPEVVATAPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB_BORPA      --KVLCVDDSALVRGLMTEIINSHPEVVATAPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB_BORBR      --KVLCVDDSALVRGLMTEIINSHPEVVATAPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB3_PSESM     MKIAIVNDMPMAIEALRRALAFEPAHQVIWAANGADAVQRSIEQTPDLILMDLIMPVMDGVATRRIMAE-
CHEB3_BURS3     --KVLCVDDSALIRSLMTEIINSQPTVCATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB2_MAGSA     --KVLIVEDSLVVRELLKHIIGDERFEVMAAVTSAEDLEMLETQQPDVISLDIRLPGMNGLATLKIMSRR
CHEB1_RHOPB     --RVMVVDDSVVIRGLISRWAEPDMVVAASLRTGLDAVNQVERVKPDVALLDIEMPELDGISALLLAKQR
CHEB1_DESVH     --RVLIVDDSALVRQLADLLSADPGIVVGTASDPFVAAKRMEAVVPDVILLDIEMPRMDGLTFLRIMTQH
CHEB1_BURTA     --KVLCVDDSALIRSLMTEIINSQPEVCATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB1_BURPS     --KVLCVDDSALIRSLMTEIINSQPEVCATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB1_BURP1     --KVLCVDDSALIRSLMTEIINSQPEVCATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB1_BURMA     --KVLCVDDSALIRSLMTEIINSQPEVCATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
LUXO_VIBCH      ---------------------------------------------------------MTGMDVLYAVKEK
CHEB_RHOPS      --RVMIVDDSVVIRGLISRWAEPDMVVAASLRTGLDAVNQVERIKPDVAVLDIEMPELDGISALLLAKKR
CHEB_NITEU      MKKILIIDDSALIRKLLTEIARPDMEVIGAAPDPIVAREMIRTLNPDVLTLDVEMPKMDGLEFLKLMRLR
CHEB_ENTCL      --RVLSVDDSALMRQIMTEIINSHSEMVATAPDPLVARDLIKKYNPDVLTLDVEMPRMDGIDFLKLMRLR
CHEB_BURXL      --KVLCVDDSALIRSLMTEIINGQPTVVATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLKLMRLR
CHEB1_METAC     --RTLIVDDSAFMRMAIRSMLASSPDIKIVGDNGKEAVEKAKSLHPDVVIMDVNMPVMDGLTAVKTIMNT
CCDB_BACSU      MTRVLVVDDAKFMRVKIREILEEANYXXXXXXXXXXXXXXLYKKLPDLVTMDITMPVKNGIKALRDILTF
YEHT_SALTY      MIKVLIVDDE-PLARRILLQGQDDIEIVGECANAVEAIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPE
YEHT_SALTI      MIKVLIVDDE-PLARRILLQGQDDIEIVGECANAVEAIGAVHKLRPDVLFLDIQMPRISGLEIVGMLDPE
ETR1_CUCSA      --KVLVMDDNGVSRSVTKGLLVHLGCEVTTAGSIEEFLRVVSQEHK-VVFMDICTPGVDGYELAIRIREK
ETR1_CUCMR      --KVLVMDDNGVSRSVTKGLLVHLGCEVTTAGSIEEFLRVVSQEHK-VVFMDICTPGVDGYELAIRIREK
CHEB4_ANADE     ----VLVVDDSAVVRNVQELSADPGIVVGTAPDPFAARDLILERAPDVITLDVEMPRMDGITFLKIMRYR
CHEB2_XANC8     --RVLIVDDSAVVRQMLTELSRDPG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB2_SYNWW     --KTLIVDDSETLAR--GISRDPAIEVVATAVDAFMARDMIIKYKPDVMTLDVEMPRMSGIEFLRRLMPQ
CHEB2_RHOPA     --RVMIVDDSVVIRGLISRWAEPDMVVAASLRTGLDAVNQLERVKPDVAVLDIEMPELDGISALLLAKKR
CHEB2_BURS3     ------------------------------ATDGDEAVDFCVAHPPDLVLMDLVMPKVDGVAATRRIMAR
CHEB1_XANCP     --RVLIVDDSAVVRQMLTELSRDPG--IEVVGSAADPLLARERLNPDVITLDVEMPRMDGLVFLNLMRLR
CHEB1_MYXXD     ---VLVIDDSAHNRRTLSTMLESEPDVRVVAADGEEGXXXXXXXXXXXXXXXXEMPKLGGYTFLRLLMRT
UVRY_SHIFL      MINVLLVDDHEGIRRILEDIKGIK--VVGEASCGEDAVKWCRTNAVDVVLMDMSMPGIGGLEATRKIARS
UVRY_ECOLI      MINVLLVDDHEGIRRILEDIKGIK--VVGEASCGEDAVKWCRTNAVDVVLMDMSMPGIGGLEATRKIARS
UVRY_ECOL6      MINVLLVDDHEGIRRILEDIKGIK--VVGEASCGEDAVKWCRANAVDVVLMDMSMPGIGGLEATRKIARS
UVRY_ECO57      MINVLLVDDHEGIRRILEDIKGIK--VVGEASCGEDAVKWCRANAVDVVLMDMSMPGIGGLEATRKIARS
CHEB1_SHEDO     --QVLVVDDSSFFRRRVSEIVNQDPEVIGVAVNGKEAVKMAAELKPHVITMDIEMPVMDGITAVR-----
CHEB1_METMA     MIRTLIVDDSAFMRMAIRSMAGDAC-------NGKEAVDKSKSLHPDIIIMDVNMPVMDGLTAVKTIMST


                         .         .         *         .         .         .         .:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
RESD_BACSU      KAT-PIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRASQTSYFNAPTKNVLVFSHLS
PHOP_BACSU      KLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRSEIAAPSSEMKNDEME-GQIV
YCBL_BACSU      S-NIPVLMISAKDGDVDKALGLGFGADDYIAKPFSMIELTARVKAAIRRATQYSAEEPAVNKVIRIHQLA
YCF27_CYAPA     S-DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSLLRRTNPTLSTTSTNGENLQIGFLK
Y851_SYNP2      GNTIPILVLSAKASETDRVLGLEVGADDYLTKPFSLRELVARCRALLRRQQFIRS--TPKNSVRQFKDIS
YCF27_PORAE     S-DVPIIMLTALSDVSDRITGLELGADDYIVKPFSPKELEARIRSVLRRVDKASSNNLPNSGIINIGFLK
WALR_STAHJ      -FEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHSQPAQEVSGTTNEITIKDIV
WALR_STAES      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHSQPAQEVSGATNEITIKDIV
WALR_STAEQ      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHSQPAQEVSGATNEITIKDIV
OMPR_SHIFL      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
OMPR_SALTY      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
OMPR_SALTI      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
OMPR_ECOLI      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
OMPR_ECOL6      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
OMPR_ECO57      SNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVLRRQA-NELPGAPSQEVIAFGKFK
YCLJ_BACSU      S-TVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYKATGKAVIDE-DMIETECFT
WALR_STAS1      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHSQPAQEVNDASNEITIKDIV
YCF27_GUITH     DSDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRAVLRRTNKAASSHLTTSGIINFNFLT
WALR_STAAW      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAU      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAT      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAS      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAR      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAN      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAM      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAE      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAC      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAAB      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAA9      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAA8      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAA3      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAA2      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
WALR_STAA1      -YEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHY--SQPAQDTGNVTNEKDIV
YYCF_BACSU      -YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQTTAPAEEEPSSNEIHIGSLV
SRRA_STAAW      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAU      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAS      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAR      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAN      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAM      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAAC      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
SRRA_STAA8      KQT-PIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTSTTVEQSEPHADVIEFKHLE
YCF27_PORYE     S-DVPIIMLTALGEVCDRITGLEIGADDYVVKPFSPKELEARIRSVLRRADKITTSLVPNSGIISIGFLK
YCF27_PORPU     S-DVPIIMLTALGEVCDRITGLEIGADDYVVKPFSPKELEARIRSVLRRADKITTNLVPNSGIISIGFLK
YCF27_GALSU     S-DIPIIMLTALGDVTDRITGLELGADDYVVKPFSPKELEARIRCVLRRVKFYFSNTFTNSGIINIGFLK
REGX3_MYCS2     S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRXXXXXXXXXXXX-VLEAGPVR
SPHR_SYNE7      GVTVPILMLSAKDTETDRVVGLEIGADDYLTKPFGTRELVARCRALLRRSQNQPAETPA---VLRYEGLK
REGX3_MYCTU     S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDSEMSD--GVLESGPVR
REGX3_MYCBO     S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDSEMSD--GVLESGPVR
YCF27_CYACA     S-DIPIIMLTALEDVLDKVTGLELGADDYVIKPFSPRELEARIQSILRRIQTRNAKLKPYDNIFKTGSLN
AFSQ1_STRCO     TDQLPIILLTARNDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESTDSASFGSL------V
VANR_ENTFC      H-TYPIIMLTGKDTEVDKITGLTIGADDYITKPFRPLELIARVKAQLRRYKKFSGVKEQNENVIVHSGLV
YVRH_BACSU      S-DAPIFFLTARSSDADKLSGFAVGADDYITKPFNPLELAARIRAHLKRTYQSKETSSNQTYTYDYFTFS
ARLR_STAS1      QTT-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAMLRR--------QPQKNLXXXXXXX
IRLR_BURPS      AHSTPVLFLTARDDVGDRVKGLELGADDYVVKPFDFVELVARVRSILRRGQ------ARESTVLRIADLE
YKOG_BACSU      DSQTPVILLTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAALRQNGTKTEDI---GTFLTYDDLR
YRKP_BACSU      S-NVPILFLTARSSTLDKTEGLLAGGDDYMTKPFSEEELHARVIAQLRRYTIYQEKKEQEETFLIGGKLR
REGX3_MYCLE     S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDSEISD--GVLESGPLR
CZCR_RALME      SET-PVLFLTALDDVADRVRGFELGADDYLVKPFAFAELLARIRRCLRQST---SKESERLRIADLDIDV
CSEB_STRAW      S-TVPVIMLSARADSIDVVLGLEAGADDYVTKPFDGXXXXXXXXXXXXXFGHASGPSAPDGGVLTFGELE
ARLR_STAEQ      XXXXXXXXX-AKSETYDKVAGLDYGADDYIVKPFDIEELLARIRAVLRRQ--------PDKDVLDINGII
ARLR_STAES      XXXXXXXXX-AKSETYDKVAGLDYGADDYIVKPFDIEELLARIRAVLRRQ--------PDKDVLDINGII
MPRA_MYCSS      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTSPDEGPDSPALTFLD---LT
MPRA_MYCSK      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTSPDEGPDSPALTFLD---LT
MPRA_MYCSJ      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTSPDEGPDSPALTFLD---LT
COPR_PSESM      GQPVPVLFLTARDGVDDRVKGLELGADDYLVKPFALSELLARVRTLLRRGSSLQVQTS-----LQIGDLQ
ARLR_STAHJ      QST-PIIIITAKSDTYDKVTGLDYGADDYIVKPFEIEELFARIRAVLRRQ--------PQKXXXXXXXXX
YEDW_ECOLI      KQT-PVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNSTLEISG-------LR
CUSR_ECOLI      NKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRG--AAVIIESQ---FQVADLM
CUSR_ECOL6      NKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRG--AAVIIESQ---FQVADLM
CUSR_ECO57      NKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRG--AAVIIESQ---FQVADLM
PCOR_ECOLX      GHEEPVLFLTAKDNVRDKVKGLELGADDYLIKPFDFTEXXXXXXXXXXXXXSQAATVCTIADM------T
ARLR_STAAW      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAAS      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAAR      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAAM      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAAC      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAAB      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAA8      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
ARLR_STAA3      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFDXXXXXXXXXXXXXXQ--------PQKDIIDVNGIT
MTRA_MYCTU      GV--PIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKEXXXXXXXXXXXNDDEPAEMLSIADV------E
MTRA_MYCPA      GV--PIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKEXXXXXXXXXXXNDDEPAEMLSIADV------E
MTRA_MYCBO      GV--PIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKEXXXXXXXXXXXNDDEPAEMLSIADV------E
MTRA_MYCLE      GV--PIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKEXXXXXXXXXXXNDDEPAEMLSIADV------D
MPRA_MYCBP      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXTKPEDAAESMAMRFSDL-----T
MPRA_MYCBO      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXTKPEDAAESMAMRFSDL-----T
PHOB_RHIME      PETLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAMLRRAKPEVLST-----LLRCGDIE
PHOB_KLEPN      AMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE-----EVIEMQGLS
MPRA_MYCUA      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTKLAADSVA-----MTFSDLS
MPRA_MYCS2      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTVSDDSGDSQK---MTFSDLT
MPRA_MYCTU      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXTKPEDAAESMAMRFSDL-----T
MPRA_MYCTA      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXTKPEDAAESMAMRFSDL-----T
HSSR_STAEQ      DYHIPVIMLTARDALSDKERAFLSGTDDYVTKPFEVKELLFRIKAVLRRYQINA------DNELQLGNLI
MPRA_MYCPA      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTK-------PEDDAMTFSDLT
MPRA_MYCA1      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTK-------PEDDAMTFSDLT
GTCR_ANEMI      -YKLPVIILSAKNRDSDKILGLGLGADDFISKPFNPLEAVARIQAQLRRAFEFNEPEAISTQSTTVGRLT
CHVI_RHIME      S-DLPVIFLTSKDEEIDELFGLKMGADDFITKPFSQRLLVERVKXXXXXXXXXXXXXGGTGPAKNAGQLV
SAER_STAAW      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAS      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAR      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAN      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAM      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAE      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAC      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAAB      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAA8      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
SAER_STAA3      KLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMKKYHQPV----EQLSFDELT
VANR_ENTFA      NDT-PILMMTALSDDENQIRAFDAEADDYVTKPFKMRILLKRVEALLRRSGALAKE-------FRVGRLT
PHOB_SHIDY      SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE-----EVIEMQGLS
PHOB_ECOLI      SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE-----EVIEMQGLS
PHOB_ECO57      SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE-----EVIEMQGLS
MPRA_MYCVP      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXXXTTPDDG--AGESAAMTFSDLS
SPAR_BACSU      -VDCPILFLTAKTEEEAIVKGLITGGDDYITKPFGVRELSARVNAHLRR---------ERRDKHQSKRFL
HSSR_STAES      DYHIPVIMLTARDALSDKERAFLSGTDDYVTKPFEVKELLFRIKAVLRRYQINA------DNELQLGNLI
HSSR_STAHJ      DYDLPVIMLTARDALSDKERAFVSGTDDYVTKPFEVKELLFRIQAVLRRYQINSQ------DIIKLGNVT
MPRA_MYCLE      GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFXXXXXXXXXXXXXTKPDDAAESVA-----MSFSDLT
PHOB_SHIFL      SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVE-----EVIKMQGLS
CHVI_RHISN      S-DLPVIFLTSKDEEIDELFGLKMGADDFITKPFSQRLLVERVKAILXXXXXXXXXXXXXXXXLERGQLV
HSSR_STAS1      DFDIPVIMLTARDALSDKEQAYLTGTDDYVTKPFEVKELMFRIKAVLKRYNVNI------NNEVSIGNLT
CREB_ECOLI      HPALPVLFLTARSEEVDRLLGLEIGADDYVAKPFSPREVCARVRTLLRRVKKFSTP----SPVIRIGHFE
HSSR_STAAB      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
CSEB_STRCO      S-TVPVIMLSARADSIDVVLGLEAGADDYVTKPFDXXXXXXXFXXXXXXXXXXXXXXXXXXXVLTFGDLE
HSSR_STAAW      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAT      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAS      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAN      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAM      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAA9      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAA8      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAA3      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAA2      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAA1      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
PHOB_PSEAE      ELTVPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRRTGPGDSE-AP----IEVGGLL
HSSR_STAAE      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAC      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
HSSR_STAAR      DYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINS------NSEMTIGNLT
CIAR_STRR6      GITTPVLIMTAKESLDDKGHGFELGADDYLTKPFYLEELKMRIQALLKRSGKF------NENTLTYGNIV
CIAR_STRPN      GITTPVLIMTAKESLDDKGHGFELGADDYLTKPFYLEELKMRIQALLKRSGKF------NENTLTYGNIV
DLTR_STRA5      GLETPIIFLTAKSQTYDKVNGLDLGADDYITKPFEADELLARIRLRTRQSSLI------RANQLRLGNIR
DLTR_STRA3      GLETPIIFLTAKSQTYDKVNGLDLGADDYITKPFEADELLARIRLRTRQSSLI------RANQLRLGNIR
ARLR_STAAN      QST-PIIIITAKSDTYDKVAGLDYGADDYIVKPFD--------XXXXXXXXXXXXXXQPQKDIIDVNGTL
CHVI_RHIRD      S-DIPVIFLTSKDEEIDELFGLKMGADDFITKPFSQRLLVERVKAILXXXXXTGGTLKPTADTLERGQLA
SILR_SALTY      GKGMPVLLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGNTMITE-----SQLKVADLS
PRRA_MYCTU      DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTA---TSSSETITVGPLE
PRRA_MYCBO      DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXGSTA---TSSSETITVGPLE
PRRA_MYCLE      DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFXXXXXXXXXXXXXXXXXXTA---TSSSETIAVGPLE
RCAC_FREDI      GYTVPILLLTAQDNITAKVQGLDAGADDYVVKPFDPIEXXXXXXXXXXXGSNNPFPLLTWGDLL------
ARCA_SHIFL      A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR-TMNLGTVSEERRSVESYKFE
ARCA_ECOLI      A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR-TMNLGTVSEERRSVESYKFE
ARCA_ECOL6      A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR-TMNLGTVSEERRSVESYKFE
ARCA_ECO57      A-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR-TMNLGTVSEERRSVESYKFE
YVCP_BACSU      S-NAPIIFISARTDELNQVMAIENGGDDYITKPFHLEVVMAKIKSVLRRTYGEYSPSLPQSRIVELGGLT
BAER_ECOLI      FSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCK-------PQRELQQQDALI
BAER_ECOL6      FSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCK-------PQRELQQQDALI
CUTR_STRLI      GMPTRVLMLTASGDVSDRVEGLEIGADDYLPKPFAFSELIARVRALGRRTSVPLPPVLERAGI------K
CUTR_STRCO      GMPTRVLMLTASGDVSDRVEGLEIGADDYLPKPFAFSELIARVRALGRRTSVPLPPVLERAGI------K
SAER_STAES      QLDIPFIYLTAKTQEHDTIYALTLGADDYIKKPFSPRELVLRTNNLLAR--MSKSNHSNKIEQLEFDGLV
SAER_STAEQ      QLDIPFIYLTAKTQEHDTIYALTLGADDYIKKPFSPRELVLRTNNLLAR--MSKSNHSNKIEQLEFDGLV
RPRY_BACFR      NAEIPIIFLTAKTLKEDILEGFKIGADDYITKPFSMEELTFRIEAILRR---VRGKKNKESNVYKIGKFT
QSEB_ECOLI      GQREPVLILTARDALAERVEGLRLGADDYLCKPFALIEVAARLEALMRRTNGQAS------NELRHGNVM
ARCA_HAEIN      XXXXX-IFLTGRDNEVDKILGLEIGADDYLTKPFNPRELTIRARNLLHRAMPHQEKENTFGEFYRFNGWK
CTRA_OCHA4      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUSU      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUSI      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUO2      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUME      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUC2      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUAB      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUA2      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
CTRA_BRUA1      KVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSKGHAQSVITTGDL------V
KDPE_ECOLI      SAV-PVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSATTAP----DPLVKFSDVT
CTRA_CAUCR      KINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSKGHAQSVIKTGDI------V
CTRA_CAUCN      KINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSKGHAQSVIKTGDI------V
QSEB_ECO57      GQREPVLILTARDALEERVEGLRLGADDYLCKPFALIEVAARLEALMRRTNGQAS------NELRHGNVM
PETR_RHOCA      MAT-PILLLTARGETRERIEGLEAGADDYXXXXXXXXXXXXRINAILRRVPEAVT-AGPKYLSLGPLRYD
YBDJ_BACSU      GLGIPVIFLSARNDMDSKLQGLQI-GEDYMVKPFDPXXXXXXXXXXXXH---------HYGTFTQIKHLY
VIRG_AGRRH      SDVPMIIISGDRLEEADKVVALELGATDFIAKPFGTREFLARIRVALRERP-SVARTKDRRSFYFADWTL
VIRG_AGRT5      SDVPIIIISGARLEEADKVIALELGATDFIAKPFGTREFLARIRVALR-VRPSVARTKDRRSFSFADWTL
TORR_ECOLI      S-TVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRIDLAAQPHTQDNCYRFAG-YC
TORR_ECO57      S-TVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRIDLAAQPYTQDNCYRFAG-YC
PHOP_SALCH      DISLPVLVLTAREGWQDKVEVLSSGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVINIPPFQ
YXDJ_BACSU      S-TSPIIFISARSGEMDQVMAIENGGDDYIEKPFSYDIVLAKIKSQIRRAYGEYAAKQGEKVVEYAGQLF
GRAR_STAAW      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAT      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAS      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAR      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAN      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAM      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAE      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAC      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAAB      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAI
GRAR_STAA9      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAA8      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAA3      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAA2      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
GRAR_STAA1      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEF---TAEEKRTLTWQDAV
CPXR_HAEIN      S-NVPVMMLTARGEDIDRVLGLELGADDCLPKPFNDRELIARIKAILRRSASPSNNIS-NVEILSFDGIT
GRAR_STAES      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEFG---VEEKRTLSWQDAT
GRAR_STAEQ      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEFG---VEEKRTLSWQDAT
QSEB_HAEIN      HQDVPVLILTARDTLDERVKGLQSGADDYLCKPFALAEVAARLQALIRRR------YGYHHSVIEQAGVK
PHOB_HAEIN      YAAIPIIMLTAKSTEEDCIACLNAGADDYITKPFSPQILLARIEAVWRRI------YEQQSQFIQIDELS
BCER_BACSU      S-NVPILFLSSRDHPADMVMSMQLGADDFIQKPFHFDVLIAKIQAMFRRVHHYNTEPSTIKTWCGA---A
CPXR_SHIFL      HQT-PVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSSEQQQNNDNGSPTLEVDALV
CPXR_ECOLI      HQT-PVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSSEQQQNNDNGSPTLEVDALV
CPXR_ECO57      HQT-PVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSSEQQQNNDNGSPTLEVDALV
PHOP_SALTI      DVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVINISPFQ
PHOP_SALTY      DVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVINIPPFQ
PHOP_SALPA      DVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVINIPPFQ
GRAR_STAHJ      S-NVPILFLSSRDNPMDQVMSMELGADDYMQKPFHTNVLIAKLQAIYRRVYEFG---AEEKRTLNWQDAL
PHOP_SHIFL      DVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVISLPPFQ
PHOP_ECOLI      DVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVISLPPFQ
PHOP_ECOL6      DVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVISLPPFQ
CSSR_BACSU      DPDVPVIFISARDADIDRVLGLELGSNDYISKPFLPRELIIRVQKLLQLVYKEAPPV-QKNEIAVSSYRV
GRAR_STAS1      SNT-PILFLSSRDNPMDQVMSMELGADDYVQKPFNTNVLIAKLQAIYRRVYQFS---LDEKRVLSWQDAI
RSTA_ECOLI      W-SGPIVLLTSLDSDMNHILALEMGACDYILKTTPPAXXXQNEQATLTKGLQETSLTPYKA--LHFGTLT
PHOP_ECO57      DVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSGLAS------QVISLPPFQ
TCTD_SALTY      GQTLPVLLLTARSAVADRVKGLNVGADDYLPKPFXXXXXXXXXXXXXXXXXGQVHEVQQLGELIFH----
QSEB_SALTY      GKQEPVLILTARDALAERVEGLRLGADDYLCKPFALIXXXXXXXXXXXXXSGQAS------SELRHGQVT
QSEB_SALTI      GKQEPVLILTARDALAERVEGLRLGADDYLCKPFALIXXXXXXXXXXXXXSGQAS------SELRHGQVT
PFER_PSEAE      QAT-PVMLMSALGAEQDRISGFTRGADDYLPKPFSXXXXXXXXXXXXXXXXXXXXXXXQRRDT----RLV
BCER_BACHD      S-NVPIIFLSSRDHPTDMVMSMQLGADDFIQKPFHFDVLVAKIQAILRRVHNYTSEQTQLKTWCGA---T
PILG_PSEAE      SASTPVIMLSSKDGLFDKAKGRIVGSDQYLTKPFSKEELLGAIKAHV-----------------------
GLNR_STRCO      GLSCPLVLIVTEGGLA--AVTADWGIDDVLLDTAGPAE----VEARLRLATGRQQLGGDDSPMIRNGDLS
NISR_LACLA      EISTPIIFVSAKDTEEXXXXXXXXXXXXXXTKPFSLKQLVAKVEANIKREERNKHAVHVFSEIRRLGPIT
VIRG_AGRT9      S-DIPIIIISGRLEETDKVVALELGASDFIAKPFSIREFLARIRVALR-----VRPNVVRSKDRRSFCFT
BASR_ECOLI      KYTLPVLILTARDTLTDKIAGLDVGADDYLVKPFXXXXXXXXXXXXXXXXNNQGE------SELIVGNLT
VIRG_RHIRD      S-DIPIIIISGRLEETDKVVALELGASDFIAKPFSIREFLARIRVALR-----VRPNVVRSKDRRSFCFT
BASR_SALTY      KYTLPVLILTAHDTLNDRITGLDVGADDYLVKPFXXXXXXXXXXXXXXXXNNQGE------SELTVGNLT
PLED_CAUCR      PTTIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTR----------------------
PILH_PSEAE      AETIPVIIVTTKDQETDKVWGKRQGARDYLTKPVDEETLLKTINAVL-----------------------
Y4XI_RHISN      GYSVPAVIMSRLDDLEKRISVFNSGADDFLRKPVSTDELIARMRALLRRSTQITCP------IIEFGNLH
ATOC_ECOLI      ETRTPVILMXXXXXXXXXXXXLRCGAFDYVIKPFDLDELNLIVQRALQLQSM------------------
PMRA_PECCC      NYQHPVLILTARDKVDDRVSGLDVGADDYLAKPFALTELQARVRALIRRNQGSS------NSKIQVDNIT
NTRC_ECOLI      HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVE--------------------------
NTRC_ECO57      HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVE--------------------------
RCSC_SALTY      GLTLPVVGVTANALAEEKQRCLESGMDSCLSKP-------------------------------------
RCSC_SALTI      GLTLPVVGVTANALAEEKQRCLESGMDSCLSKP-------------------------------------
NTRC_SALTY      HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVE--------------------------
FRZE_MYXXA      PAVAPVIILSSLASPEDKRRGLDAGADAYLVK--------------------------------------
YCF29_PORYE     XXXSPVIFLTAKGMTKDRIKGYDMGCYGYLSKPFDPNELLSIINNLIAR---------------------
HNR_SHIFL       GDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------------
HNR_ECOLI       GDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------------
HNR_ECO57       GDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------------
RCSC_ECOLI      GLTLPVIGVTANALAEEKQRCLESGMDSCLSKP-------------------------------------
PDTAR_MYCTU     RI-APIVVLTAQRDLVER--ARDAGAMAYLVKPFSISDLIPAIELAVSR---------------------
RSSB_SERMA      GQNIPIIILTARDRIESLVNSLDSGANDFLAKPFALPELISRVKAVNRRMAGFASQT------WSLGALY
NTRC_PROVU      YPTLPVIIMTAHSDLDAAVNAYQQGAFDYLPKPFDIDETLALIE--------------------------
NTRC_KLEPN      HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVDSHYQEQQQPRAPISPTADII------
CHEY_BACSU      DAQARIIMCSAMGQVID---AIQAGAKDFIVKPFQADRVLEAINKTL-----------------------
ZRAR_KLEOX      NPSIPVLIMTAYSSVDTAVEALKSGALDYLIKPLDFDKLQLTLSEALAHTRLSESPV-------------
DHKJ_DICDI      GIHTPIIAMTAHALARDRVKCLEAGMDDYISKPINPDQLKAMIEKYL-----------------------
DCTR_BACSU      KLEVDVIVVSAAKDKETISLMLQNGAVDYILKPFKLERMRQALEKY------------------------
ALGB_PSEPK      APWMRVVIVTAHSAIDTAVDAIQAGAADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEI-------
YFHA_ECOLI      QPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDALEQSAPA-----------------
YFHA_ECO57      QPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDALEQSAPA-----------------
SP0F_BACSU      DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL-----------------------
ALGB_PSESM      APWMRVVIVTAHSAVDTAVDAIQAGAADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEV-------
CHEB6_ANADE     RPT-PVVVLSSRSRRADVFKALELGALDFVARP-------------------------------------
YSO1_PLEBO      GETLPAIALTAYAREEDRQAALRSGFNDYLTKPVDPLELIRLVQQY------------------------
NARL_SHIFL      SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
NARL_ECOLI      SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
NARL_ECOL6      SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
NARL_ECO57      SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL------------------------------
ZRAR_SALTY      NPAIPILIMTAFSSVETAVEALKAGALDYLIKPLDLQETLEKALAHTREAELPSASAAQFGMI-------
ZRAR_SALTI      NPAIPILIMTAFSSVETAVEALKAGALDYLIKPLDLQETLEKALAHTREAELPSASAAQFGMI-------
DHKB_DICDI      LIESPIVALTANSGYKDKQKCLSVGMNDFLQKPIKTSDILIQIKKHL-----------------------
DCTR_BACME      GYKTDVIAVTAASDIETVRKVLQYGAVDYIMKPFKFERMKQALEQY------------------------
SP0F_BACTK      DESIKVILMSAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVRNEL-----------------------
SP0A_BACCI      NKPMPVIMLTAFGDVTKKAV--ELGASYFILKPFDMEYLASHI---------------------------
NTRX_AZOC5      HPEVPVVMISGHGNIETAVAAIKRGAYDFIEKPFNADRLVV-----------------------------
CHEY_LISMO      DPSAKVIMCSAMGQVVD---AIKKGAKDFIVKPFQADRVLEALE--------------------------
CHEY_LISIN      DPSAKVIMCSAMGQVVD---AIKKGAKDFIVKPFQADRVLEALE--------------------------
DHKD_DICDI      FDNIPILLLTAKADENLRIKLLQNGVSDYVNKPFSSEELVARV---------------------------
CYAB_STIAU      SRQVPVIILTANDSEAERVKGLRAGADDYVNKSASMAELSARIESVMRRTS-------------------
ALGB_PSEAE      APWMRVVIVTAHSAVDTAVDAMQAGAVDYLVKPCSPDQLRLAAAKQLEVRQLTARLEALEDEVRRQG---
REGA_RHOS4      RPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEV-------------------------------
NARP_ECOLI      GVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAIRAGAKGSKVFSERV---------NQYL
CHEY_THEMA      DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVV------------------------------
NARP_HAEIN      GVDARILILTVSDAKNDIYTLIDAGADGYLLKDTEPDTLLEQIK--------------------------
DHKG_DICDI      EGTTPIVAITASAMNGEMSKALAAGCDDYLSKPLQLKDL-------------------------------
CQSS_VIBCH      YKNIPIIGYTGDNSPKTLALVQTSGMNDFIVKPADRDVLLNKVAA-------------------------
ALGR_PSEAE      EAPPAVIFCTAHDEFALE--AFQVSAVGYLVKPVRSEDLAEALKKASRRVQLAALTKPPASGGSGPRSHI
Y2406_STAEQ     -LDCQIIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQL-------------------------------
FIXJ_BRAJA      QSPFPILIMTGHGDVPLAVEAMKLGAVDFLEKPFEDDRLTAMIESAIRQAEPAAKSEAVAQDI-------
SP0A_BACAN      LRQPSVIMLTAFGDVTKKAV--DLGASYFILKPFDMENLTSHI---------------------------
CHEB2_GEOMG     CPT-PVIVISAKSDDEKVFKALELGAVDFVAKP-------------------------------------
Y165_STAES      -LDCQVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQL-------------------------------
SP0A_CLOPA      NIVPNVIVLSAVGQDKITQRAITLGADYYVVKPFD-----------------------------------
NTRXL_RICPR     YPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLII-----------------------------
SP0A_CLOAB      AENLPIIVLSAVGQDKITQRAITLGADYYVVKPFD-----------------------------------
SP0A_BACTU      LKQPSVIMLTAFGDVTKKAV--DLGASYFILKPFDMENLTSHI---------------------------
SP0A_BACCR      LKQPSVIMLTAFGDVTKKAV--DLGASYFILKPFDMENLTSHI---------------------------
NTRXL_RICTY     YPLIPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLII-----------------------------
TRPO_PSEAE      KLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKRENLSELLLAAKAVL-----------------------
NTRXL_RICFE     YPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVI-----------------------------
GACS_PSESY      NSSLPIVALTAHAMANEKRSLLQSGMDDYLTKPISERQLAQVV---LKWTGLALRNPAPERQEVHVGPLV
Y217_STAA3      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y214_STAAR      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y201_STAAC      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y198_STAAW      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y198_STAAS      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y184_STAA8      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y161_STAAB      -LDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
NTRXL_RICCN     YPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVI-----------------------------
LUXQ_VIBVY      KLGTPIYACTADAQESTKQEFLSAGANRVIVKPIKEQELLLHFKAH------------------------
LUXQ_VIBVU      KLGTPIYACTADAQESTKQEFLSAGANRVIVKPIKEQELLLHFKAH------------------------
SP0A_CLODI      DIMPKIIVLSAVGQDKITQSAINLGADYYIVKPFD-----------------------------------
CHEY_PSEAE      LKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLKEKIEKIFERVN-------------------
CHEB3_GEOSL     SPTA-VIVISSRSEDEKVFRALELGAVDFVAKP-------------------------------------
BARA_SHIFL      QRQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERL-------------------------------
BARA_ECOLI      QQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERL-------------------------------
BARA_ECOL6      QQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERL-------------------------------
BARA_ECO57      QQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERL-------------------------------
Y223_STAAM      ALDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
Y215_STAAN      ALDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQL-------------------------------
PATA_ANASP      SYNTPVIMVTEKAGLVDRARAKIVRASGHLTKPFNQGDLLKVIFKHI-----------------------
EVGS_ECOLI      NSSLPIWGLTANAQANEREKGLSCGMNLCLFKPLTLDVLKTHL---------------------------
DCTR_BACHD      YIDVDIIAVTAANDTKTIKTLLRYGVMDYLVKPF------------------------------------
CHEB2_METHJ     -TPVPIIIVSGIDNLEEIRASFRA----------------------------------------------
CHEY_TREPA      DKNAKVVIISALGELVKKAL--LLGAKNYIVKPLDRKKVLERIASVLK----------------------
ARR14_ARATH     EMDLPVIMMSVDGRTTTVMTGINHGACDYLIKPIRPEEL-------------------------------
EVGS_ECO57      NSSLPIWGLTANAQANEREKGLNCGMNLCLFKPLTLDVLKTHL---------------------------
CHEB2_ACIBL     GQT-PVIVVSATQGARETFKALQLGAFDFVAKPQEGSSLTLENVADIAKIKVAGAARKPRPQI-------
ZRAR_ECOLI      NPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKAL-----------------------
SKN7_YEAST      DNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKRIPLCEQQLPPR----------
REGA_RHOCA      RPEARIVVLTGYGAIATAVAAVKMGATDYLSKPADANDI-------------------------------
HILA_SALTI      -------------------------------------------------------------------KFV
DCTD_RHILE      DVDLPVILMTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSV----RRAS-------------------
CHEB_TREDE      NIKIPVVILSS---IAKEGAKLELGACDFITKP-------------------------------------
CHEB1_SYNWW     AL--PVIIFSS---LSQKGTALQLGAVDFIAKP-------------------------------------
CHEB1_SYNAS     -IPTPIIIVSA-----------------------------------------------------------
APRR5_ARATH     DINIPVIMMSTQDSVNTVYKCMLKGAADYLVKPLRRNE-LRNLWQHVWRRQTSLAP--------------
SP0A_BACSU      DLKKQVIMLTAFGDVTKKAV--DLGASYFILKPFDMENLV----GHIRQVSGNASSVTHR----------
HILA_SALTY      -------------------------------------------------------------------KFV
HILA_SALPA      -------------------------------------------------------------------KFV
CQSS_VIBHB      YASVPIIAHTGDSSPITLDKIGSSGMSDFIVKPADKNRL-------------------------------
CHEY_HELPY      FKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVL-----------------------
CHEY_HELPJ      FKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVL-----------------------
CHEB_TREPA      RIDIPVIILSS---IAKEGARLELGASDFVTKPFGSE------SAHLRTVS-------------------
CHEB_NOCSJ      GNKVPIIMFST---LTERGAALGAGASDYVPKP-------------------------------------
CHEB3_RHOPA     PI--PVVICSSGSDLMFEAL--EAGAVDIVPKPVDTRQALMESSGRLREA--------------------
CHEB3_BRAJA     PI--PVIICSS---LTEEGEAFEAGAVDIVPKPIDTRQALLECSTRL-----------------------
ZRAR_ECO57      NPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKAL-----------------------
YHCZ_BACSU      FPDTNIIVLTSYSDQEHVIPALQAGAKAYQLKDTEPEELVKTRQVH------------------------
YDFI_BACSU      HDT-PIIILTTYNEDHLMIEGIELGAKGYLLKDTSSETLFHTMDAAIRGNVLLQPDILKR----------
CHEY_RHIEC      PNTAAFIILTAQGDRALVQRAAQLGANNVLAKPFTIEKMKAAIEA-------------------------
SP0A_BACST      FEHQPVIMLTAFGDVTKKAV--ELGASYFILKPFDMENLAHHIRQVYGKTTPVVRKAAP-----------
DHKI_DICDI      GGHIPIIAVTAHAMKGDKEKFLESGVDDYVTKPINPKLL-------------------------------
CHEB_ARCFU      QPT-PVVMLSSKEGARETLEALKIGAVDFVTKPDGALVDLSSVAQELRKVQMAAS---------------
Y0G0_VIBCH      PKVPLVVFITAYDEYAVS--AFETHAIDYLLKPLSSSRLASKLQQQLRR------NVAPSNDL-------
NTRC_BRASR      RPNLPVIVMSAQNTFMTAIRPSERGAYEYLPKPFDLKELI------------------------------
DOKA_DICDI      GQRIPIIAMTAND---SKDRCFEVGMDDYLSKP-------------------------------------
DCTD_RHIME      DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPF------------------------------------
CHEB_BACHD      PLPIIIVSSTTKEGAENALTAMELGAVDFITKPSGPISLDLEKVRDLLIEKVASAP--------------
RPFG_XANC8      DI--PIILITIVGDEPIRQAALEAGVIDFLVKPIRPREL-------------------------------
SP0A_BACME      KENYPVIMLTAFGDVTKKAV--DLGAAYFILKPFDMENLVNHI---------------------------
SP0A_CLOB8      QLVPRIIILSAVGQDKITQQAITLGADYYTVKPFD-----------------------------------
NTRC_AZOC5      RPDLPVIVMSAQNTFMTAIRASERGAYEYLPKPFDLKELI------------------------------
CHEY_YERPE      GATLPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEY_YEREN      GATLPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEB_NATPD      -CPTPVLVLSAHAD--------------------------------------------------------
YCF29_PORPU     LAKIPVIFLTAKGMTKDRIKGYNMGCYGYLSKPFDPEELVSLIKNLIYRDSL------------------
Y8J3_VIBVU      EYRPTIVFVTAYDEYAVK--AFEQQAIDYLMKPLSEARLI------------------------------
PILR_PSEAE      HPQTPVAMITAYGSLDTAIQALKAGAFDFLTKPVDLGRLLVATALRLRNPEAEEAPVDNR----------
DIVK_OCHA4      DELIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DHKK_DICDI      NRICPSIFLTANTMSTDKKRCFDHGMNHFISKPFQLEQLRSAIE--------------------------
CHEY_CAMJJ      YEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLE--------------------------
CHEY_CAMJE      YEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLE--------------------------
CHEY_CAMJ8      YEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLE--------------------------
CHEB_HALSA      --PTPILMVSA-----------------------------------------------------------
CHEB3_HAHCH     YPT-PIVVVTASGDAVTAMQVLEAGAITVTPKPQGP----------------------------------
CHEB2_DESVH     -MPRPVLMVSS-----------------------------------------------------------
CHEB1_DESDG     -MPRPVLMVSS-----------------------------------------------------------
ACTR_RHIME      RDDTRMIVLTGYGNIATAVNAVKLGALDYLAKP-------------------------------------
YPH5_THIVI      DYGIPILFLSQEXXXXXXXXXXXXGGDGFIKKPVSREALIAAVEYRMR----------------------
PRR1_SCHPO      DHNTPILAITSNISMNDAVTYFNHGVTDLLVKPF------------------------------------
DIVK_BRUSU      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUSI      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUO2      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUME      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUC2      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUAB      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUA2      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
DIVK_BRUA1      LRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL-----------------------
CHEB_HALMA      --PTPVLMLSAHTD-ENADVTFEAGAVDFFTKP-------------------------------------
CHEB1_LEPIN     KLGIPVIMLSV---LTQNGAALEYGAIDFVPKPFDPEEI-------------------------------
CHEB1_LEPIC     KLGIPVIMLSV---LTQNGAALEYGAIDFVPKPFDPEEI-------------------------------
ARR12_ARATH     -MDLPVIMLSAHSDPKYVMKGVTHGACDYLLKPVRIEEL-------------------------------
ARR11_ARATH     GLELPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELKIIWQHVLRK---------------------
ACTR_SINMW      RDDTRMIVLTGYGNIATAVNAVKLGALDYLAKP-------------------------------------
NTRC_RHIME      RPDLPVLVMSAQNTFMTAIKASEKGAYDYLPKPFDLTELI------------------------------
FIXJ_AZOC5      GAHMAVIVMTGHGDVPLAVEAMKLGAADFLEKPFDDAAIIAAVRASLGRSA-------------------
CHEB4_MYXXD     XXXXXXXXXXXXRDIQTSMAALRAGALAVLQKPLGP----------------------------------
CHEB1_METHJ     EITLVLSSLTSEGAEMTKR-AIALGADDFMLKP-------------------------------------
ARR10_ARATH     -MDLPVIMLSAHSDPKYVMKGVKHGACDYLLKPVRIEEL-------------------------------
YCF29_CYAPA     TDYCPVILLTTRGLTQDRIIGYKTGCDSYISKPFNIEELVVIIEGVLNRHTL------------------
FIXJ_RHIME      KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIE--------------------------
CITT_BACHD      FRDVDIMMVTAAKEVDTVQEALRGGIIDYLLKPVQKEVLHQRLDAYVQKREL------------------
TCSB_EMENI      GCSAPIVALSAFSEDSNIKDCMNSGMDMFISKP-------------------------------------
FIMZ_ECOLI      QSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQ--------------------------
FIMZ_ECO57      QSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQ--------------------------
CHEY_SHIFL      GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEY_ECOLI      GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEY_ECO57      GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEB2_RHORT     PIPVVVCSSLTETDSETASQAWEAGAVEIILKPVGTAQFLLESKIHICDVVKAAA---------------
AGLZ_MYXXD      GQNLKVLLLSSESGVDGLAQHRQTAADGYLAIPFEMGEL-------------------------------
LUXQ_VIBCH      VLHLPVVVYACTADGLERQAFFHAGAEYVLVKPLKEQTLLEHFKHH------------------------
CHEY_ECOL6      GAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
Y4021_VIBPA     ANPPLIVFVTAYDDYAIK--AFEQNAADYLLKPISDARL-------------------------------
SP0A_MOOTA      NFRPKIVILTALGQESMTMRSVELGADYYILKPFD-----------------------------------
CHEB1_MAGSA     DPGLKVIMLTLKGADVSLR-AMQMGAADYIPKPTSTRDL-------------------------------
TCSA_EMENI      GLTMPIIAITGNAMKGDAETYIAQGMDDCICKPVHRDQLL------------------------------
SP0A_BACSH      MSSIQVIMLTAFGDVMKQAV--DLGASYFMLKPFEFDQLVQKIKASIPKKASVLQPTTPQ----------
PRR95_ORYSJ     DANIPVIMMSSNDSVSMVFKCMLKGAADFLVKPIRKNEL-------------------------------
PRR37_ORYSJ     NINIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNEL-------------------------------
PRR37_ORYSI     NINIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNEL-------------------------------
NODW_BRAJA      NIHIPIIFITGHGDIPMTVRAMKGGAVDFLSKPFRDQELLDAVVAATER---------------------
DHKM_DICDI      GLKLPIIALTADATTGHKNLCLEAGCNEFMSKPLD-----------------------------------
CHEB_SYMTH      RPTPVVMVSSHTREGAEATIALALGAVDFVAKPSGSISLNMHV---------------------------
CHEB_PYRHO      -YPVPVIMISA---LTQEGAALEYGAIDFIPKPINMKELKDEIIAKIKEAA-------------------
CHEB_OCEIH      PV--PVVMLSSKAGAEKTIQAISNGAVDFIMKPSGSISLIRNVEDEIRKKVILASTV-------------
CHEB_LAWIP      -MPLPVIMVSS-----------------------------------------------------------
CHEB_ALHEH      QPTPVLMFSSLTYDGARETLALDAGASDFIPKRF------------------------------------
CHEB2_BURPS     S-PCAILIVTA-----------------------------------------------------------
CHEB2_BURP1     S-PCAILIVTA-----------------------------------------------------------
CHEB2_BURMA     S-PCAILIVTA-----------------------------------------------------------
CADC_ECOLI      --------------------------------------------------------------VVRVGEWL
CHEB_CLOAB      KIDIPIIVFSS---ISQKGMKYYLGAFDFIPKPEKPFELSKMKDDLIKRIRVA-----------------
BVGA_BORPE      GLPLRVLVLTGQ----------------------------------------------------------
BVGA_BORPA      GLPLRVLVLTGQ----------------------------------------------------------
BVGA_BORBR      GLPLRVLVLTGQ----------------------------------------------------------
SP0A_BREPA      RLSPKIIMLTAFGEITKKAV--ELGAAYYILKPFDMEVLAQRIRQIIKPASSFVTSVKPQSTLQVRGR--
LUXN_VIBHB      SPQTPIVALSGE----------------------------------------------------------
LUXN_VIBHA      SPQTPIVALSGE----------------------------------------------------------
CHEY_ENTCL      GMSMPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEB_SHEFN      NPTPILMFSSLTHDGAKATLALEAGALDFLPKRFE-----------------------------------
NTRC_AZOBR      RPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERALNSNTPPAALPADAGE--------
CHEV_BACSU      SSDVPVMIFSSLITDDLRHRGEVVGADEQISKP-------------------------------------
CHEB_PYRAB      -YPVPVIMISA---LTQEGAALEYGAIDFIPKPINMRELKDEIIAKIKEAA-------------------
CHEB4_BURTA     S-PCAILIVTA-----------------------------------------------------------
CHEB1_PSEPU     CPT-PVLMFSS---LTHEGAALDAGAVDYLPKNFE-----------------------------------
CHEB1_PSEPK     CPT-PVLMFSS---LTHEGAALDAGAVDYLPKNFE-----------------------------------
ARR18_ARATH     DL--PVIMLSAHSDYDSVMKGIIHGACDYLVKPVGLKEL-------------------------------
NTRC_RHOCA      P-GLPVIVISAQNTIMTAIQAAEADAYDYLPKPFDLPDLM------------------------------
DHKF_DICDI      KSRANIVGLSATYLHGSKDYCVSMGMDDFVVKP-------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
CHEB_TRIEI      YKQLPVIMFSA---ITQRGAALTLGANDYITKP-------------------------------------
CHEB3_SYNWW     EI-CPVLMVSS---LTQEGAALELGAFDFVGKP-------------------------------------
CHEB1_PSEAE     CPT-PVLMFSS---LTHEGAALDAGAVDYLPKNFE-----------------------------------
CHEB1_PSE14     --PTPVVICSS---LTQKGAALSAGAVEIITKP-------------------------------------
DCTR_RHOCA      GLVPPVIFLTGHADVPLAVQSLKAGAFDFVEKPFNDNHIV------------------------------
CHEY_SALTY      SAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEY_SALTI      SAALPVLMVTXXXXXXXXXXXXXXGASGYVVKPF------------------------------------
CHEB_NOSP7      S-PCAIIIVTAS---VSKNAGFEAMG--------------------------------------------
CHEB3_SHEON     --PTPVVICST---LTEQGAALAAGAVDIITKP-------------------------------------
CHEB3_RHOPB     PI--PVIICSTRSDVMFE--AFEAGAFDIVPKPIDTTHALLEASARM-----------------------
CHEB2_METAC     --PTPVVIVSALGERAEELTAFEYGAVDVIEKP-------------------------------------
CHEB1_PSEU2     --PTPVVICSS---LTQKGAALSAGAVEIITKP-------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
Y2151_LEPIN     GVLPRIVIVSEENTPAVLKNLIDEGAMDYIPKPIKREKILEKVNAAIKK---------------------
Y1769_LEPIC     GVLPRIVIVSEENTPAVLKNLIDEGAMDYIPKPIKREKILEKVNAAIKK---------------------
LYTR_STRA5      AHPPLVVFATAYDNYAVK--AFESNAVDYIMKPFEQQRVDMALSKVKKLSQLTTA---------------
LYTR_STRA3      AHPPLVVFATAYDNYAVK--AFESNAVDYIMKPFEQQRVDMALSKVKKLSQLTTA---------------
CHEB_NITWN      NL---IVIMASTLTRRNAEISFKAGASDYIPKPESTREVIRHLAAKRRRPATVASPPPDHDD--------
CHEB_METBU      TTPIPIIMFSSKKGSIEALEALRLGAIDFITKPSGLQEI-------------------------------
CHEB_MARMM      VPGCKIVMASTGGEVTIRALSM--GAADYASKP-------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB2_PSEPF     CPT-PVLMFSS---LTHEGAALDAGAVDFLPKNFE-----------------------------------
ARR2_ARATH      GLDLPVIMMSASKSVVLKGV--THGAVDYLIKPV-RIEALKNIWQHVVR---------------------
ARR22_ARATH     KVTSMIVGVTSVADQEEERKAFEAGLNHCLEKP-------------------------------------
ARR1_ARATH      GLDLPVIMMSASKSVVLKGV--THGAVDYLIKPV-RMEALKNIWQHVVR---------------------
YXJL_BACSU      LPNTKIVILTTFDTEEYVFEGIRAGAVGYLLKDTLPEELIDAIRAAAR----------------------
YFIK_BACSU      LPSVKVLMLTTFKDSALIAEALEEGASGYLLKDMSADTIVKAVMT-VHSGGMVLPPELTAQMLNEWKREK
Y3287_YERPE     SMP-HIVFVTAYDEYAIR--AFEEHAFDYLLKPLDHQRL-------------------------------
PGTA_SALTY      DDQLPILLITGHGDVPMAVDAVKKGAWDFLQKPVDPGKLLILIEDALRQ---------------------
CHEB_PYRKO      YPT-PVIMVSA---LTQEGAALEYGAIDFIPKPINMRELRDEIIAKVKEAA-------------------
CHEB3_RHORT     --PKPVVMVSS-----------------------------------------------------------
CHEB3_PSEU2     -IPTPVLMFSS---LTHEGAALDAGAVDFLPKNFE-----------------------------------
CHEB2_PSESM     --PTPVVICSS---LTQKGAALSAGAVEIITKP-------------------------------------
CHEB2_PSEF5     CPT-PVLMFSS---LTHEGAALDAGAVDFLPKNFE-----------------------------------
CHEB2_PSE14     -IPTPVLMFSS---LTHEGAALDAGAVDFLPKNFE-----------------------------------
CHEB1_PSESM     -IPTPVLMFSS---LTHEGAALDAGAVDFLPKNFE-----------------------------------
TOXR_VIBPA      ----------------------------------------------------------------------
SLN1_YEAST      GYTSPIVALTAFADDSNIKECLESGMNGFLSKP-------------------------------------
GACA_PSEU2      HPDIKVVAVTVCEEDPFPTRLLQAGAAGYMTKGAGLAEMVQAI---------------------------
DHKL_DICDI      KFSLPIIATTANVFKEDQLKCFDAGMDDFI----------------------------------------
CHEB_NITMU      QPT-PIVIVSGSTDPAEVGTTFDA----------------------------------------------
CHEB5_ANADE     PI--PVVICSS-----------------------------------------------------------
CHEB2_RHIL3     PI--PVVMCSSLTEAGSETLALEAGAVDVILK--------------------------------------
TOXR_VIBCH      ----------------------------------------------------------------------
PRR73_ORYSJ     KIDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNEL-------------------------------
PRR73_ORYSI     KIDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNEL-------------------------------
MAK1_SCHPO      ELKVPIVALSANAVLSCKDSGF----DSYLAKPITLQHLSLIISGIL-----------------------
DEGU_BREBE      YPDVKVLVLSIHDDESYVTHVLKTGASGYLLKEMDADALI------------------------------
CHEB_RHILO      PCSILLVTASIESNLAD-----------------------------------------------------
CHEB3_CHRVO     --PTPVLMISSLTDAGSETAALELGAVDFIHKPAD--DIARHMQEY------------------------
CHEB3_ANADE     --PTPIVIVTS-----------------------------------------------------------
CHEB2_CARHZ     RPT-PIIVISS---LTQKGAALELGAVDYVAKP-------------------------------------
CHEB1_SHESR     MAKCPTPIL-------------------------------------------------------------
CHEB1_SHESM     MAKCPTPIL-------------------------------------------------------------
APRR9_ARATH     EANIPVIMMSSQDSIKMVLKCMLRGAADYLIKPMRKNELKNLWQHVWRRLTLRDDPTA------------
NTRXL_RICBR     YPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVI-----------------------------
DHKC_DICDI      EQESIIIALTAHINPEIQVKCFDAGMNDFISKPFKPQ---------------------------------
Y693_VIBCH      --TMPVVFVTAYDQYALQ--AFEDNAFDYLLKPVDTERLAKTVQRLLRQ---------------------
Y503_VIBVU      --TMPVVFVTAYDQYAIQ--AFEDNAFDYLLKPVDPERLRKTVKRLSKAASHSA----------------
DEGU_BACSU      YPESKVIILSIHDDENYVTHALKTGARGYLLKEMDADTLI------------------------------
DCUR_ECOL6      RCKSDVIVISSAADAVTIKDSLHYGVVDYLIKPF------------------------------------
CHEB1_XANOR     --PTPVVICST---LTEKG---------------------------------------------------
CHEB1_XANOM     --PTPVVICST---LTEKG---------------------------------------------------
CHEB1_GEOSL     ---CP-----------------------------------------------------------------
CHEB1_CHRVO     --PTPVIICSS---LTEKGAALAAGAVAIITKPLNQRAFLLEAAKELARAKMGVVKRISQGAAEHA----
CHEB1_ACIBL     XXXXXVIMFST---LTERGAAFSLGASDYVTKPSNSRPGGQGVEA-------------------------
YESN_BACSU      SPSVQFIVLSGFGEFEYAKEAMKYGVKHYLLKP-------------------------------------
LUXQ_VIBPA      KLGTPIYACTADTAQETSDAFMEAGANYVLLKPIKENAL-------------------------------
LUXQ_VIBHA      LRLGTPIYACTADTAKETSDAFMAAGANYMLKPIKENAL-------------------------------
GACA_PSEAE      PDIKVVVVTVCEEDPFPTRL-MQAGAAGYMTKGAGLEEMVQAI---------------------------
DHKE_DICDI      XXXXXIVALSADSSSSFGQVCFDCGMNGYLGKP-------------------------------------
CHEB4_HAHCH     --PTPVLMFSS---LTYEGAALEAGAVDFLPKSFE-----------------------------------
CHEB2_PHOPR     VLPTPILMFSS-----------------------------------------------------------
CHEB2_METMA     FPT-PVVIVSALGEKAEELTALEYGAVDVIEKPSGILSQSMH----------------------------
CHEB2_BRAJA     DL---VIIMASTLTRRNAEISFKAGAADYIPKPESTREAIRHLGARLRR---------------------
CHEB1_VIBVY     SVPTPILMFSS-----------------------------------------------------------
CHEB1_VIBVU     SVPTPILMFSS-----------------------------------------------------------
CHEB4_GEOMG     H-PVPIVVVSGNLDAEEVASTFRA----------------------------------------------
CHEB2_SHESR     P-TAVVMISSLTEEGADATFNALAGAVDFIPKP-------------------------------------
CHEB2_SHESM     P-TAVVMISSLTEEGADATFNALAGAVDFIPKP-------------------------------------
CHEB1_VIBPA     SPT-PILMFSS-----------------------------------------------------------
CHEB1_BURS3     ERPCAILIVTS-----------------------------------------------------------
FIMZ_SALTY      QEHTRILFLSSKSEAFYAGRAIRAGANGFVSKRKDLNDI-------------------------------
DCUR_SHIFL      RCKSDVIVISSAADAATIKDSLHYGVVDYLIKPF------------------------------------
DCUR_ECOLI      RCKSDVIVISSAADAATIKDSLHYGVVDYLIKPF------------------------------------
DCUR_ECO57      RCKSDVIVISSAADAATIKDSLHYGVVDYLIKPF------------------------------------
CHEB_THICR      PL--PVVMIST---LTEKGITFEAGAVDFVAKP-------------------------------------
CHEB_THETN      A-PCPVVIISSLSGALTTFEALELGAVDFVAKP-------------------------------------
CHEB_METBF      CPT-PVVMISAFGERAEELTAFEYGAVDVIQRP-------------------------------------
CHEB_IDILO      N-PCPILMFSS---LTHEGAALEAGAADFLPKKFE-----------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB1_SHEON     MAKCPTPIL-------------------------------------------------------------
YCCH_BACSU      SLDVDVIFVTGHGGYAVH--AFDLNVHDYIMKPYYADRLAASFDRYLKK---------------------
Y538_VIBPA      --TMPVVFVTAYDQYAIQ--AFEDNAFDYLLKPVDPCRL-------------------------------
Y2823_SHEON     DTLPKIVFVTAFDEFAVK--AFDNHAFDYLLKPIDADRL-------------------------------
PDE2_DICDI      PVHIPVILMS--GTAVDYKYAIKIGGQDFLTKPI-AKELL------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
CHEB_SALRD      S-PRPILMLSS---LTEKGAAMRAGAADFLSK--------------------------------------
CHEB_CHRSD      PM--PVLMVSS---LTQKGSALELGAVDFVAKP-------------------------------------
CHEB_BACSU      -YNLPVIMVSSQ---TEKGKELEIGAFDFITKP-------------------------------------
CHEB3_VIBCH     PL--PIVMLSSEGAITTL-EALYLGAVDFVAKP-------------------------------------
CHEB3_GEOMG     PI--PVVMCS------------------------------------------------------------
CHEB2_XANCP     --PTPVVICST---LTEKG---------------------------------------------------
CHEB1_XANC8     --PTPVVICST---LTEKG---------------------------------------------------
CHEB1_VIBCH     ----------------------------------------------------------------------
APRR1_ARATH     DLRIPVIMMSRQDEVPVVVKCLKLGAADYLVKPLRTNELL------------------------------
CHEB_NITHX      NL---IVIMASTLTRRNAEISFKAGAADYIPKPESTREI-------------------------------
CHEB_METMP      KPT-PILMLSA-----------------------------------------------------------
CHEB3_PSEPK     PCAIVIVTVDRKQNV-------------------------------------------------------
CHEB2_XANC5     --PTPVVICST---LTEKG---------------------------------------------------
CHEB2_XANAC     --PTPVVICST---LTEKG---------------------------------------------------
CHEB2_PSEAE     --PTPVLMISS---LTERGSALELGAVDFIAKP-------------------------------------
CHEB2_AZOBR     APQVKIIMLTLRGADISMRC-LSAGAADYIPKPTSTREI-------------------------------
CHEB1_PSEPF     --PCAIVIVT------------------------------------------------------------
CHEB1_PSEF5     --PCAIVIVT------------------------------------------------------------
CHEB1_HAHCH     PM--PVVMISS---LTEQGAALEYGAVDFIAKPIDLRE--------------------------------
CHEB1_BORA1     S-PCAIIVVTS-----------------------------------------------------------
YEHT_SHIFL      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIDEARL-------------------------------
YEHT_ECOLI      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIDEARL-------------------------------
YEHT_ECOL6      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIDEARL-------------------------------
YEHT_ECO57      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIDEARL-------------------------------
CHEB3_PSEAE     --PCAIVIVT------------------------------------------------------------
CHEB2_CHRVO     --PTPVVICSS---LTQKGTAMAAGAVEVIAKP-------------------------------------
CHEB_PSEA6      K-PVPIIMFSSLTLQGAKATALDSGAMDFLPKKFE-----------------------------------
CHEB_GEOKA      XXXXXXXXXXXXEGAENTIAAMQYGAVDFVAKPSGPISL-------------------------------
CHEB2_XANOR     --PTPVVMISS---LTERGAALSLGAVDFVSKP-------------------------------------
CHEB2_XANOM     --PTPVVMISS---LTERGAALSLGAVDFVSKP-------------------------------------
CHEB2_SHEON     --PTAVVMISA---LTEEGAALALGAVDFIPKP-------------------------------------
CHEB2_SHEDO     --PTPVVICST---LTDKGAALSAGAVSIVTKPIGLKDFIQDAASDITNAVKAAA---------------
CHEB2_RHOPB     -APRPVVMISS-----------------------------------------------------------
CHEB2_GEOSL     PI--PVVMCS------------------------------------------------------------
CHEB2_DESDG     PI--PVVICSA-----------------------------------------------------------
CHEB2_BURCA     ERPCAILIVTS-----------------------------------------------------------
CHEB1_XANC5     --PTPVVMISS---LTERGAALSLGAVDFVSKP-------------------------------------
CHEB1_XANAC     --PTPVVMISS---LTERGAALSLGAVDFVSKP-------------------------------------
CHEB1_RALEJ     ATPCPIVVVT------------------------------------------------------------
ARR21_ARATH     FGNLPVLVMSS--DTNKEEESLSCGAMGFIPKPIHPTDL-------------------------------
MALR_BACSU      NEAVDVIVISAASDVIKKTLRY--GAVDYLIKPFE-----------------------------------
LYTT_BACAN      KNPPAIVFATAYDQYALQ--AFEVDALDYILKPFDEERIVQTLKKYKKQ---------------------
CHEB_METFK      PM--PVVMISS---LTERGSAMELGAVDFVTKP-------------------------------------
CHEB3_PSE14     -TPCAIVIVT------------------------------------------------------------
CHEB2_RHOCS     DPNVKIVMLTAKGADISLR-ALRAGAADYIPKPSSTREL-------------------------------
CHEB2_PSEU2     -TPCAIVIVT------------------------------------------------------------
CHEB1_RALME     PM--PVLMVSS---LTERGSALELGAVDFVTKP-------------------------------------
CHEB1_CARHZ     VYPVPVIMLSSLTTHGAKATALENGAVDFVPKDGDWNKVVSELKEKIKIAVLAKKRPKPTGGTLNPKNVI
LYTT_BACCR      KNPPAIVFATAYDQYALQ--AFEVDALDYILKPFDEERIVQTLKKYKKQ---------------------
CHEB_VIBF1      CPTPTLMFSS------------------------------------------------------------
CHEB_THEMA      APT-RVIMVSS---LTEEGAALRNGAVDFITKP-------------------------------------
CHEB2_RALEJ     PM--PVLMVSS---LTERGSALELGAVDFVTKPLGIRDGLMEIADKIRAASRARVRQAPQ----------
CHEB1_BURCA     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
RRF1_DESVH      ----------------------------------------------------------------------
MAK2_SCHPO      ENNCPVIALTADIQKSAKQRCLEVGMNFYLTKPFTQKQLV------------------------------
LYTT_ENTFA      KKAPYLVFATAYDQYALKA--FQVNAKDYILKPFEEEKITQVIE--------------------------
LYTR_STRMU      AHPPLVVFATAYDHYAVK--AFESNAADYILKPFE-----------------------------------
CHEB_ROSDO      PM--PVVMLSS---LTSKGQALSRGAIDCILKPTDGYDL-------------------------------
CHEB_MOOTA      GNPVAVIMLSAAGAAVTI-KALELGAVDFIPKP-APGDSLDDFTRQLTEKVKAAARV-------------
CHEB_DESHY      --PTPIIILSA---LTTEGAALEAGAFDVVAKP-------------------------------------
CHEB_BORPE      PM--PVVMVSSGGEITLRAL--ELGAIDFVTKP-------------------------------------
CHEB_BORPA      PM--PVVMVSSGGEITLRAL--ELGAIDFVTKP-------------------------------------
CHEB_BORBR      PM--PVVMVSSGGEITLRAL--ELGAIDFVTKP-------------------------------------
CHEB3_PSESM     -TPCAIVIVT------------------------------------------------------------
CHEB3_BURS3     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
CHEB2_MAGSA     --PTPIVVVAAQVDVVEKPVGVTNAGYDTM----------------------------------------
CHEB1_RHOPB     NL---IIIMASTLTRRNAEISFKAGAADYIPKPESTRE--------------------------------
CHEB1_DESVH     PL--PVVICSS-----------------------------------------------------------
CHEB1_BURTA     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
CHEB1_BURPS     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
CHEB1_BURP1     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
CHEB1_BURMA     PM--PVVMVSS---LTERGSALELGAVDFVTKP-------------------------------------
LUXO_VIBCH      SPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKAS-------------------
CHEB_RHOPS      DL---IIIMASTLTRRNAEISFKAGAADYIPKPESTRE--------------------------------
CHEB_NITEU      PM--PVVMVST---LTERGVTFRAGAVDFVAKPMDIRNSLEEITGKIRTASTALEPVASNG---------
CHEB_ENTCL      PM--PVVMVSSKGSEITLR-ALELGAVDFVTKPLAYSEMIAEKIRHPSRAKLAAHTPLAAPDTLKAG---
CHEB_BURXL      PM--PVVMVSS---LTERGRALELGAVDFVTKP-------------------------------------
CHEB1_METAC     S-PVPIIMFS------------------------------------------------------------
CCDB_BACSU      DPKAKVIMCTAMRQQRIVTEAIELGAKDFIVKPFEETKVL------------------------------
YEHT_SALTY      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIEEKRL-------------------------------
YEHT_SALTI      HRPY-IVFLTAFDEYAIK--AFEEHAFDYLLKPIEEKRL-------------------------------
ETR1_CUCSA      FAKCHMVVLTGNSDKVTKESCLRAGMDGLILKP-------------------------------------
ETR1_CUCMR      FAKCHMVVLTGNSDKVTKESCLRAGMDGLILKP-------------------------------------
CHEB4_ANADE     --PTPVIVVSS-----------------------------------------------------------
CHEB2_XANC8     --PTPVVMISS---LTERGAALSLGAVDFISKP-------------------------------------
CHEB2_SYNWW     -YPLPVVMISALSESVFDAL--NAGAIDFVAKP-------------------------------------
CHEB2_RHOPA     DL---VVIMASTLTRRNAEISFKAGAADYIPKPETTRE--------------------------------
CHEB2_BURS3     ----------------------------------------------------------------------
CHEB1_XANCP     --PTPVVMISS---LTERGAALSLGAVDFISKP-------------------------------------
CHEB1_MYXXD     APT-PVIVISSYSHRSDVFKALELGAFDFIAKPQHPTEAMEALRVELLEKVRAARHVRP-----------
UVRY_SHIFL      TADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRS-------------------------
UVRY_ECOLI      TADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRS-------------------------
UVRY_ECOL6      TADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRS-------------------------
UVRY_ECO57      TADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRS-------------------------
CHEB1_SHEDO     ----------------------------------------------------------------------
CHEB1_METMA     D-PVPIIMFS------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
RESD_BACSU      IDHDAHRVTADGTEVSLTPKEYELLYFLAKTPDKVYDREKLLKEVWQYEFFGDLRTVDTHVKRLREKLNK
PHOP_BACSU      I--GDLKILPDESQLELTPKEFELLLYLGRHKGRVLTRDLLLSAVWNYDFAGDTRIVDVHISHLRDKIEN
YCBL_BACSU      IDIDNVSVLKNGEPLQLTSTEWQLLCLFASNPKKVFTKEQIYRSVWNEEYFDDQNIINVHMRRLREKIED
YCF27_CYAPA     IDINKRQVFKNGERIRLTGMEFSLLELLISKMGEPFSRAQILQEVWGPERHIDTRVVDVHISRLRSKLEE
Y851_SYNP2      LFPEECRVTVRGEEVSLSPKEYRLLELFMSYPRRVWSRDQLIEQVWGADFLGDTKTVDVHIRWLREKLEL
YCF27_PORAE     IDVNKHQVYKNNERVRLTGMEFSLLELLISKAGQPFSRATILQEVWGAERQVDTRVVDVHISRLRAKLED
WALR_STAHJ      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAES      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAEQ      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
OMPR_SHIFL      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
OMPR_SALTY      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
OMPR_SALTI      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
OMPR_ECOLI      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
OMPR_ECOL6      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
OMPR_ECO57      LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
YCLJ_BACSU      INKKTREVLLNGEPVNLTPKEFDLLYYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLAS
WALR_STAS1      IYPDAYSIKKRGDDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
YCF27_GUITH     IDLNKRQIYKDNERIRLTGMEFSLLELLISRSGQPFSRADILQEVWGPERHVDTRVVDVHISRLRAKLET
WALR_STAAW      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAU      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAT      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAS      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAR      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAN      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAM      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAE      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAC      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAAB      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAA9      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAA8      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAA3      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAA2      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
WALR_STAA1      IYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIED
YYCF_BACSU      IFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGXXXXXXXXXXXXXEKIED
SRRA_STAAW      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAU      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAS      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAR      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAN      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAM      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAAC      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
SRRA_STAA8      IDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDREQLLKEVWHYEFYGDLRTVDTHVKRLREKLNR
YCF27_PORYE     IDTNKRQVYKNNERVRLTGMEFSLLELLVSKAGEPFSRASILQEVWGPERHVDTRVVDVHISRLRAKLED
YCF27_PORPU     IDTNKRQVYKNNERVRLTGMEFSLLELLVSKAGEPFSRASILQEVWGPERHVDTRVVDVHISRLRAKLED
YCF27_GALSU     IDINRKQVYKNEERIRLTGMEFNLLELLISNSGEPLSRTTILEEVWGPERHLDTRVVDVHISRLRAKLED
REGX3_MYCS2     MDVERHVVSVNGEPITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEE
SPHR_SYNE7      LFPEECRVLLDDRELTLSPKEFRLLELFMRHPRRVWSRDQLLEKIWGIDFMGDSKTIDVHIRWLREKIEA
REGX3_MYCTU     MDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEA
REGX3_MYCBO     MDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEA
YCF27_CYACA     IDLEKKQIYKNNELIRLTEMEFSLLELLVSQSGKAFSRSKILKEVWGHEPIADTRIVDVHISRLRAKLED
AFSQ1_STRCO     IDRSAMTVTKNGEDXXXXXXXXXXXXXXXXXXGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVED
VANR_ENTFC      INVNTHECYLNEKQLSLTPTEFSILRILCENKGNVVSSELLFHEIWGDEYFSKSNTITVHIRHLREKMND
YVRH_BACSU      PQNAELIV--GGEAVACSAQLLQLLQYFCEHPNVVLSKDQIYEKVWGYPSYGDNNTVMVHIRKLREKIER
ARLR_STAS1      XXXXAFKVTVDGQPLDLTKTEYDLLFLLVENRNHVLQREQIITDVWGYDTEVETNVVDVYIRYLRNKLKP
IRLR_BURPS      LDLTRRKATRQGDVVLLTAKEFALLWLLMRREGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKI-D
YKOG_BACSU      VNEKTREVRRGDKEVELTPREFDLLVYMLKHPQQVLTREQILSSVWGFDYIGDTNVVDVYIRYIRKKL-D
YRKP_BACSU      VSEEFNEVWKEEKQIKLSDLEYRILKLLMNKRNKIFSAQNIYESVWGQPFYCSNNTVMVHIRKLRSKIED
REGX3_MYCLE     MDVERHVVSVNGYAITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGVDYVGDTKTLDVHVKRLRSKIEA
CZCR_RALME      LGRRVFRGT---TRIELTNQEFSLLHLLMRRRGEVLSRTTIASQVWGXXXXXXXXXXXXAIRRLRSKV-D
CSEB_STRAW      IDTEGMEVRRSGQPVALTPTEMRLLLEFSSAPGTVLSRDKLLERVWDYGWGGDTRVVDVHVQRLRTKIGQ
ARLR_STAEQ      IDKDAFKVTVNGHQLELTKTEYDLLYVLAENRNHVMQREQILDHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAES      IDKDAFKVTVNGHQLELTKTEYDLLYVLAENRNHVMQREQILDHVWGYNSEVETNVVDVYIRYLRNKLKP
MPRA_MYCSS      LDPVTREVTRGSRQISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEA
MPRA_MYCSK      LDPVTREVTRGSRQISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEA
MPRA_MYCSJ      LDPVTREVTRGSRQISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEA
COPR_PSESM      VDLLKRRATRGGKRIELTAKEFALLELLMRRQGEVLSKSLIASQVWDMNFDSDTNVIEVAIRRLRAKIDD
ARLR_STAHJ      XXXXAFNVTINGEQLDFTKTEYDLLYLLATNRNRVLQREQILDHVWGYDSEVETNVVDVYIRYLRNKLKP
YEDW_ECOLI      MDSVSHSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKV-D
CUSR_ECOLI      VDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDN
CUSR_ECOL6      VDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDN
CUSR_ECO57      VDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDN
PCOR_ECOLX      VDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDD
ARLR_STAAW      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAAS      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAAR      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAAM      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAAC      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAAB      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAA8      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
ARLR_STAA3      IDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
MTRA_MYCTU      IDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEK
MTRA_MYCPA      IDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEK
MTRA_MYCBO      IDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEK
MTRA_MYCLE      IDVPAHKVTRNGEHISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEK
MPRA_MYCBP      LDPVTREVNRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
MPRA_MYCBO      LDPVTREVNRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
PHOB_RHIME      LDRETHRVHRRSREVRLGPTEFRLLEFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLR-KALN
PHOB_KLEPN      LDPSSHRVMTGDSPLDMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEH
MPRA_MYCUA      LDPVTREVTRGARRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
MPRA_MYCS2      LDPVTREVTRGGRQISLTRTEFSLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEA
MPRA_MYCTU      LDPVTREVNRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
MPRA_MYCTA      LDPVTREVNRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
HSSR_STAEQ      LNQSYMEITVGSKTMNLPNKEFQLLFLLASNPKHIFTRDDIIEKIWGFDYEGDDRTVDVHIKRLRQRLSK
MPRA_MYCPA      LDPVTREVTRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
MPRA_MYCA1      LDPVTREVTRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
GTCR_ANEMI      LLHTACVVYRGDETYSVTPLEYRLLNTMQCSRTSIFTKQQLFEQAWSETYWEDDNTIMVQISRLRDKIED
CHVI_RHIME      MDQERHTCTWKNESVTLTVTEFLILHALAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKM
SAER_STAAW      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAS      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAR      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAN      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAM      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAE      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAC      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAAB      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAA8      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAA3      LINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
VANR_ENTFA      LLPEDFRVLCDGTELPLTRKEFEILLLLVQNKGRTLTHEIILSRIWGYDFDGDGSTVHTHIKNLRAKLPE
PHOB_SHIDY      LDPTSHRVMTGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
PHOB_ECOLI      LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
PHOB_ECO57      LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
MPRA_MYCVP      LDPVTREVTRGDRPISLTRTEFSLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
SPAR_BACSU      FHFDSKEVFINNNKLNLTKNEYKICEFLAQHKGRTFSREQIYEEIYGLEGNALYSTITEFIRTIRKKCKE
HSSR_STAES      LNQSYMEITVGSKTMNLPNKEFQLLFLLASNPKHIFTRDDIIGKIWGFDYEGDDRTVDVHIKRLRQRLSK
HSSR_STAHJ      LIQEYMELSVDSKNVNLPTKEFQLLFLLCGQPKHIFTRDTLIERIWGFDYEGDERTIDVHIKRLRHRLNQ
MPRA_MYCLE      LDPVTREVARGQRWISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEA
PHOB_SHIFL      LNPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEP
CHVI_RHISN      MDQERHTCTWKSEPVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKM
HSSR_STAS1      LNQSYLEIQSSSKSMNLPNKEFQLLFLLASNPRQVFNRDALIEKIWGFDYEGDERTVDVHIKRLRKRLEK
CREB_ECOLI      LNEPAAQISWFDTPLALTRYEFLLLKTLLKSPGRVWSRQQLMDSVWEDAQDTYDRTVDTHIKTLRAKLRA
HSSR_STAAB      LNQSYLELQVSNKTMTLPNKEFQLLFMLATRPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
CSEB_STRCO      VDTDGMEVRRAGRPVGLTPTEMRLLLEFSSAPGTVLSRDKLLERVWDYGWGGDTRVVDVHVQRLRTKIGQ
HSSR_STAAW      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAT      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAS      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAN      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAM      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAA9      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAA8      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAA3      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAA2      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAA1      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
PHOB_PSEAE      LDPISHRVTIDGKPAEMGPTEYRLLQFFMTHQERAYTRGQLLDQVWGGNVYVEERTVDVHIRRLRKALGE
HSSR_STAAE      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAC      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
HSSR_STAAR      LNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-
CIAR_STRR6      VNLSTNTVKVEDTPVELLGKEFDLLVYFLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLK-
CIAR_STRPN      VNLSTNTVKVEDTPVELLGKEFDLLVYFLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLK-
DLTR_STRA5      LNTDSHXXXXXXXXXXXXXXXFLLMEVFMRNAKQIIPKNQLISKVWGPSDNSEYNQLEVFISFLRKKLRF
DLTR_STRA3      LNTDSHXXXXXXXXXXXXXXXFLLMEVFMRNAKQIIPKNQLISKVWGPSDNSEYNQLEVFISFLRKKLRF
ARLR_STAAN      L-----KVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKP
CHVI_RHIRD      MDQERHTCTWKGEPVTLTVTEFLILHSLAPAAGRGEKRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKL
SILR_SALTY      VDLVSRKVSRAGNRIVLTSKEFSLLEFFIRHQGEVLPRSLIAFMVWVHEFLADTNAIDVAVKRLRAKIDN
PRRA_MYCTU      VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
PRRA_MYCBO      VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
PRRA_MYCLE      VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTTVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
RCAC_FREDI      LNPSTCEVTYNGCPLNLTTMEYDLLELLLRNCQHVFSSEELLDKLWSSEDFPSEATVRSHVRRLRHKLVA
ARCA_SHIFL      LDNSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFES
ARCA_ECOLI      LDNSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFES
ARCA_ECOL6      LDNSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFES
ARCA_ECO57      LDNSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFES
YVCP_BACSU      IYPDQNEAEWNSVRILFSQKEFQLLSIFVREHKKIVSRDELLEALWDDVDFVDDNTLTVNVNRLRRKLE-
BAER_ECOLI      IDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLES
BAER_ECOL6      IDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLES
CUTR_STRLI      LDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKL--
CUTR_STRCO      LDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKL--
SAER_STAES      LKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
SAER_STAEQ      LKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEK
RPRY_BACFR      FDTQKQILAIGDKQTKLTTKESELLGLLCAHANEILQRDFALKTIWIDDNYFNARSMDVYITKLRKHLKD
QSEB_ECOLI      LDPGKRIATLAGEPLTLKPKEFALLELLMRNAGRVLSRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGS
ARCA_HAEIN      LDLNSHSITPEGQEFKLPRSEFRAMLHFCENPGKLQTREELLKKMTGRELKPQDRTVDVTIRRIRKHFED
CTRA_OCHA4      VNLDAKTVEVSGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUSU      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUSI      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUO2      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUME      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUC2      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUAB      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUA2      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
CTRA_BRUA1      VNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLDA
KDPE_ECOLI      VDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQ
CTRA_CAUCR      VNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAA
CTRA_CAUCN      VNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAA
QSEB_ECO57      LDPGKRIATLAGEPLTLKPKEFALLELLMRNAGRVLPRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGS
PETR_RHOCA      LDRGE--LSQGDQPVRLTATEAALMRIFAAHAGEVIGRTELIESASAEEAAGDRA-VDVQITRLRRKIEP
YBDJ_BACSU      IDAVTKKVFNESDEVLFTAIERKIFFYLYENRDSILTKEHFFEYLWQLE-DRNPNIVNVHIKKIRAKIND
VIRG_AGRRH      NIRQRRLISEEGGEIKLTAGEFNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLIFRLRRKLEG
VIRG_AGRT5      NLRRRRLISEEGSEVKLTAGEFNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEG
TORR_ECOLI      LNVSRHTLERDGEPIKLTRAEYEMLVAFVTNPGEILSRERLLRMLSARRVENDLRTVDVLIRRLRHKLSA
TORR_ECO57      LNVSRHTLERDGEPIKLTRAEYEMLVAFVTNPGEILSRERLLRMLSARRVENDLRTVDVLIRRLRHKLSA
PHOP_SALCH      VDLSRRELSVNEEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
YXDJ_BACSU      VERFELRFQDXXXXXXXXXXXXXXXXXXRGEK--VTSRDRLMEKTWDTDIFIDDNTLNVYITRLRKKLR-
GRAR_STAAW      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAT      VDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAS      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAR      IDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAN      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAM      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVSRLRKKLSE
GRAR_STAAE      VDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAC      VDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAAB      IDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAA9      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAA8      VDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAA3      VDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAA2      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAA1      VDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSE
CPXR_HAEIN      LHFSHGIATYNEENLNLTDYEFKILCLLLKSKGNVVSREEL-----------------------------
GRAR_STAES      VDLSKDSIQKDDKTIFLSKTEMIILEMLINKRNQIVTRDTLITALWDDEAFVSDNTLTVNVNRLRKKLSE
GRAR_STAEQ      VDLSKDSIQKDDKTIFLSKTEMIILEMLINKRNQIVTRDTLITALWDDEAFVSDNTLTVNVNRLRKKLSE
QSEB_HAEIN      LDQNQRSVWLNNQPISLTSREYKLLELFMLNKDRVLSRSSIEESSWDEEI--SSGALDVHIYNLRQKL--
PHOB_HAEIN      IDENAQRVFFQQQEINLSSTEFKLLHFFMRHPEKVYSREQLLNRIWHNDLEVEYRTVDSYIRRLRRNLAP
BCER_BACSU      VDAEQNLVSNDKGSVELTKNEMFILKQLIEQKNKIVSREELIRSLWNDERFVSDNTLTVNVNRLRKKL-D
CPXR_SHIFL      LNPGRQEASFDGQXXXXXXXXXXXXXXXAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPD
CPXR_ECOLI      LNPGRQEASFDGQXXXXXXXXXXXXXXXAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPD
CPXR_ECO57      LNPGRQEASFDGQXXXXXXXXXXXXXXXAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPD
PHOP_SALTI      VDLSRRELSVNEEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
PHOP_SALTY      VDLSRRELSVNEEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
PHOP_SALPA      VDLSRRELSVNEEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
GRAR_STAHJ      VDLSKDSIQKGDSVIYLSKTEMIILEMLIQKQNQIVTRDTLITALWDDEAFVSDNTLTVNVNRLRKKLSD
PHOP_SHIFL      VDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
PHOP_ECOLI      VDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
PHOP_ECOL6      VDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
CSSR_BACSU      AEDAREVYDENGNIINLTSKEFDLLLLFIHHKGHPYSREDILLKVWGHDYFGTXXXXXXXXXXXXXKMPE
GRAR_STAS1      LDLSKDSINKEDHQIYLSKTEMIILEMLVKKQNQIVTRDTLITALWDDEAFVSDNTLTVNVNRLRKKLAD
RSTA_ECOLI      IDPINRVVTLANTEISLSTADFELLWELATHAGQIMDRDALLKNLRGVSYDGLDRSVDVAISRLRKKLLD
PHOP_ECO57      VDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQA
TCTD_SALTY      -DEGYFLL--QGQPLALTPREQALLTVLMYRRTRPVSRQQLFEQVFSLNDEVSPESIELYIHRLRKKLQG
QSEB_SALTY      LNPGNLVATLAGEPLALKPKEFALLELLLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGS
QSEB_SALTI      LNPGNLVATLAGEPLALKPKEFALLELLLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGS
PFER_PSEAE      FDDQAQDVLHQGLPAGLTPSEYRLLATLREHAGEALSKPFLYRSVLHRSYTRLDRGLDVHVCNLRRKLAV
BCER_BACHD      IDYESNTVSNHVGSIELSKNEFFILKRLIERKNKIVTRDDLIRSLWEDERFISDNTLTVNVNRLRKRL-D
PILG_PSEAE      ----------------------------------------------------------------------
GLNR_STRCO      VDEATYSAKLKGRVLDLTFKEFELLKYLAQHPGRVFTRAQLLQEVWGYDYFGGTRTVDVHVRRLRAKL--
NISR_LACLA      FYLEERRVCVNGQTIPLTCREYDILELLSQRTSKVYTREDIYDDVYDEYSNALFRSISEYIYQIRSKFA-
VIRG_AGRT9      LNLRQRRLMSEGGEVKLTAGEFNLLLAFLEKPRDVLSREQLLIASRVRDEEVYDRSIDVLILRLRRKLEA
BASR_ECOLI      LNMGRRQVWMGGEELILTPKEYALLSRLMLKAGSPVHREILYNDIYNWDNEPSTNTLEVHIHNLRDKV--
VIRG_RHIRD      LNLRQRRLMSEGGEVKLTAGEFNLLLAFLEKPRDVLSREQLLIASRVRDEEVYDRSIDVLILRLRRKLEA
BASR_SALTY      LNIGRHQAWRDGQELTLTPKEYALLSRLMLKAGSPVHREILYNDIYNWDNEPSTNTLEVHIHNLRDKVGK
PLED_CAUCR      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
Y4XI_RHISN      FDPIGRQVSVDGHPLMIARRELCILEHLLNRAGRIVPRARLEDQLYSFNDEVSGNALEAGIYRLRGYLSR
ATOC_ECOLI      ----------------------------------------------------------------------
PMRA_PECCC      LDLNNQQVLLDEKPVVLTPKEFAILSRLVLKAGYQVHRELLHQDIYAWNDDPSSNSLEVHIHNLRQKIGK
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
YCF29_PORYE     ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
RSSB_SERMA      LDPVNHQVMLDNELLMLSKKEYHLLHELMRCAGTVVRKAVLEQRLFGHGDSVESNSLEVHMHNLRRKIGK
NTRC_PROVU      ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
ZRAR_KLEOX      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
ALGB_PSEPK      ----------------------------------------------------------------------
YFHA_ECOLI      ----------------------------------------------------------------------
YFHA_ECO57      ----------------------------------------------------------------------
SP0F_BACSU      ----------------------------------------------------------------------
ALGB_PSESM      ----------------------------------------------------------------------
CHEB6_ANADE     ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
NARL_SHIFL      ----------------------------------------------------------------------
NARL_ECOLI      ----------------------------------------------------------------------
NARL_ECOL6      ----------------------------------------------------------------------
NARL_ECO57      ----------------------------------------------------------------------
ZRAR_SALTY      ----------------------------------------------------------------------
ZRAR_SALTI      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
SP0A_BACCI      ----------------------------------------------------------------------
NTRX_AZOC5      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
ALGB_PSEAE      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
NARP_ECOLI      REREMFGAEEDPFSV-LTERELDVLHELAQG----LSNKQI-----------------------------
CHEY_THEMA      ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
ALGR_PSEAE      SAR-----TRKG--IELIPLEEVIFFTLRHAQGEVLLDEPLLEDEFGERFV-------------------
Y2406_STAEQ     ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
SP0A_BACAN      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
Y165_STAES      ----------------------------------------------------------------------
SP0A_CLOPA      ----------------------------------------------------------------------
NTRXL_RICPR     ----------------------------------------------------------------------
SP0A_CLOAB      ----------------------------------------------------------------------
SP0A_BACTU      ----------------------------------------------------------------------
SP0A_BACCR      ----------------------------------------------------------------------
NTRXL_RICTY     ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
NTRXL_RICFE     ----------------------------------------------------------------------
GACS_PSESY      LD--------------------------------------------------------------------
Y217_STAA3      ----------------------------------------------------------------------
Y214_STAAR      ----------------------------------------------------------------------
Y201_STAAC      ----------------------------------------------------------------------
Y198_STAAW      ----------------------------------------------------------------------
Y198_STAAS      ----------------------------------------------------------------------
Y184_STAA8      ----------------------------------------------------------------------
Y161_STAAB      ----------------------------------------------------------------------
NTRXL_RICCN     ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
SP0A_CLODI      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEB3_GEOSL     ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
Y223_STAAM      ----------------------------------------------------------------------
Y215_STAAN      ----------------------------------------------------------------------
PATA_ANASP      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
CHEB2_METHJ     ----------------------------------------------------------------------
CHEY_TREPA      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
ZRAR_ECOLI      ----------------------------------------------------------------------
SKN7_YEAST      ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
HILA_SALTI      FD--DFILNMDGKKVNIPPKEYAVLVILLEAAGKIVSKNTLLDQVWGDAEVNE-ESLTRCIYALRRILSE
DCTD_RHILE      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
CHEB1_SYNWW     ----------------------------------------------------------------------
CHEB1_SYNAS     ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
SP0A_BACSU      ----------------------------------------------------------------------
HILA_SALTY      FD--DFILNMDGKKVNIPPKEYAVLVILLEAAGEIVSKNTLLDQVWGDAEVNE-ESLTRCIYALRRILSE
HILA_SALPA      FD--DFILNMDGKKVNIPPKEYAVLVILLEAAGEIVSKNTLLDQVWGDAEVNE-ESLTRCIYALRRILSE
CQSS_VIBHB      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
CHEB3_RHOPA     ----------------------------------------------------------------------
CHEB3_BRAJA     ----------------------------------------------------------------------
ZRAR_ECO57      ----------------------------------------------------------------------
YHCZ_BACSU      ----------------------------------------------------------------------
YDFI_BACSU      LQEIQFRMKKQRNETQLTEKEVIVLKAIA-----------------------------------------
CHEY_RHIEC      ----------------------------------------------------------------------
SP0A_BACST      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
Y0G0_VIBCH      ----------------------------------------------------------------------
NTRC_BRASR      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
DCTD_RHIME      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
RPFG_XANC8      ----------------------------------------------------------------------
SP0A_BACME      ----------------------------------------------------------------------
SP0A_CLOB8      ----------------------------------------------------------------------
NTRC_AZOC5      ----------------------------------------------------------------------
CHEY_YERPE      ----------------------------------------------------------------------
CHEY_YEREN      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
YCF29_PORPU     ----------------------------------------------------------------------
Y8J3_VIBVU      ----------------------------------------------------------------------
PILR_PSEAE      ----------------------------------------------------------------------
DIVK_OCHA4      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
CHEY_CAMJJ      ----------------------------------------------------------------------
CHEY_CAMJE      ----------------------------------------------------------------------
CHEY_CAMJ8      ----------------------------------------------------------------------
CHEB_HALSA      ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
CHEB2_DESVH     ----------------------------------------------------------------------
CHEB1_DESDG     ----------------------------------------------------------------------
ACTR_RHIME      ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
PRR1_SCHPO      ----------------------------------------------------------------------
DIVK_BRUSU      ----------------------------------------------------------------------
DIVK_BRUSI      ----------------------------------------------------------------------
DIVK_BRUO2      ----------------------------------------------------------------------
DIVK_BRUME      ----------------------------------------------------------------------
DIVK_BRUC2      ----------------------------------------------------------------------
DIVK_BRUAB      ----------------------------------------------------------------------
DIVK_BRUA2      ----------------------------------------------------------------------
DIVK_BRUA1      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB1_LEPIN     ----------------------------------------------------------------------
CHEB1_LEPIC     ----------------------------------------------------------------------
ARR12_ARATH     ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
ACTR_SINMW      ----------------------------------------------------------------------
NTRC_RHIME      ----------------------------------------------------------------------
FIXJ_AZOC5      ----------------------------------------------------------------------
CHEB4_MYXXD     ----------------------------------------------------------------------
CHEB1_METHJ     ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
YCF29_CYAPA     ----------------------------------------------------------------------
FIXJ_RHIME      ----------------------------------------------------------------------
CITT_BACHD      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
FIMZ_ECOLI      ----------------------------------------------------------------------
FIMZ_ECO57      ----------------------------------------------------------------------
CHEY_SHIFL      ----------------------------------------------------------------------
CHEY_ECOLI      ----------------------------------------------------------------------
CHEY_ECO57      ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
CHEY_ECOL6      ----------------------------------------------------------------------
Y4021_VIBPA     ----------------------------------------------------------------------
SP0A_MOOTA      ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
SP0A_BACSH      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
CHEB_SYMTH      ----------------------------------------------------------------------
CHEB_PYRHO      ----------------------------------------------------------------------
CHEB_OCEIH      ----------------------------------------------------------------------
CHEB_LAWIP      ----------------------------------------------------------------------
CHEB_ALHEH      ----------------------------------------------------------------------
CHEB2_BURPS     ----------------------------------------------------------------------
CHEB2_BURP1     ----------------------------------------------------------------------
CHEB2_BURMA     ----------------------------------------------------------------------
CADC_ECOLI      VTPSINQISRNGRQLTLEPRLIDLLVFFAQHSGEVLSRDELIDNVWKRSIV-TNHVVTQSISELRKSLKD
CHEB_CLOAB      ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
SP0A_BREPA      ----------------------------------------------------------------------
LUXN_VIBHB      ----------------------------------------------------------------------
LUXN_VIBHA      ----------------------------------------------------------------------
CHEY_ENTCL      ----------------------------------------------------------------------
CHEB_SHEFN      ----------------------------------------------------------------------
NTRC_AZOBR      ----------------------------------------------------------------------
CHEV_BACSU      ----------------------------------------------------------------------
CHEB_PYRAB      ----------------------------------------------------------------------
CHEB4_BURTA     ----------------------------------------------------------------------
CHEB1_PSEPU     ----------------------------------------------------------------------
CHEB1_PSEPK     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
NTRC_RHOCA      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
CHEB_TRIEI      ----------------------------------------------------------------------
CHEB3_SYNWW     ----------------------------------------------------------------------
CHEB1_PSEAE     ----------------------------------------------------------------------
CHEB1_PSE14     ----------------------------------------------------------------------
DCTR_RHOCA      ----------------------------------------------------------------------
CHEY_SALTY      ----------------------------------------------------------------------
CHEY_SALTI      ----------------------------------------------------------------------
CHEB_NOSP7      ----------------------------------------------------------------------
CHEB3_SHEON     ----------------------------------------------------------------------
CHEB3_RHOPB     ----------------------------------------------------------------------
CHEB2_METAC     ----------------------------------------------------------------------
CHEB1_PSEU2     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
Y2151_LEPIN     ----------------------------------------------------------------------
Y1769_LEPIC     ----------------------------------------------------------------------
LYTR_STRA5      ----------------------------------------------------------------------
LYTR_STRA3      ----------------------------------------------------------------------
CHEB_NITWN      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_MARMM      ----------------------------------------------------------------------
CHEB5_GEOMG     ----------------------------------------------------------------------
CHEB2_PSEPF     ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
ARR22_ARATH     ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
YXJL_BACSU      ----------------------------------------------------------------------
YFIK_BACSU      QLKGINEIEKPNELLDLTEREIEVLAEL----GYGLNNKEIAE---------------------------
Y3287_YERPE     ----------------------------------------------------------------------
PGTA_SALTY      ----------------------------------------------------------------------
CHEB_PYRKO      ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
CHEB3_PSEU2     ----------------------------------------------------------------------
CHEB2_PSESM     ----------------------------------------------------------------------
CHEB2_PSEF5     ----------------------------------------------------------------------
CHEB2_PSE14     ----------------------------------------------------------------------
CHEB1_PSESM     ----------------------------------------------------------------------
TOXR_VIBPA      ------------EVVRLGSNESRILLMLAERPNEVLTRNELHEFVWREQFEVDDSSLTQAISTLRKMLKD
SLN1_YEAST      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
CHEB_NITMU      ----------------------------------------------------------------------
CHEB5_ANADE     ----------------------------------------------------------------------
CHEB2_RHIL3     ----------------------------------------------------------------------
TOXR_VIBCH      ------------EIIRLGSNESRILWLLAQRPNEVISRNDLHDFVWREQFEVDDSSLTQAISTLRKMLKD
PRR73_ORYSJ     ----------------------------------------------------------------------
PRR73_ORYSI     ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
DEGU_BREBE      ----------------------------------------------------------------------
CHEB_RHILO      ----------------------------------------------------------------------
CHEB3_CHRVO     ----------------------------------------------------------------------
CHEB3_ANADE     ----------------------------------------------------------------------
CHEB2_CARHZ     ----------------------------------------------------------------------
CHEB1_SHESR     ----------------------------------------------------------------------
CHEB1_SHESM     ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
NTRXL_RICBR     ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
Y693_VIBCH      ----------------------------------------------------------------------
Y503_VIBVU      ----------------------------------------------------------------------
DEGU_BACSU      ----------------------------------------------------------------------
DCUR_ECOL6      ----------------------------------------------------------------------
CHEB1_XANOR     ----------------------------------------------------------------------
CHEB1_XANOM     ----------------------------------------------------------------------
CHEB1_GEOSL     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEB1_ACIBL     ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
CHEB4_HAHCH     ----------------------------------------------------------------------
CHEB2_PHOPR     ----------------------------------------------------------------------
CHEB2_METMA     ----------------------------------------------------------------------
CHEB2_BRAJA     ----------------------------------------------------------------------
CHEB1_VIBVY     ----------------------------------------------------------------------
CHEB1_VIBVU     ----------------------------------------------------------------------
CHEB4_GEOMG     ----------------------------------------------------------------------
CHEB2_SHESR     ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB1_VIBPA     ----------------------------------------------------------------------
CHEB1_BURS3     ----------------------------------------------------------------------
FIMZ_SALTY      ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CHEB_THICR      ----------------------------------------------------------------------
CHEB_THETN      ----------------------------------------------------------------------
CHEB_METBF      ----------------------------------------------------------------------
CHEB_IDILO      ----------------------------------------------------------------------
CHEB2_RALME     ----------------------------------------------------------------------
CHEB1_SHEON     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
Y538_VIBPA      ----------------------------------------------------------------------
Y2823_SHEON     ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
LIAR_BACSU      ----------------------------------------------------------------------
CHEB_SALRD      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB_BACSU      ----------------------------------------------------------------------
CHEB3_VIBCH     ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
CHEB2_XANCP     ----------------------------------------------------------------------
CHEB1_XANC8     ----------------------------------------------------------------------
CHEB1_VIBCH     ----------------------------------------------------------------------
APRR1_ARATH     ----------------------------------------------------------------------
CHEB_NITHX      ----------------------------------------------------------------------
CHEB_METMP      ----------------------------------------------------------------------
CHEB3_PSEPK     ----------------------------------------------------------------------
CHEB2_XANC5     ----------------------------------------------------------------------
CHEB2_XANAC     ----------------------------------------------------------------------
CHEB2_PSEAE     ----------------------------------------------------------------------
CHEB2_AZOBR     ----------------------------------------------------------------------
CHEB1_PSEPF     ----------------------------------------------------------------------
CHEB1_PSEF5     ----------------------------------------------------------------------
CHEB1_HAHCH     ----------------------------------------------------------------------
CHEB1_BORA1     ----------------------------------------------------------------------
YEHT_SHIFL      ----------------------------------------------------------------------
YEHT_ECOLI      ----------------------------------------------------------------------
YEHT_ECOL6      ----------------------------------------------------------------------
YEHT_ECO57      ----------------------------------------------------------------------
CHEB3_PSEAE     ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
CHEB_PSEA6      ----------------------------------------------------------------------
CHEB_GEOKA      ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB2_SHEON     ----------------------------------------------------------------------
CHEB2_SHEDO     ----------------------------------------------------------------------
CHEB2_RHOPB     ----------------------------------------------------------------------
CHEB2_GEOSL     ----------------------------------------------------------------------
CHEB2_DESDG     ----------------------------------------------------------------------
CHEB2_BURCA     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_RALEJ     ----------------------------------------------------------------------
ARR21_ARATH     ----------------------------------------------------------------------
MALR_BACSU      ----------------------------------------------------------------------
LYTT_BACAN      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB3_PSE14     ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
CHEB2_PSEU2     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
CHEB1_CARHZ     LGKNGRQLVVIGASTGGPPALREIIPKLPQTFPVPIVIIQHITRGFSKPLADQLARVSRL--KVKEAEKD
LYTT_BACCR      ----------------------------------------------------------------------
CHEB_VIBF1      ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
RRF1_DESVH      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
LYTR_STRMU      ----------------------------------------------------------------------
CHEB_ROSDO      ----------------------------------------------------------------------
CHEB_MOOTA      ----------------------------------------------------------------------
CHEB_DESHY      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB3_PSESM     ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
CHEB2_MAGSA     ----------------------------------------------------------------------
CHEB1_RHOPB     ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
LUXO_VIBCH      ----------------------------------------------------------------------
CHEB_RHOPS      ----------------------------------------------------------------------
CHEB_NITEU      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB1_METAC     ----------------------------------------------------------------------
CCDB_BACSU      ----------------------------------------------------------------------
YEHT_SALTY      ----------------------------------------------------------------------
YEHT_SALTI      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
CHEB4_ANADE     ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB2_SYNWW     ----------------------------------------------------------------------
CHEB2_RHOPA     ----------------------------------------------------------------------
CHEB2_BURS3     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
CHEB1_MYXXD     ----------------------------------------------------------------------
UVRY_SHIFL      ----------------------------------------------------------------------
UVRY_ECOLI      ----------------------------------------------------------------------
UVRY_ECOL6      ----------------------------------------------------------------------
UVRY_ECO57      ----------------------------------------------------------------------
CHEB1_SHEDO     ----------------------------------------------------------------------
CHEB1_METMA     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPSDPRVIQTVWGIGYRFEPEGREG
RESD_BACSU      SPEAAKKIVTVWGVGYKFE------
PHOP_BACSU      NTKKPIYIKTIRGLGYKLE------
YCBL_BACSU      DPSSPQYIKTLWGIGYK--------
YCF27_CYAPA     NPSNPDLILTARGIGYLFQ------
Y851_SYNP2      DPSQPEYLITVRGFGYRF-------
YCF27_PORAE     DPSNPDLILTARGTGYLFQ------
WALR_STAHJ      DPSHPEYIVTRRGVGY---------
WALR_STAES      DPSHPEYIVTRRGVGY---------
WALR_STAEQ      DPSHPEYIVTRRGVGY---------
OMPR_SHIFL      DPAHPRYIQTVWGLGYVFVPDG---
OMPR_SALTY      DPAHPRYIQTVWGLGYVFVPDG---
OMPR_SALTI      DPAHPRYIQTVWGLGYVFVPDG---
OMPR_ECOLI      DPAHPRYIQTVWGLGYVFVPDG---
OMPR_ECOL6      DPAHPRYIQTVWGLGYVFVPDG---
OMPR_ECO57      DPAHPRYIQTVWGLGYVFVPDG---
YCLJ_BACSU      E--DKPFLYTVWGVGYKFDED----
WALR_STAS1      DPSHPEYIVTRRGVGY---------
YCF27_GUITH     DPSNPDLILTARGTGYLFQ------
WALR_STAAW      DPSHPEYIVTRRGVGY---------
WALR_STAAU      DPSHPEYIVTRRGVGY---------
WALR_STAAT      DPSHPEYIVTRRGVGY---------
WALR_STAAS      DPSHPEYIVTRRGVGY---------
WALR_STAAR      DPSHPEYIVTRRGVGY---------
WALR_STAAN      DPSHPEYIVTRRGVGY---------
WALR_STAAM      DPSHPEYIVTRRGVGY---------
WALR_STAAE      DPSHPEYIVTRRGVGY---------
WALR_STAAC      DPSHPEYIVTRRGVGY---------
WALR_STAAB      DPSHPEYIVTRRGVGY---------
WALR_STAA9      DPSHPEYIVTRRGVGY---------
WALR_STAA8      DPSHPEYIVTRRGVGY---------
WALR_STAA3      DPSHPEYIVTRRGVGY---------
WALR_STAA2      DPSHPEYIVTRRGVGY---------
WALR_STAA1      DPSHPEYIVTRRGVGY---------
YYCF_BACSU      NPSHPNWIVTRRGVGY---------
SRRA_STAAW      VSSEAHMIQTVWGVGYKFEVKSND-
SRRA_STAAU      VSSEAHMIQTVWGVGYKFEVKSND-
SRRA_STAAS      VSSEAHMIQTVWGVGYKFEVKSND-
SRRA_STAAR      VSSEAH