[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55062.1

[Show Plain Result]


## Summary of Sequence Search
    1::359
  134::294     4e-07  30%  894 aa  NIA_BEABA RecName: Full=Nitrate reductase [NADPH];       
  323::493     5e-04  33%  546 aa  SUOX_MOUSE RecName: Full=Sulfite oxidase, mitochondrial;       
  322::492     8e-04  34%  545 aa  SUOX_HUMAN RecName: Full=Sulfite oxidase, mitochondrial;       
    1::359

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIA_BEABA       ----------------------------------------------------------------------
SUOX_MOUSE      ----------------------------------------------------------------------
SUOX_HUMAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNFYVNVGGNIKKNFTIDVRDLAEDAN
NIA_BEABA       --------------------------------------------NWTFTVDGLVEKPFTIAVRDLIQKYD
SUOX_MOUSE      ----------------------------------------------------------------------
SUOX_HUMAN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
NIA_BEABA       QFTYVTLVCAKGFSWGAAGLTGVPIGALLRMAKPKRAAKYVCFEGADKYGTSVKLNWCMDENIMVAHKMN
SUOX_MOUSE      -----------------------------------DSDPTGTAYGAS-----IPLARAMDPEALLAYEMN
SUOX_HUMAN      -----------------------------------DSDPTGTAYGAS-----IPLARAMDPEALLAYEMN


                         .         .         .         +         .         .         .:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEI
NIA_BEABA       GQSLHPDHGKPVRIIIPGQIGGRSVKWLKKITITSEPSD-------------------------------
SUOX_MOUSE      GQPLPRDHGGRVSVESEESYSHWQRRDYVDWDTVNFDLAPSIQELP----IQSAITQPQDGAIVESG-EV
SUOX_HUMAN      GQPLPRDHGGRVSVQPEESYSHWQRRDYVDWETVDFDSAPSIQELPV----QSAITEPRDGETVESG-EV


                         .         *         .         .         .         .         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIA_BEABA       ----------------------------------------------------------------------
SUOX_MOUSE      TIKGYASGGGRAVIRVDVSVDGGLTWQEAELEGRKAWAWRIWQ---------------------------
SUOX_HUMAN      TIKGYASGGGRAVIRVDVSLDGGLTWQVAKLDGRKAWAWRLWQ---------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxx
NIA_BEABA       ---------
SUOX_MOUSE      ---------
SUOX_HUMAN      ---------