[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55075.1

[Show Plain Result]


## Summary of Sequence Search
    1::286
    2::284     2e-59  44%  303 aa  EFTS_CLOBB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::284     3e-59  44%  303 aa  EFTS_CLOBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::285     1e-58  44%  303 aa  EFTS_CLOD6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     8e-57  41%  304 aa  EFTS_CLOTE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     5e-56  42%  307 aa  EFTS_CLOBL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     5e-56  42%  307 aa  EFTS_CLOBK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     5e-56  42%  307 aa  EFTS_CLOBJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     5e-56  42%  307 aa  EFTS_CLOBH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     5e-56  42%  307 aa  EFTS_CLOB1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::285     5e-56  43%  306 aa  EFTS_CLOAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::268     5e-56  45%  292 aa  EFTS_ALHEH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     7e-56  42%  307 aa  EFTS_CLOBM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     1e-55  41%  307 aa  EFTS_CLOB6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::287     5e-55  43%  306 aa  EFTS_RHILO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::291     3e-54  46%  312 aa  EFTS_CAUSK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     4e-54  45%  307 aa  EFTS_MESSB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     7e-54  42%  307 aa  EFTS_RHIME RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     7e-54  43%  287 aa  EFTS_DESVV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     7e-54  43%  287 aa  EFTS_DESVH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-53  46%  294 aa  EFTS_LISMH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-53  46%  294 aa  EFTS_LISMF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-53  46%  294 aa  EFTS_LISMC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-53  46%  294 aa  EFTS_LISIN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::292     2e-53  39%  312 aa  EFTS_PELPD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-53  46%  294 aa  EFTS_LISMO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     3e-53  42%  307 aa  EFTS_SINMW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::272     6e-53  45%  273 aa  EFTS_HYDS0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-52  45%  294 aa  EFTS_LISW6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     2e-52  42%  307 aa  EFTS_RHISN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     2e-52  45%  305 aa  EFTS_OCHA4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::291     8e-52  44%  311 aa  EFTS_PHEZH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     8e-52  49%  286 aa  EFTS_DESDA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::294     1e-51  40%  314 aa  EFTS_NOSP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     1e-51  44%  307 aa  EFTS_BARHE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::284     2e-51  41%  303 aa  EFTS_MAGSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     2e-51  43%  306 aa  EFTS_CLOK5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::282     2e-51  43%  306 aa  EFTS_CLOK1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::268     5e-51  44%  291 aa  EFTS_ROSDO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     5e-51  44%  307 aa  EFTS_BARQU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::282     1e-50  44%  302 aa  EFTS_GLUOX RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     1e-50  44%  307 aa  EFTS_BART1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::275     1e-50  43%  294 aa  EFTS_BACSK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::292     2e-50  43%  312 aa  EFTS_CAUCR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::292     2e-50  43%  312 aa  EFTS_CAUCN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::293     2e-50  37%  294 aa  EFTS_LAWIP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     2e-50  47%  301 aa  EFTS_HYPNA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-50  40%  274 aa  EFTS_GRAFK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::284     3e-50  39%  303 aa  EFTS_CLOPE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::284     3e-50  39%  303 aa  EFTS_CLOP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     3e-50  42%  292 aa  EFTS_BORPD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     3e-50  43%  294 aa  EFTS_NITOC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::293     4e-50  37%  313 aa  EFTS_ANAVT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::285     2e-49  41%  303 aa  EFTS_PELCD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-49  41%  295 aa  EFTS_LYSSC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     3e-49  43%  292 aa  EFTS_STAS1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     3e-49  43%  291 aa  EFTS_HALHL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUSU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUSI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUO2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUME RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUMB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUC2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     3e-49  43%  305 aa  EFTS_BRUA1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     3e-49  43%  307 aa  EFTS_BARBK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::293     3e-49  37%  313 aa  EFTS_ANASP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::276     4e-49  45%  302 aa  EFTS_NITMU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::291     5e-49  38%  311 aa  EFTS_GEOLS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     6e-49  43%  297 aa  EFTS_AZOSB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::276     1e-48  38%  277 aa  EFTS_AMOA5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     2e-48  42%  290 aa  EFTS_THIDA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::278     2e-48  39%  297 aa  EFTS_FUSNN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::288     2e-48  40%  290 aa  EFTS_AQUAE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     2e-48  42%  292 aa  EFTS_LACPL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     4e-48  42%  293 aa  EFTS_ENTFA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::267     5e-48  45%  291 aa  EFTS_SILST RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     5e-48  41%  296 aa  EFTS_AZOSE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     5e-48  45%  292 aa  EFTS_ACIF5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     5e-48  45%  292 aa  EFTS_ACIF2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     1e-47  42%  291 aa  EFTS_LACS1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::263     1e-47  43%  264 aa  EFTS_DEIRA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::273     2e-47  40%  293 aa  EFTS_THISH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     2e-47  46%  292 aa  EFTS_RALSO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     2e-47  46%  292 aa  EFTS_RALEH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     2e-47  41%  292 aa  EFTS_PEDPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     2e-47  42%  308 aa  EFTS_AGRT5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::268     3e-47  43%  291 aa  EFTS_JANSC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     3e-47  38%  309 aa  EFTS_RICTY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::275     3e-47  45%  294 aa  EFTS_LACBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     3e-47  46%  292 aa  EFTS_CUPTR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::284     6e-47  38%  303 aa  EFTS_CLOPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     8e-47  42%  308 aa  EFTS_AGRRK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     1e-46  40%  308 aa  EFTS_PARL1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURM1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     2e-46  40%  292 aa  EFTS_BORPE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     2e-46  40%  292 aa  EFTS_BORPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     2e-46  40%  292 aa  EFTS_BORBR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  41%  293 aa  EFTS_BURTA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURP6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURP0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURMS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURM9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-46  42%  293 aa  EFTS_BURM7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     3e-46  41%  274 aa  EFTS_FLAPJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::275     3e-46  42%  295 aa  EFTS_BREBN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-46  45%  292 aa  EFTS_RALEJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     4e-46  39%  307 aa  EFTS_NITHX RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-46  40%  293 aa  EFTS_BURP8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     5e-46  41%  278 aa  EFTS_THEFY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::269     7e-46  46%  293 aa  EFTS_TERTT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::249     7e-46  46%  292 aa  EFTS_RALPJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::272     9e-46  41%  294 aa  EFTS_THICR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::275     9e-46  42%  294 aa  EFTS_OCEIH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     9e-46  41%  293 aa  EFTS_MACCJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::286     1e-45  36%  306 aa  EFTS_CLONN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     2e-45  44%  292 aa  EFTS_RALME RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-45  40%  293 aa  EFTS_BURXL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     3e-45  41%  294 aa  EFTS_NITEC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::269     3e-45  40%  292 aa  EFTS_IDILO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::284     6e-45  38%  304 aa  EFTS_SYMTH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     6e-45  40%  291 aa  EFTS_LACSS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     7e-45  43%  283 aa  EFTS_PROMH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     7e-45  39%  278 aa  EFTS_CYTH3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     7e-45  46%  288 aa  EFTS_CHRVO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     7e-45  36%  289 aa  EFTS_CHLT3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     7e-45  42%  293 aa  EFTS_BURCJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     7e-45  41%  293 aa  EFTS_BACHD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     9e-45  40%  294 aa  EFTS_NITEU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::273     9e-45  41%  293 aa  EFTS_METCA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     9e-45  44%  283 aa  EFTS_HAEDU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     9e-45  40%  292 aa  EFTS_BORA1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-44  41%  293 aa  EFTS_BACLD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   22::306     2e-44  39%  309 aa  EFTS_ORITB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-44  40%  293 aa  EFTS_BURVG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::270     2e-44  40%  292 aa  EFTS_PSYIN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     3e-44  40%  293 aa  EFTS_BURCM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     3e-44  40%  293 aa  EFTS_BURA4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-44  39%  293 aa  EFTS_BURCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-44  39%  293 aa  EFTS_BURCC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-44  39%  293 aa  EFTS_BURCA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     5e-44  38%  309 aa  EFTS_RICFE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     6e-44  36%  288 aa  EFTS_PROA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     6e-44  36%  288 aa  EFTS_CHLTE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::282     6e-44  40%  301 aa  EFTS_ACICJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     8e-44  40%  293 aa  EFTS_BURS3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     8e-44  39%  293 aa  EFTS_BACP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     1e-43  42%  307 aa  EFTS_ZYMMO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::291     1e-43  43%  312 aa  EFTS_MARMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     1e-43  38%  291 aa  EFTS_LACRJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     1e-43  38%  291 aa  EFTS_LACRD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     1e-43  39%  286 aa  EFTS_HAHCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-43  44%  293 aa  EFTS_BURPP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     1e-43  40%  278 aa  EFTS_STRCO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     1e-43  38%  278 aa  EFTS_MICLC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::273     2e-43  37%  293 aa  EFTS_DICNV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-43  37%  307 aa  EFTS_NITWN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     3e-43  43%  283 aa  EFTS_ACTPJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     4e-43  38%  307 aa  EFTS_BRAJA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     5e-43  44%  282 aa  EFTS_PASMU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     5e-43  38%  286 aa  EFTS_HAMD5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::290     7e-43  40%  309 aa  EFTS_RHORT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     7e-43  40%  293 aa  EFTS_JANMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     7e-43  39%  295 aa  EFTS_BACWK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     9e-43  40%  278 aa  EFTS_STRAW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     9e-43  39%  309 aa  EFTS_RICBR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     9e-43  39%  309 aa  EFTS_RICB8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     9e-43  45%  284 aa  EFTS_NEIG1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::272     2e-42  44%  291 aa  EFTS_DINSH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-42  37%  288 aa  EFTS_CHLPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     2e-42  39%  293 aa  EFTS_BACSU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     2e-42  42%  283 aa  EFTS_ACTP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     2e-42  42%  283 aa  EFTS_ACTP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-42  45%  284 aa  EFTS_NEIMF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-42  45%  284 aa  EFTS_NEIM0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     2e-42  42%  281 aa  EFTS_MANSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     3e-42  38%  307 aa  EFTS_BRASO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     3e-42  38%  295 aa  EFTS_BACC2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     6e-42  44%  284 aa  EFTS_NEIMB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     6e-42  44%  284 aa  EFTS_NEIMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     6e-42  38%  294 aa  EFTS_GEOKA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     6e-42  38%  290 aa  EFTS_CELJU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     7e-42  39%  292 aa  EFTS_STAES RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     7e-42  39%  292 aa  EFTS_STAEQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     7e-42  37%  308 aa  EFTS_RHOP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     7e-42  39%  295 aa  EFTS_BACCN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     7e-42  36%  308 aa  EFTS_AGRVS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     7e-42  39%  293 aa  EFTS_AERHH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     1e-41  42%  278 aa  EFTS_STRRA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAAW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAAT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAAS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAAR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAA8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     1e-41  39%  293 aa  EFTS_STAA3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     1e-41  37%  309 aa  EFTS_RICPR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     1e-41  40%  309 aa  EFTS_RICM5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::252     1e-41  41%  296 aa  EFTS_PARDP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     1e-41  42%  283 aa  EFTS_HAES2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     1e-41  42%  283 aa  EFTS_HAES1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACHK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACCZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACC3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACC0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACAN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACAH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  295 aa  EFTS_BACAA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-41  39%  293 aa  EFTS_AERS4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-41  38%  293 aa  EFTS_BACA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     2e-41  40%  289 aa  EFTS_CHRSD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::287     2e-41  35%  308 aa  EFTS_BDEBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     2e-41  38%  295 aa  EFTS_BACCQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     2e-41  38%  295 aa  EFTS_BACC7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     2e-41  38%  295 aa  EFTS_BACC1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAAN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAAM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAAE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAA9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-41  39%  293 aa  EFTS_STAA1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     3e-41  36%  274 aa  EFTS_PORGI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     3e-41  36%  274 aa  EFTS_PORG3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::273     3e-41  44%  291 aa  EFTS_LEUCK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     4e-41  39%  292 aa  EFTS_STAHJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     4e-41  37%  309 aa  EFTS_RICSI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     4e-41  37%  309 aa  EFTS_RICRS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     4e-41  37%  309 aa  EFTS_RICRO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     4e-41  37%  309 aa  EFTS_RICCN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     4e-41  36%  308 aa  EFTS_RHIE6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     4e-41  41%  304 aa  EFTS_GRABC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     5e-41  37%  308 aa  EFTS_RHOPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     6e-41  44%  294 aa  EFTS_POLNS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     6e-41  37%  312 aa  EFTS_MAGSA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     6e-41  41%  293 aa  EFTS_LARHH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     6e-41  42%  283 aa  EFTS_HAEPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     6e-41  41%  283 aa  EFTS_HAEIG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     6e-41  41%  283 aa  EFTS_HAEI8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     6e-41  40%  289 aa  EFTS_AZOVD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::251     8e-41  47%  291 aa  EFTS_SILPO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     8e-41  37%  309 aa  EFTS_RICAE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     8e-41  38%  308 aa  EFTS_ERYLH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     1e-40  37%  309 aa  EFTS_RICAH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     1e-40  36%  308 aa  EFTS_RHILW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-40  41%  289 aa  EFTS_FRAP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     1e-40  36%  309 aa  EFTS_RICCK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-40  44%  293 aa  EFTS_HERAR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-40  37%  295 aa  EFTS_BACCR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     1e-40  37%  295 aa  EFTS_BACC4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     2e-40  41%  283 aa  EFTS_HAEIN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::258     2e-40  41%  283 aa  EFTS_HAEIE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     2e-40  39%  285 aa  EFTS_YERE8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     2e-40  36%  355 aa  EFTS_HELHP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::290     3e-40  36%  309 aa  EFTS_RICPU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     3e-40  43%  294 aa  EFTS_POLSQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::273     3e-40  38%  291 aa  EFTS_LEUMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     4e-40  36%  308 aa  EFTS_RHIEC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     4e-40  39%  283 aa  EFTS_PHOLL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     4e-40  37%  292 aa  EFTS_LACF3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     4e-40  36%  294 aa  EFTS_GEOTN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::256     4e-40  43%  276 aa  EFTS_ACIC1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     5e-40  39%  307 aa  EFTS_RHOP5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     5e-40  35%  292 aa  EFTS_LEGPH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     5e-40  35%  292 aa  EFTS_LEGPC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     5e-40  35%  292 aa  EFTS_LEGPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     5e-40  38%  294 aa  EFTS_GEOSW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     5e-40  34%  288 aa  EFTS_CHLCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::334     5e-40  36%  352 aa  EFTS_CAMHC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::266     5e-40  39%  285 aa  EFTS_ALCBS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     7e-40  35%  292 aa  EFTS_LEGPL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     9e-40  35%  285 aa  EFTS_BIFA0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::263     1e-39  37%  264 aa  EFTS_DEIDV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::273     2e-39  35%  296 aa  EFTS_RUTMC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-39  38%  307 aa  EFTS_METS4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-39  39%  308 aa  EFTS_METRJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-39  42%  289 aa  EFTS_FRATW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-39  42%  289 aa  EFTS_FRATT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     2e-39  42%  289 aa  EFTS_FRAT1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     2e-39  40%  278 aa  EFTS_ARTCA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     2e-39  38%  308 aa  EFTS_RHOPT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     2e-39  38%  308 aa  EFTS_RHOPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::336     2e-39  37%  354 aa  EFTS_CAMC5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     2e-39  42%  283 aa  EFTS_ACTSZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     3e-39  37%  289 aa  EFTS_MARAV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     3e-39  34%  288 aa  EFTS_CHLPD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::336     3e-39  38%  354 aa  EFTS_CAMC1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-39  39%  283 aa  EFTS_ENT38 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     5e-39  38%  307 aa  EFTS_METNO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     5e-39  42%  289 aa  EFTS_FRATO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     5e-39  42%  289 aa  EFTS_FRATN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     5e-39  42%  289 aa  EFTS_FRATM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     5e-39  42%  289 aa  EFTS_FRATH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     5e-39  42%  289 aa  EFTS_FRATF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     6e-39  39%  278 aa  EFTS_STRGG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     6e-39  41%  292 aa  EFTS_OENOB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::252     6e-39  38%  293 aa  EFTS_LACCB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::252     6e-39  38%  293 aa  EFTS_LACC3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     6e-39  38%  298 aa  EFTS_DELAS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::271     6e-39  34%  274 aa  EFTS_AZOPC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     6e-39  38%  298 aa  EFTS_ACISJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::272     8e-39  39%  291 aa  EFTS_METFK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-38  37%  292 aa  EFTS_TOLAT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::276     1e-38  34%  276 aa  EFTS_SALRD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     1e-38  42%  307 aa  EFTS_SPHWW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     1e-38  37%  283 aa  EFTS_ENTS8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     1e-38  33%  288 aa  EFTS_CHLP8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     2e-38  41%  289 aa  EFTS_PSEAE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     2e-38  41%  289 aa  EFTS_PSEAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     2e-38  41%  289 aa  EFTS_PSEA7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::247     3e-38  43%  247 aa  EFTS_SPIPL RecName: Full=Elongation factor Ts;       
    3::277     3e-38  36%  296 aa  EFTS_SPICI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     3e-38  38%  308 aa  EFTS_RHIL3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     3e-38  41%  289 aa  EFTS_PSEA8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     3e-38  33%  288 aa  EFTS_PELPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::264     5e-38  40%  284 aa  EFTS_PHOPR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     5e-38  37%  293 aa  EFTS_EXIS2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     7e-38  38%  288 aa  EFTS_CHLL2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     9e-38  37%  307 aa  EFTS_XANP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::277     9e-38  36%  280 aa  EFTS_TREDE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     9e-38  38%  287 aa  EFTS_PSEU5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     9e-38  38%  283 aa  EFTS_KLEP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     9e-38  38%  283 aa  EFTS_KLEP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::268     1e-37  36%  290 aa  EFTS_PSEA6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     1e-37  33%  288 aa  EFTS_PELLD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::271     1e-37  34%  299 aa  EFTS_HALOH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     1e-37  37%  306 aa  EFTS_METPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::253     2e-37  37%  290 aa  EFTS_SACD2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     2e-37  40%  298 aa  EFTS_RHOSK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     2e-37  40%  298 aa  EFTS_RHOS4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     2e-37  40%  298 aa  EFTS_RHOS1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-37  38%  283 aa  EFTS_CITK8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-37  36%  307 aa  EFTS_AZOC5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     2e-37  42%  292 aa  EFTS_XYLFT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-37  38%  275 aa  EFTS_KINRD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHISS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHIFL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHIF8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHIDS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHIBS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_SHIB3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ESCF3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOUT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOSE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOLU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOLI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOLC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOL6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOL5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOHS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECODH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECOBW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO8A RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO81 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO7I RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO5E RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO57 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO55 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO45 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO27 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     3e-37  37%  283 aa  EFTS_ECO24 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::336     3e-37  36%  354 aa  EFTS_CAMFF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::274     4e-37  42%  293 aa  EFTS_EXISA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     6e-37  36%  355 aa  EFTS_WOLSU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     6e-37  34%  290 aa  EFTS_NEOSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     6e-37  37%  306 aa  EFTS_METEP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     6e-37  37%  306 aa  EFTS_METC4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     9e-37  36%  283 aa  EFTS_SERP5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     9e-37  37%  288 aa  EFTS_PSEF5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::282     9e-37  34%  282 aa  EFTS_PARUW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     9e-37  35%  282 aa  EFTS_CHLMU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::262     9e-37  38%  282 aa  EFTS_ALISL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     1e-36  41%  292 aa  EFTS_XYLFA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     1e-36  35%  308 aa  EFTS_RHOPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-36  38%  287 aa  EFTS_PSEFS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALTY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALTI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALSV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALNS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALHS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALG2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALEP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALDC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-36  38%  275 aa  EFTS_SALAI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-36  35%  296 aa  EFTS_COXBU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-36  35%  296 aa  EFTS_COXBR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-36  35%  296 aa  EFTS_COXBN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-36  35%  296 aa  EFTS_COXB2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-36  37%  298 aa  EFTS_ACIAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     2e-36  39%  280 aa  EFTS_VIBCM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     2e-36  39%  280 aa  EFTS_VIBCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     2e-36  39%  280 aa  EFTS_VIBC3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALPK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-36  38%  283 aa  EFTS_SALPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::279     2e-36  38%  302 aa  EFTS_METPP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     3e-36  38%  292 aa  EFTS_XANCP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     3e-36  38%  292 aa  EFTS_XANC8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     3e-36  38%  281 aa  EFTS_VIBHB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     3e-36  32%  307 aa  EFTS_NAUPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::283     4e-36  33%  286 aa  EFTS_WOLWR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     4e-36  39%  280 aa  EFTS_VIBVY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     4e-36  39%  280 aa  EFTS_VIBVU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     4e-36  37%  283 aa  EFTS_SALA4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-36  35%  292 aa  EFTS_PSYWF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-36  45%  271 aa  EFTS_MYCUA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     4e-36  45%  271 aa  EFTS_MYCMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     4e-36  35%  296 aa  EFTS_COXB1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::268     4e-36  39%  290 aa  EFTS_ALTMD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     5e-36  38%  275 aa  EFTS_SALTO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     5e-36  37%  283 aa  EFTS_PECCP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     5e-36  36%  297 aa  EFTS_MESFL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     6e-36  36%  285 aa  EFTS_SODGM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::288     6e-36  37%  288 aa  EFTS_PROVI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::256     6e-36  36%  274 aa  EFTS_ONYPE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     6e-36  36%  283 aa  EFTS_ERWT9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     6e-36  37%  270 aa  EFTS_CORA7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::254     8e-36  35%  290 aa  EFTS_VESOH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     8e-36  39%  307 aa  EFTS_VARPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     8e-36  34%  307 aa  EFTS_RHOCS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::276     8e-36  41%  277 aa  EFTS_MYCA9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     8e-36  35%  291 aa  EFTS_BIFAA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::284     1e-35  32%  286 aa  EFTS_WOLPM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::272     1e-35  43%  275 aa  EFTS_RHOE4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-35  36%  287 aa  EFTS_PSEU2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-35  36%  287 aa  EFTS_PSE14 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     1e-35  37%  283 aa  EFTS_ERWCT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-35  36%  287 aa  EFTS_PSESM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-35  40%  275 aa  EFTS_CLAM3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-35  36%  276 aa  EFTS_LEIXX RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     3e-35  32%  355 aa  EFTS_HELPG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     3e-35  38%  285 aa  EFTS_EDWI9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     3e-35  35%  299 aa  EFTS_DECAR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     3e-35  37%  282 aa  EFTS_COLP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     3e-35  40%  275 aa  EFTS_CLAMS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::267     4e-35  33%  280 aa  EFTS_BAUCH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     5e-35  32%  355 aa  EFTS_HELPY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::256     5e-35  36%  274 aa  EFTS_AYWBP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     7e-35  43%  278 aa  EFTS_RENSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::272     7e-35  35%  294 aa  EFTS_PSYA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     7e-35  44%  275 aa  EFTS_NOCFA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     7e-35  31%  355 aa  EFTS_HELP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::280     7e-35  39%  281 aa  EFTS_BEUC1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     9e-35  37%  287 aa  EFTS_PSEPF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     9e-35  43%  275 aa  EFTS_MYCA1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::270     9e-35  34%  272 aa  EFTS_BLOPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     2e-34  44%  274 aa  EFTS_MYCSS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     2e-34  44%  274 aa  EFTS_MYCSK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::273     2e-34  44%  274 aa  EFTS_MYCSJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     2e-34  31%  355 aa  EFTS_HELPH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     2e-34  31%  355 aa  EFTS_HELAH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     2e-34  35%  282 aa  EFTS_CHLTB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     2e-34  40%  310 aa  EFTS_BEII9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::272     2e-34  36%  294 aa  EFTS_PSYCK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-34  41%  276 aa  EFTS_MYCLE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::275     2e-34  41%  276 aa  EFTS_MYCLB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     2e-34  31%  355 aa  EFTS_HELPJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     2e-34  35%  291 aa  EFTS_ACIAD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     3e-34  43%  275 aa  EFTS_MYCPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     3e-34  42%  275 aa  EFTS_CORGB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::213     3e-34  40%  357 aa  EFTS_CAMJR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::213     3e-34  40%  357 aa  EFTS_CAMJJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::213     3e-34  40%  357 aa  EFTS_CAMJ8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     3e-34  36%  287 aa  EFTS_PSEMY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     3e-34  41%  275 aa  EFTS_MYCS2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::284     4e-34  30%  287 aa  EFTS_WOLTR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     4e-34  38%  275 aa  EFTS_CORK4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     4e-34  32%  282 aa  EFTS_CHLFF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     6e-34  35%  282 aa  EFTS_CHLT2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::213     6e-34  40%  357 aa  EFTS_CAMJD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     8e-34  32%  282 aa  EFTS_CHLCV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::213     8e-34  39%  357 aa  EFTS_CAMJE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     1e-33  34%  282 aa  EFTS_CHLTR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     2e-33  39%  292 aa  EFTS_XANAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::276     2e-33  33%  281 aa  EFTS_WOLPP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    7::283     2e-33  31%  283 aa  EFTS_PELUB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     2e-33  33%  282 aa  EFTS_CHLAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     2e-33  34%  267 aa  EFTS_BUCAP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     2e-33  32%  288 aa  EFTS_EHRRW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     2e-33  33%  288 aa  EFTS_EHRRG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     2e-33  31%  288 aa  EFTS_EHRCJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     2e-33  34%  282 aa  EFTS_CHLTA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     3e-33  39%  292 aa  EFTS_XANOR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     3e-33  39%  292 aa  EFTS_XANOP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     3e-33  39%  292 aa  EFTS_XANOM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::337     3e-33  31%  355 aa  EFTS_HELPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     3e-33  37%  278 aa  EFTS_ARTS2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     4e-33  38%  292 aa  EFTS_XANC5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     4e-33  42%  275 aa  EFTS_CORGL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     4e-33  34%  283 aa  EFTS_BIFLO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     4e-33  34%  283 aa  EFTS_BIFLI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::268     4e-33  34%  283 aa  EFTS_BIFLD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     5e-33  38%  308 aa  EFTS_SPHAL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::287     6e-33  35%  305 aa  EFTS_NITSB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     8e-33  39%  275 aa  EFTS_CORDI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     1e-32  41%  292 aa  EFTS_XANCB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::241     1e-32  47%  275 aa  EFTS_RHOSR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::241     1e-32  45%  275 aa  EFTS_RHOOB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::281     1e-32  37%  304 aa  EFTS_POLSJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     1e-32  32%  278 aa  EFTS_BORHD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     1e-32  38%  281 aa  EFTS_VIBSL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-32  44%  271 aa  EFTS_MYCVP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::286     1e-32  30%  287 aa  EFTS_ANAPZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     2e-32  38%  298 aa  EFTS_RHOS5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     3e-32  35%  271 aa  EFTS_SACEN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::277     3e-32  37%  278 aa  EFTS_ARTAT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     4e-32  36%  287 aa  EFTS_PSEP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     5e-32  34%  283 aa  EFTS_SHEAM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     5e-32  36%  287 aa  EFTS_PSEPK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-31  35%  287 aa  EFTS_PSEPG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::281     1e-31  32%  282 aa  EFTS_CHLPN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::272     2e-31  32%  273 aa  EFTS_TROWT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     2e-31  35%  341 aa  EFTS_LACAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     2e-31  31%  288 aa  EFTS_EHRCR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::274     2e-31  40%  275 aa  EFTS_COREF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::327     2e-31  35%  330 aa  EFTS_BACFR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::327     2e-31  35%  330 aa  EFTS_BACFN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-31  35%  283 aa  EFTS_SHEHH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::326     2e-31  34%  329 aa  EFTS_PARD8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::325     3e-31  35%  348 aa  EFTS_STRMU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::270     3e-31  40%  270 aa  EFTS_PROAC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::272     3e-31  31%  273 aa  EFTS_TROW8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::267     3e-31  35%  269 aa  EFTS_DEIGD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     5e-31  38%  281 aa  EFTS_VIBF1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     6e-31  33%  282 aa  EFTS_SHEWM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     6e-31  35%  287 aa  EFTS_PSEE4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     8e-31  35%  346 aa  EFTS_STRA5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     8e-31  35%  346 aa  EFTS_STRA3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     8e-31  35%  346 aa  EFTS_STRA1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     8e-31  35%  306 aa  EFTS_LEPCP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::322     8e-31  38%  342 aa  EFTS_LACLA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRZT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRZP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRZJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRR6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRPN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRPJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRPI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRP4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-30  35%  346 aa  EFTS_STRP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::283     1e-30  36%  306 aa  EFTS_POLNA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-30  41%  271 aa  EFTS_MYCTU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-30  41%  271 aa  EFTS_MYCTA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-30  41%  271 aa  EFTS_MYCBT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-30  41%  271 aa  EFTS_MYCBP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-30  41%  271 aa  EFTS_MYCBO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     1e-30  33%  290 aa  EFTS_TREPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::288     1e-30  33%  290 aa  EFTS_TREPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::265     1e-30  35%  287 aa  EFTS_PSEPW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::322     1e-30  34%  342 aa  EFTS_LACLS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::322     1e-30  34%  342 aa  EFTS_LACLM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::326     1e-30  36%  329 aa  EFTS_BACV8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::291     1e-30  31%  291 aa  EFTS_ANAMF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     2e-30  31%  278 aa  EFTS_BORDL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     3e-30  36%  281 aa  EFTS_VIBPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::291     3e-30  30%  291 aa  EFTS_ANAMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     4e-30  39%  281 aa  EFTS_VIBFM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::288     4e-30  39%  308 aa  EFTS_NOVAD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     4e-30  30%  278 aa  EFTS_BORRA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::329     4e-30  32%  348 aa  EFTS_ARCB4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     5e-30  33%  283 aa  EFTS_SHEON RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     5e-30  39%  307 aa  EFTS_RHOFD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     5e-30  34%  341 aa  EFTS_LACGA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     9e-30  33%  282 aa  EFTS_SHEPW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::322     1e-29  36%  326 aa  EFTS_RHOBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     1e-29  32%  283 aa  EFTS_SHESW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     1e-29  32%  283 aa  EFTS_SHEPC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::257     1e-29  33%  294 aa  EFTS_MYCPU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::270     1e-29  43%  271 aa  EFTS_MYCGI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-29  35%  341 aa  EFTS_LACJO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::261     1e-29  36%  276 aa  EFTS_KOCRD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-29  32%  283 aa  EFTS_SHESR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-29  32%  283 aa  EFTS_SHESM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-29  32%  283 aa  EFTS_SHESA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::277     3e-29  32%  298 aa  EFTS_MYCAP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::264     3e-29  33%  268 aa  EFTS_BUCAT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::264     3e-29  33%  268 aa  EFTS_BUCAI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::264     3e-29  33%  268 aa  EFTS_BUCA5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::332     3e-29  35%  350 aa  EFTS_SULDN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::258     3e-29  33%  277 aa  EFTS_PHYAS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     6e-29  37%  291 aa  EFTS_STRM5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     7e-29  38%  270 aa  EFTS_NOCSJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::283     1e-28  38%  308 aa  EFTS_VEREI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-28  35%  346 aa  EFTS_STRU0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     1e-28  34%  283 aa  EFTS_SHEFN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::278     1e-28  29%  278 aa  EFTS_BORT9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::105     1e-28  59%  216 aa  EFTS_ALKOO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::106     2e-28  57%  224 aa  EFTS_FINM2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::289     2e-28  36%  310 aa  EFTS_METSB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::320     4e-28  33%  320 aa  EFTS_FLAJ1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::279     4e-28  31%  279 aa  EFTS_BORBU RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::256     5e-28  33%  283 aa  EFTS_SHEDO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   58::196     5e-28  47%  217 aa  EFTS_CARHZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     6e-28  34%  283 aa  EFTS_PSEHT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    9::330     8e-28  33%  353 aa  EFTS_SULNB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     1e-27  34%  282 aa  EFTS_SHESH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-27  33%  341 aa  EFTS_LACH4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     1e-27  52%  200 aa  EFTS_DESVM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::263     1e-27  33%  266 aa  EFTS_BUCBP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::293     1e-27  32%  296 aa  EFTS_ACHLI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     2e-27  50%  198 aa  EFTS_DESOH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::279     2e-27  31%  279 aa  EFTS_BORAP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::272     2e-27  36%  291 aa  EFTS_STRMK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     2e-27  53%  196 aa  EFTS_DESPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::279     2e-27  31%  279 aa  EFTS_BORBZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     3e-27  32%  282 aa  EFTS_SHELP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-27  53%  198 aa  EFTS_DESDG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   59::197     4e-27  45%  216 aa  EFTS_GEOSF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIBY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIBT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIBS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIBC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIB5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::269     4e-27  40%  291 aa  EFTS_ACIB3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::277     5e-27  34%  295 aa  EFTS_MYCMS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     7e-27  37%  342 aa  EFTS_LACDB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     7e-27  37%  342 aa  EFTS_LACDA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   55::197     7e-27  44%  216 aa  EFTS_GEOUR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     7e-27  53%  215 aa  EFTS_ALKMQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::248     9e-27  31%  292 aa  EFTS_MYCGA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     9e-27  35%  272 aa  EFTS_CORU7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::269     9e-27  30%  276 aa  EFTS_BUCCC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::327     1e-26  33%  330 aa  EFTS_BACTN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   61::198     2e-26  42%  200 aa  EFTS_SYNFM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-26  33%  283 aa  EFTS_SHEB9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-26  33%  283 aa  EFTS_SHEB8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-26  33%  283 aa  EFTS_SHEB5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::260     2e-26  33%  283 aa  EFTS_SHEB2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::271     2e-26  36%  272 aa  EFTS_CORJK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-26  51%  297 aa  EFTS_THEEB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   59::197     2e-26  44%  216 aa  EFTS_GEOSL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::267     2e-26  31%  269 aa  EFTS_BLOFL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     2e-26  50%  219 aa  EFTS_ANAD2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     3e-26  53%  199 aa  EFTS_THEYD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-26  50%  219 aa  EFTS_ANASK RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-26  50%  219 aa  EFTS_ANADE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     6e-26  53%  198 aa  EFTS_THELT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     6e-26  31%  347 aa  EFTS_STRSV RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     6e-26  31%  347 aa  EFTS_STRGC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::274     6e-26  29%  292 aa  EFTS_MYCS5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::277     8e-26  33%  295 aa  EFTS_MYCCT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::255     8e-26  32%  279 aa  EFTS_BORGA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   54::196     1e-25  44%  214 aa  EFTS_SYNWW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-25  50%  263 aa  EFTS_CYAP4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   62::198     1e-25  43%  217 aa  EFTS_DESHY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   62::198     1e-25  43%  217 aa  EFTS_DESHD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-25  49%  219 aa  EFTS_TRIEI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-25  36%  346 aa  EFTS_STRTD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-25  36%  346 aa  EFTS_STRT2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::287     2e-25  36%  346 aa  EFTS_STRT1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     2e-25  31%  346 aa  EFTS_STRSY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     2e-25  31%  346 aa  EFTS_STRS2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   58::196     2e-25  43%  215 aa  EFTS_HELMI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     3e-25  48%  204 aa  EFTS_THEPX RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     3e-25  48%  204 aa  EFTS_THEP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::255     3e-25  32%  294 aa  EFTS_MYCMO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   58::196     3e-25  41%  204 aa  EFTS_CALS8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     4e-25  48%  219 aa  EFTS_SYNS9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     4e-25  50%  212 aa  EFTS_SOLUE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   55::197     5e-25  39%  198 aa  EFTS_DICTD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   59::197     6e-25  42%  216 aa  EFTS_GEOSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   55::197     6e-25  39%  198 aa  EFTS_DICT6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   59::197     8e-25  42%  216 aa  EFTS_GEOBB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-24  49%  221 aa  EFTS_SYNP6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-24  49%  221 aa  EFTS_SYNE7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     1e-24  46%  203 aa  EFTS_MOOTA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   58::196     1e-24  41%  204 aa  EFTS_ANATD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     2e-24  46%  200 aa  EFTS_THETN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-24  49%  286 aa  EFTS_CYAP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-24  45%  218 aa  EFTS_PROM5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   55::197     2e-24  42%  216 aa  EFTS_GEOMG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-24  47%  218 aa  EFTS_SYNY3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-24  45%  218 aa  EFTS_PROM9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   62::198     3e-24  41%  217 aa  EFTS_DESRM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-24  45%  200 aa  EFTS_DESMR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-24  50%  239 aa  EFTS_ACAM1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   60::196     4e-24  44%  215 aa  EFTS_CLOTH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     7e-24  48%  196 aa  EFTS_THEM4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     7e-24  44%  218 aa  EFTS_PROMP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::105     7e-24  46%  199 aa  EFTS_GALSU RecName: Full=Elongation factor Ts, chloroplastic;      
    1::104     9e-24  44%  218 aa  EFTS_PROMS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     9e-24  44%  218 aa  EFTS_PROM2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     9e-24  44%  218 aa  EFTS_PROM0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-23  47%  217 aa  EFTS_SYNR3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-23  48%  218 aa  EFTS_SYNP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-23  44%  219 aa  EFTS_SYNPX RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::105     2e-23  45%  219 aa  EFTS_SYNPW RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     2e-23  30%  346 aa  EFTS_STRE4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::105     3e-23  46%  220 aa  EFTS_SYNSC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     3e-23  30%  346 aa  EFTS_STRS7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-23  43%  217 aa  EFTS_PROMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-23  46%  249 aa  EFTS_CYAP8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::236     5e-23  32%  270 aa  EFTS_WIGBR RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     5e-23  44%  218 aa  EFTS_PROMT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     5e-23  44%  218 aa  EFTS_PROM1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::273     5e-23  28%  292 aa  EFTS_MYCPE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     6e-23  32%  346 aa  EFTS_STRP8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     6e-23  32%  346 aa  EFTS_STRP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     8e-23  44%  218 aa  EFTS_PROM4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::98      8e-23  49%  197 aa  EFTS_COPPD RecName: Full=Elongation factor Ts;       
    1::323     1e-22  32%  346 aa  EFTS_STRPZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPG RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRPB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRP6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::323     1e-22  32%  346 aa  EFTS_STRP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   55::197     1e-22  39%  219 aa  EFTS_ACIBL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     1e-22  45%  251 aa  EFTS_MICAN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   60::198     1e-22  41%  219 aa  EFTS_ANADF RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::253     2e-22  28%  291 aa  EFTS_UREU1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     2e-22  45%  218 aa  EFTS_PROM3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::253     3e-22  28%  291 aa  EFTS_UREPA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::253     3e-22  28%  291 aa  EFTS_UREP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     3e-22  45%  218 aa  EFTS_PROMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::105     4e-22  47%  219 aa  EFTS_GUITH RecName: Full=Elongation factor Ts, chloroplastic;      
    2::106     5e-22  48%  197 aa  EFTS_SULSY RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     7e-22  44%  219 aa  EFTS_RHDSA RecName: Full=Elongation factor Ts, chloroplastic;      
    8::273     7e-22  30%  292 aa  EFTS_MYCA5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     3e-21  29%  298 aa  EFTS_MYCPN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::105     4e-21  44%  196 aa  EFTS_THEAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     6e-21  43%  201 aa  EFTS_SYNAS RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::105     6e-21  46%  220 aa  EFTS_PORPU RecName: Full=Elongation factor Ts, chloroplastic;      
    5::107     6e-21  44%  202 aa  EFTS_PHATR RecName: Full=Elongation factor Ts, chloroplastic;      
    3::152     2e-20  34%  197 aa  EFTS_FERNB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    5::106     3e-20  44%  220 aa  EFTS_PORYE RecName: Full=Elongation factor Ts, chloroplastic;      
   10::280     3e-20  30%  303 aa  EFTS_MYCH7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     5e-20  44%  197 aa  EFTS_PERMH RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    4::108     5e-20  43%  201 aa  EFTS_METI4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::277     6e-20  31%  279 aa  EFTS_PHYMT RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   10::280     8e-20  30%  303 aa  EFTS_MYCH2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::105     1e-19  38%  219 aa  EFTS_GLOVI RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   59::198     2e-19  38%  282 aa  EFTS_SYNJA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     2e-19  43%  195 aa  EFTS_RUBXD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     2e-19  42%  199 aa  EFTS_LEPIN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     2e-19  42%  199 aa  EFTS_LEPIC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   46::350     2e-19  28%  355 aa  EFTS_DICDI RecName: Full=Elongation factor Ts, mitochondrial;      
    2::106     2e-19  44%  198 aa  EFTS_LEPBP RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     2e-19  44%  198 aa  EFTS_LEPBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-19  40%  199 aa  EFTS_LEPBL RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::107     3e-19  40%  199 aa  EFTS_LEPBJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    8::108     3e-19  43%  208 aa  EFTS_GRATL RecName: Full=Elongation factor Ts, chloroplastic;      
   10::280     5e-19  29%  303 aa  EFTS_MYCHJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     7e-19  39%  197 aa  EFTS_THENN RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     1e-18  38%  199 aa  EFTS_THESQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     1e-18  38%  199 aa  EFTS_THEMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     2e-18  38%  199 aa  EFTS_THEP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   61::198     2e-18  40%  258 aa  EFTS_SYNJB RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::279     3e-18  25%  298 aa  EFTS_MYCGE RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::104     6e-18  40%  218 aa  EFTS_SYNS3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    3::106     6e-18  40%  197 aa  EFTS_PETMO RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     8e-18  39%  198 aa  EFTS_HERA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::106     2e-17  42%  217 aa  EFTS_MYXXD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    2::106     1e-16  40%  206 aa  EFTS_DESAD RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    1::112     2e-16  41%  204 aa  EFTS_FRAAA RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::105     9e-16  39%  196 aa  EFTS_THET8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
    6::105     9e-16  39%  196 aa  EFTS_THET2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   56::251     8e-15  39%  338 aa  EFTS_BOVIN RecName: Full=Elongation factor Ts, mitochondrial;      
   43::238     2e-14  39%  325 aa  EFTS_HUMAN RecName: Full=Elongation factor Ts, mitochondrial;      
    4::100     2e-14  38%  209 aa  EFTS_CYAME RecName: Full=Elongation factor Ts, chloroplastic;      
   53::218     3e-14  39%  324 aa  EFTS_RAT RecName: Full=Elongation factor Ts, mitochondrial;        
   53::218     4e-14  39%  324 aa  EFTS_MOUSE RecName: Full=Elongation factor Ts, mitochondrial;      
   60::199     7e-14  34%  204 aa  EFTS_FRASC RecName: Full=Elongation factor Ts;         Short=EF-Ts;
   11::111     9e-14  33%  208 aa  EFTS_CYACA RecName: Full=Elongation factor Ts, chloroplastic;      
   37::140     2e-10  34%  299 aa  EFTS_SCHPO RecName: Full=Elongation factor Ts, mitochondrial;      
    5::67      4e-10  46%   87 aa  EFTS_ANTSP RecName: Full=Elongation factor Ts, chloroplastic;      
   59::196     1e-25  46%  216 aa  EFTS_ALKOO RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::205     1e-12  33%  224 aa  EFTS_FINM2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    2::105     6e-26  49%  217 aa  EFTS_CARHZ RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   59::196     6e-17  33%  200 aa  EFTS_DESVM RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   60::198     9e-27  43%  198 aa  EFTS_DESOH RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::195     3e-23  41%  196 aa  EFTS_DESPS RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   60::197     3e-18  33%  198 aa  EFTS_DESDG RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
    2::106     5e-17  38%  216 aa  EFTS_GEOSF RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
    2::106     3e-18  40%  216 aa  EFTS_GEOUR RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
   55::196     2e-24  43%  215 aa  EFTS_ALKMQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    5::108     9e-24  44%  200 aa  EFTS_SYNFM RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   56::199     7e-14  35%  297 aa  EFTS_THEEB RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::106     1e-19  41%  216 aa  EFTS_GEOSL RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
   60::198     2e-22  42%  219 aa  EFTS_ANAD2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::195     1e-17  34%  199 aa  EFTS_THEYD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::198     2e-22  42%  219 aa  EFTS_ANASK RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::198     2e-22  42%  219 aa  EFTS_ANADE RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::197     2e-17  35%  198 aa  EFTS_THELT RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    2::105     8e-23  48%  214 aa  EFTS_SYNWW RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   60::199     6e-20  37%  263 aa  EFTS_CYAP4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    1::107     5e-20  46%  217 aa  EFTS_DESHY RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 1->107)
    1::107     5e-20  46%  217 aa  EFTS_DESHD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 1->107)
   56::199     1e-18  35%  219 aa  EFTS_TRIEI RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::105     2e-23  51%  215 aa  EFTS_HELMI RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   54::196     8e-23  38%  204 aa  EFTS_THEPX RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   54::196     8e-23  38%  204 aa  EFTS_THEP3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::105     3e-23  45%  204 aa  EFTS_CALS8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   60::199     6e-20  37%  219 aa  EFTS_SYNS9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::198     3e-19  34%  212 aa  EFTS_SOLUE RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    3::106     4e-24  48%  198 aa  EFTS_DICTD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
    2::106     1e-19  41%  216 aa  EFTS_GEOSM RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
    3::106     5e-24  48%  198 aa  EFTS_DICT6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
    2::106     5e-19  40%  216 aa  EFTS_GEOBB RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
   60::199     7e-21  40%  221 aa  EFTS_SYNP6 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::199     7e-21  40%  221 aa  EFTS_SYNE7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   54::196     3e-22  38%  203 aa  EFTS_MOOTA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::105     7e-24  47%  204 aa  EFTS_ANATD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   58::196     7e-22  38%  200 aa  EFTS_THETN RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::199     2e-17  36%  286 aa  EFTS_CYAP7 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     4e-16  32%  218 aa  EFTS_PROM5 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::106     8e-18  38%  216 aa  EFTS_GEOMG RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->107)
   60::199     6e-15  36%  218 aa  EFTS_SYNY3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::199     2e-16  33%  218 aa  EFTS_PROM9 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    1::107     3e-19  41%  217 aa  EFTS_DESRM RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 1->107)
   60::198     2e-20  36%  200 aa  EFTS_DESMR RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     5e-19  37%  239 aa  EFTS_ACAM1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::105     1e-19  43%  215 aa  EFTS_CLOTH RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   58::196     1e-19  36%  196 aa  EFTS_THEM4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     2e-16  34%  218 aa  EFTS_PROMP RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   56::198     5e-07  26%  199 aa  EFTS_GALSU RecName: Full=Elongation factor Ts, chloroplastic;      (query 145->285)
   56::199     1e-16  33%  218 aa  EFTS_PROMS RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   56::199     2e-16  33%  218 aa  EFTS_PROM2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   56::199     1e-16  33%  218 aa  EFTS_PROM0 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   60::199     4e-17  36%  217 aa  EFTS_SYNR3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     8e-17  34%  218 aa  EFTS_SYNP2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   60::199     8e-18  36%  219 aa  EFTS_SYNPX RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   61::200     5e-19  36%  219 aa  EFTS_SYNPW RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   61::200     2e-18  37%  220 aa  EFTS_SYNSC RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     1e-16  35%  217 aa  EFTS_PROMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   60::199     2e-17  38%  249 aa  EFTS_CYAP8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     1e-17  36%  218 aa  EFTS_PROMT RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   56::199     1e-17  36%  218 aa  EFTS_PROM1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   56::199     1e-16  34%  218 aa  EFTS_PROM4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   59::197     4e-19  35%  197 aa  EFTS_COPPD RecName: Full=Elongation factor Ts;       (query 149->286)
    3::106     8e-20  42%  219 aa  EFTS_ACIBL RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 4->107)
   56::199     5e-14  32%  251 aa  EFTS_MICAN RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    1::107     7e-19  44%  219 aa  EFTS_ANADF RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 1->107)
   60::199     3e-17  34%  218 aa  EFTS_PROM3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   60::199     3e-18  36%  218 aa  EFTS_PROMM RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   57::200     9e-14  32%  219 aa  EFTS_GUITH RecName: Full=Elongation factor Ts, chloroplastic;      (query 145->286)
   59::197     1e-19  36%  197 aa  EFTS_SULSY RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   61::200     2e-11  29%  219 aa  EFTS_RHDSA RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->286)
   58::196     3e-19  34%  196 aa  EFTS_THEAB RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::197     6e-18  33%  201 aa  EFTS_SYNAS RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   61::199     8e-12  31%  220 aa  EFTS_PORPU RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->285)
   61::200     1e-12  29%  202 aa  EFTS_PHATR RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->286)
   61::199     5e-11  31%  220 aa  EFTS_PORYE RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->285)
   59::197     8e-17  32%  197 aa  EFTS_PERMH RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   61::197     1e-12  30%  201 aa  EFTS_METI4 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   56::199     9e-19  38%  219 aa  EFTS_GLOVI RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
    2::103     5e-19  43%  282 aa  EFTS_SYNJA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->104)
   59::195     1e-13  31%  195 aa  EFTS_RUBXD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->284)
   60::197     4e-15  32%  199 aa  EFTS_LEPIN RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   60::197     3e-15  32%  199 aa  EFTS_LEPIC RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   59::196     2e-12  26%  198 aa  EFTS_LEPBP RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   59::196     2e-12  26%  198 aa  EFTS_LEPBA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   60::197     5e-15  31%  199 aa  EFTS_LEPBL RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   60::197     5e-15  31%  199 aa  EFTS_LEPBJ RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   64::203     8e-12  30%  208 aa  EFTS_GRATL RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->286)
   59::195     8e-12  29%  197 aa  EFTS_THENN RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::195     5e-17  34%  199 aa  EFTS_THESQ RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::195     5e-17  34%  199 aa  EFTS_THEMA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
   59::195     2e-16  33%  199 aa  EFTS_THEP1 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->286)
    2::103     5e-17  40%  258 aa  EFTS_SYNJB RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 3->104)
   62::199     4e-16  32%  218 aa  EFTS_SYNS3 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 151->286)
   55::197     2e-15  32%  197 aa  EFTS_PETMO RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   59::196     3e-13  31%  198 aa  EFTS_HERA2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   56::197     3e-14  30%  217 aa  EFTS_MYXXD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 145->286)
   59::162     3e-12  36%  206 aa  EFTS_DESAD RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->251)
   60::199     1e-13  33%  204 aa  EFTS_FRAAA RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->282)
   58::195     8e-12  29%  196 aa  EFTS_THET8 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   58::195     8e-12  29%  196 aa  EFTS_THET2 RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 149->285)
   56::195     1e-07  24%  209 aa  EFTS_CYAME RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->284)
    1::112     9e-14  37%  204 aa  EFTS_FRASC RecName: Full=Elongation factor Ts;         Short=EF-Ts;(query 1->107)
   67::206     5e-04  22%  208 aa  EFTS_CYACA RecName: Full=Elongation factor Ts, chloroplastic;      (query 149->286)
    1::286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEGTVMAIVSDDA
EFTS_CLOBB      ---ISAKSVKELRERTGAGMMDCKKALTETDGDIEKAVEVLREKGLXXXXXXSGRVAAEGLVKTYISEDK
EFTS_CLOBA      ---ISAKSVKELRERTGAGMMDCKKALTETDGDIEKAVEVLREKGLXXXXXXSGRVAAEGLVKTYISEDK
EFTS_CLOD6      MANITAQMVKELRESTGAGMMDCKKALQEAEGNMEKAVDLLREKGLSKAAKKAGRVAAEGLVAIEMNDDN
EFTS_CLOTE      ---ITAKMVKELREITGAGMMDCKKALTETNGDTEKAVEVLREKGLXXXXXXSGRIAAEGLVETYIAEDK
EFTS_CLOBL      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOBK      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOBJ      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOBH      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOB1      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOAB      ---ISASAVKELRERTGAGMMACKKALSEANGDSEKAVEILREKGLXXXXXXXGRVASEGLVVAYVNEDG
EFTS_ALHEH      --AISASLVKQLRERTGSGMMECKKALVETDGDLDAAVELMRKKGLAKADKKSGRIAAEGIIAAKRSEDG
EFTS_CLOBM      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_CLOB6      ---ISAKMVKDLREKTGAGMMDCKKALTECDGDLEKAVEVLREKGLXXXXXXSGRVAAEGIVSTYISEDM
EFTS_RHILO      --SISAAQVKELRDLTGAGMMDCKAALNETNGNMEEAVDWLRKKGISKADKKAGRTAAEGLIG--VDAGV
EFTS_CAUSK      MAEVTAALVKELREKSGVGMMDCKKALVENNGDIDASIDWLRAKGLSKAAKKADRVAAEGLVGIVVRAEG
EFTS_MESSB      --SISAALVKQLREVTGAGMMDCKTALAETGGDLEAAVDWLRKKGISKADKKAGRTAAEGLIG--LAADA
EFTS_RHIME      ---VTAAMVKELREKTGAGMMDCKKALAETNGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--IASSG
EFTS_DESVV      --AITASMVKELREKTSAGMMDCKKALEECGGEMDKAVDWLRQKGLSKAAKKAGRATSEGLVGCFVSADG
EFTS_DESVH      --AITASMVKELREKTSAGMMDCKKALEECGGEMDKAVDWLRQKGLSKAAKKAGRATSEGLVGCFVSADG
EFTS_LISMH      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_LISMF      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_LISMC      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_LISIN      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_PELPD      --AITAAQINELRKATGAGMLDCKKALEQNDGDFEKSVDYLRTKGLXXXXXXXXXXXTEGMVAAFVSDDL
EFTS_LISMO      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_SINMW      ---VTAAMVKELREKTGAGMMDCKKALAETNGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--IASAG
EFTS_HYDS0      --AVSSENVKLLREMTGAGMLDCKKALEEANGDIDKAKEILRIKGLAKADKKASRETKEGLIVA--KSTP
EFTS_LISW6      MANITAQMVKELREKTGAGMMDCKKALVETEGDMEKAIDYLREKGIAKAAKKSDRVASEG--MTHVISNE
EFTS_RHISN      ---VTAAMVKDLREKTGAGMMDCKKALAETNGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--IASAG
EFTS_OCHA4      --SISASLVKELRDLTGAGMMDCKTALAETNGDIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_PHEZH      MAEITAALVKELREKTDAGMMDCKKALQENNGDLEAAADWLRTKGLXXXXXXXXXXXXEGLVAGLVSADG
EFTS_DESDA      MAAITAQMVKELREMTGAGMMDCKKALVEVEGDLEKAVDWLRQKGMAKAAKKSGRATSEGLVTVALSDDG
EFTS_NOSP7      MAEISAKLVQELRQKTGAGMMDCKKALIETEGNVEEAADWLRKKGISKAGAKSDRVAAEGLVDTYIQPGG
EFTS_BARHE      --SITAAQVKELRELSGAGMMDCKAALAETNGDMEAAVDWLRXXXXXXXXXXXXRTAAEGLI-GVVSQDL
EFTS_MAGSM      --AVTASMVKELREKTGVGMMDCKKALAETGGDMEAAVDWLRKKGMASAQKKSARVAAEGKVTTLSLGSV
EFTS_CLOK5      ---ITAQMVKELRERTGAGMMDCKKALNEAGGDSEKAIEILREKGLAAAAKKSGRIASEGLVKTYISEDG
EFTS_CLOK1      ---ITAQMVKELRERTGAGMMDCKKALNEAGGDSEKAIEILREKGLAAAAKKSGRIASEGLVKTYISEDG
EFTS_ROSDO      --AITAAMVKELRDSTGAGMMDAKKALTENNGDMEAAVDWLRTKGLAKAAKKSGRTAAEGLV--AVKVQG
EFTS_BARQU      --SITAAQVKELRELSGAGMMDCKAALADTNGDMEAAVDWLRXXXXXXXXXXXXRTAAEGLI-GIVSKD-
EFTS_GLUOX      MAEITAALVRELREATGAGMMDCKKALTEAAGDMEAAIDWLRTKGLSQAAKKSGRTTAEGLVG--VASAK
EFTS_BART1      --SVTAAQVKELRELSGAGMMDCKAALAETNGDMDAAVDWLRXXXXXXXXXXXXRTAAEGLI-GVVSKDS
EFTS_BACSK      --AVTASMVKELREKTGAGMMDCKKALVEVDGDMEKAIDYLREKGIAKAEKKADRVAAEG--LASVVTEG
EFTS_CAUCR      MAEITAALVKELREKSGVGMMDCKKALAENNGDIEASIDWLRAKGLSXXXXXXXXXXXEGLVXXXXXXXX
EFTS_CAUCN      MAEITAALVKELREKSGVGMMDCKKALAENNGDIEASIDWLRAKGLSXXXXXXXXXXXEGLVXXXXXXXX
EFTS_LAWIP      --SISASMVKTLRERTGAGMMDCKQALEEANGDMEKAIDWLRQRGLSKASKKAGRATTEGLIGCQVLPGS
EFTS_HYPNA      MAEITAALVKELREKTGAGMMDAKKALVENNGDQAAAIEWLRAKGLXXXXXXXXXXXXEGLVAVKLSDDG
EFTS_GRAFK      MAKITAAEVNKLRKATGAGMMDCKKALVEAEGDFDGAIELLRKKGQKVAAKRADRDSSEGAAIAQVNGDN
EFTS_CLOPE      ---ITAKAVKELRERTGAGMMDCKKALTETNGDMEKAVEVXXXXXXXXXXXXXXXXXXXXIVKTYVSEDM
EFTS_CLOP1      ---ITAKAVKELRERTGAGMMDCKKALTETNGDMEKAVEVXXXXXXXXXXXXXXXXXXXXIVKTYVSEDM
EFTS_BORPD      MAEITAALVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYISADA
EFTS_NITOC      --AITAAQVKELRERTGSGMMECKKALVETGGDIETAIEWMRKQGLAKADKKAGRVAAEGIIVTAVSQDG
EFTS_ANAVT      MAEISAKLVQELRQKTGAGMMDCKKALKETEGDVEQAIDWLRKKGIASAGKKSDRIAAEGLVDTYIQPGG
EFTS_PELCD      ---ITASMVSELRTKTGAGMMDCKKALSEADGNIEEAVDILRKKGLSXXXXXXXXXXXEGLVVGL--NEG
EFTS_LYSSC      MANITAQLVKELREKTGAGMMDCKKALVQTDGDLEAAIDFLREKGLSSAAKKADRIAAEGT--TYILEQG
EFTS_STAS1      --AISAKLVKELREKTGAGMMDCKKALTETDGDIDKAVDFLREKGIAKAAKKSDRIAAEGLVH--VEERG
EFTS_HALHL      --SVSANLVKQLRERTGSGMMECKKALVEVDGDLEAAAELMRKKGLXXXXXXXXXXXXXXXXXXXXSEDG
EFTS_BRUSU      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUSI      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUO2      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUME      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUMB      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUC2      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUAB      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUA2      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BRUA1      --SISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRXXXXXXXXXXXXRTAAEGLVGVAASGN-
EFTS_BARBK      --SITAAQVKELRELSGAGMMDCKAALMETNGDIETAVDWLRXXXXXXXXXXXXRTAAEGLIG--IASKG
EFTS_ANASP      MAEISAKLVQELRQKTGAGMMDCKKALKETEGDVEQAIDWLRKKGIASAGKKSDRIAAEGLVDTYIQPGG
EFTS_NITMU      MAEITAQMVKELREITGLGMMECKKALTEASGDMKAAEDLLRIXXXXXXXXXXXXXXXEGIVAAHIARDG
EFTS_GEOLS      --AITAAQINELRKATGAGMLDCKKALEEVDGDMEQAVDYXXXXXXXXXXXXXXXXXTEGMXXXXXXXXX
EFTS_AZOSB      MAEITASMVKELREKTDAPMMECKKALTEAGGDMAKAEEVLRIKLGNKASKAAARVTAEGIVGTYLSADG
EFTS_AMOA5      --AITAQDINKLRQLTGAGMMDCKKALTEAQGDIDKAIELLRKKGQKIAAARAGRDTTEGFALADVNASA
EFTS_THIDA      MAEITASMVKDLREKTDAPMMDCKKALTEAGGDMQKAEEILRVRFGNKAAKSAGRVAAEGVVTIAISPDG
EFTS_FUSNN      MATVTAALVKELRERTGAGMLDCKKALESHDGDIEKSIDYLREKGIAKAVKKAGRIAAEGLIFDEATPDH
EFTS_AQUAE      --AVSMEDVKKLREMTGAGMLDCKKALEEAGGDIEKAKEILRVKGLAKAEKKAGRETKEGLIYVIVSEDR
EFTS_LACPL      MAKISAAQVKELRDKTGVGMMDAKKALVETEGDMEKAVDVLREKGVAKAEKKSGRVAAEGIAAVAIKDN-
EFTS_ENTFA      MADVTAKMVKELRDMTGVGMMDAKKALVKVEGDMEKAVDFLRENGMAKAAKKNDRIAAEG--LANVATVG
EFTS_SILST      --AITAAMVKELRESTGAGMMDAKKALVENDGDMEAAVDWLRTKGLAKAAKKSGRTAAE--XXXXXXXXX
EFTS_AZOSE      MAEITASMVKELREKTDAPMMECKKALTEAAGDLAKAEEILRVKLGSKASKAASRVTAEGIVATWQSADG
EFTS_ACIF5      --AISAQQVKELRERSGAGMMECKTVLTEAEGDMEAAIDLLRARGLAKADKKASRVAAEGVIVTALSEDQ
EFTS_ACIF2      --AISAQQVKELRERSGAGMMECKTVLTEAEGDMEAAIDLLRARGLAKADKKASRVAAEGVIVTALSEDQ
EFTS_LACS1      MAKISAAQVKELRDKTGVGMMDAKKALVAVEGDMEKAIDFLREKGMAKAAKKSDRVAAEG--LANVAVNG
EFTS_DEIRA      --------IKKLREMTGAGMMDVKKALADAEGNEDKAIALLRERGIAKAVKKGDREAKEGIVRFAV--DG
EFTS_THISH      ---ITASMVKELRERTGAGMMECKKALAETNGDMEAAIELMXXXXXXXXXXXXXXXXXEGQVVVALSDDA
EFTS_RALSO      MAAITASMVAELRAKTDAPMMECKKALTEAEGNMEKAEEILRVKLGNKAGKAAARITAEGVIASFI--DG
EFTS_RALEH      MAAITASMVAELRAKTDAPMMECKKALTEADGDLDKAEELLRVKLGNKASKAASRVTAEGVVASFI--DG
EFTS_PEDPA      MASISAKLVKELRDKIGVGMMDAKKALVATEGDMDKAVDFLREKGIAKAAKKSDRVAAEG--LADVEMHD
EFTS_AGRT5      MTEITAAMVKELREKSGAGMMDCKKALAETNGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--VATMG
EFTS_JANSC      --AITASMVKELRDTTGAGMMDAKKALTETDGDMDAAVDWLRTKGLAKAAKKSGRTAAEG--LXXXXXXX
EFTS_RICTY      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRKKGLAAAVKKFGRIASEG--LTAIKING
EFTS_LACBA      ---ITAAQVKELRDKTQVGMMDAKKALVASEGDMDKAIDFLREKGIAKAKKKSGNVAANG--LARVKEDG
EFTS_CUPTR      MAAITASMVAELRAKTDAPMMECKKALTEADGDLNKAEELLRVKLGNKASKAASRVTAEGVVAAFI--DG
EFTS_CLOPS      ---ITAKAVKELRERTGAGMMDCKKALTETNGDMEKAVEVXXXXXXXXXXXXXXXXXXXXIVKTYVSEDM
EFTS_AGRRK      MTEITAALVKELREKSGAGMMDCKKALIETNGDIEAAIDWLRAKGISKADKKSGRTAAEGLV--AIAGAG
EFTS_PARL1      MAEITASMVKQLRETTGAGMMDCKSALTETGGDMEAAIDWLRTXXXXXXXXXXXXXXXXXLIGVVAN--G
EFTS_BURM1      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BORPE      MAEITAALVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYIAADG
EFTS_BORPA      MAEITAALVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYIAADG
EFTS_BORBR      MAEITAALVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYIAADG
EFTS_BURTA      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURPS      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURP6      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURP1      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURP0      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURMS      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURMA      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURM9      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_BURM7      MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEGVVASFVG--A
EFTS_FLAPJ      MATITAADVNKLRTITGAGMMDCKKALVESDGDFDLAIENLRKKGQKVAANRSDRESTEGAAIAVVNADN
EFTS_BREBN      --AISAQAVKELRERTGAGMMDCKRALEETAGDMEKAIDLLRERGVAKAAKKSGRIAAEG--LXXXXXXX
EFTS_RALEJ      MAAITASMVAELRAKTDAPMMECKKALTEADGDLNKAEELLRVKLGNKASKAASRVTAEGVVASFI--DG
EFTS_NITHX      MATITAAMVKDLRETTGVGMMDCKQALTENDGDMQAAIDWXXXXXXXXXXXXXXXVAAEGLIGAVTSGN-
EFTS_BURP8      MAAITASMVAELRAKTDAPMMECKKALTEADGDMARAEELLRVKLGNKASKAASRVTAEGVIASFIEGGA
EFTS_THEFY      MANYTAADVKRLRELTGAGMMACKKALEESGGDFDKAIEALRIKGAKDVGKRAERTAANG-LIALAQDGD
EFTS_TERTT      --AVSASLVKELRERTGLGMMECKKALAETDGDIDAAIENLRKASGLKAAKKADRTAAEGVVAAKVADDG
EFTS_RALPJ      MAAITASMVAELRAKTDAPMMECKKALTEAEGNLEKAEEILRVKLGNKAGKASSRVTAEGVVAAFV--EG
EFTS_THICR      --AVTASMVKELREATGAGMMDCKKALAETDGNMEEAIEFLRXXXXXXXXXXXXRTAAEGVIAIAVSDDK
EFTS_OCEIH      --AITAQMVKELREKTGAGMMDCKKALQETNGDIEQAIDFLREKGMXXXXXXXXXXXXEG--LTHIEVEG
EFTS_MACCJ      --AITAQLVKQLRERTGAGMMDCKKALTETNGDIDAAVDYLXXXXXXXXXXXXXXXXXXXTTY--VASSG
EFTS_CLONN      ---VTAKMVKELRERTGAGMMDCKKALTETDGDMEKAVEFXXXXXXXXXXXXXXXXXXXXLVTTYLSEDN
EFTS_RALME      MAAITASMVAELRAKTDAPMMECKKALTEADGDLGKAEELLRVKLGNKASKAASRVTAEGIVVSYI--DG
EFTS_BURXL      MAAITASMVAELRAKTDAPMMECKKALTEADGDMARAEELLRVKLGNKASKAASRVTAEGVVASFIGGNA
EFTS_NITEC      MAEITASMVKELRELTGLGMMECKKALSEAGGDMKAAEDLLRXXXXXXXXXXXXXXXXEGVISGFITVDG
EFTS_IDILO      --AITAALVKELRERTGAGMMDCKKALQEVDGDMEAAIELMRKSGQXXXXXXXXXXXXEGVIL--VKSEG
EFTS_SYMTH      MAEITAKMVAELRARTGAGMMDCKKALMETGGDFDKAVDWXXXXXXXXXXXXXXXXXXXXXVHAIVEDGA
EFTS_LACSS      MAEIKAAQVMELRKKTGVGIMDAKKALVASDGNVEEAIDALREKGMAKAAKKNDRIAAEG--LAGVAIDG
EFTS_PROMH      MSGITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGIILAEVAADG
EFTS_CYTH3      MSTITAAEVNKLRTMTGAGMMDCKKALTESGGDFEAAIDILRKKGQKVSAARAENTTSEGIVSITVSADG
EFTS_CHRVO      MAEITAKMVSDLRVATGLGMMECKKALVEAEGDFAKAEEILRIKSGSKASKMAGRLAAEGIIGSYVEGGV
EFTS_CHLT3      MAEISAKAVKDLRDKTGVGMMECKKALQETDGDMEKAVEFLXXXXXXXXXXXXXXXXXEGVIAVKTTEDS
EFTS_BURCJ      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BACHD      --AITASMVKELREKTGAGMMDCKKALTETNGDMDKAIDYLREKGIXXXXXXXXXXXXEG--LAYVKAEG
EFTS_NITEU      MAEITASMVKELRELTGLGMMECKKALVEADGDMKAAEDLLRXXXXXXXXXXXXXXXXEGVISGFVTADG
EFTS_METCA      --SITAGMVKELRERTGSGMMECKKALTETGGDLEAAVELMRKQGLAKADKKSGRTAAEGRICARVSEDG
EFTS_HAEDU      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARVASGF
EFTS_BORA1      MAEITAALVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAASRVTAEGLIGLFIAADG
EFTS_BACLD      --AITAQMVKELREKTGAGMMDCKKALTETDGNMDKAIDLL--XXXXXXXXXXXXXXXXXXXLTLIKTDG
EFTS_ORITB      ---ISISLVKKLRDATGAAMTSCKQALQEAKGDIEEAIKVLRKTNLAQMSSKLQRKADEGIVALAV--DN
EFTS_BURVG      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_PSYIN      ---VTAKQVKELRDRTAAGMMDCKKALVEAEGDLELAIENMRKSXXXXXXXXXXXXXXXXXILAKV--EG
EFTS_BURCM      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BURA4      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BURCH      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BURCC      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BURCA      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_RICFE      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_PROA2      MSQISAKDVKDLRDKTGVGMMDCKKALEETGGDMQKAIEYXXXXXXXXXXXXXXXEASEGIIAIRISDDN
EFTS_CHLTE      MSQISAKDVKELRDTTGVGMMECKKALEETGGDMQKAVEYLXXXXXXXXXXXXXXXXSEGVVCILMSDDQ
EFTS_ACICJ      MADITGAMVKDLREKTGAGMMDCKKALVETDGDMEAAVDWLRXXXXXXXXXXSGRTAAEGLVG--VAHEG
EFTS_BURS3      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGNKASKAASRVTAEGVVASFVGGNA
EFTS_BACP2      --AITAQLVKELRQKTGAGMMDCKKALTETDGDIDKAIDLL--XXXXXXXXXXXXXXXXXXXLTLIKTDG
EFTS_ZYMMO      MAEITAAAVKALRERTGAGMMDCKKALNEANGEMEAAVDWLRXXXXXXXXXXSGRQAAEGLVGVMI--DG
EFTS_MARMM      MAGITAALVKELRDKTGVGMMDCKKALGETDGDFEAAVDWLRKKGLSKAAKKADRVAAEGLV--AVATQG
EFTS_LACRJ      MAEIKAAQVMQLRKKSGAGIMDAKKALVASDGDMDKAMDYLREKGIAKAAKKSDRVAAEG--LADIAVNG
EFTS_LACRD      MAEIKAAQVMQLRKKSGAGIMDAKKALVASDGDMDKAMDYLREKGIAKAAKKSDRVAAEG--LADIAVNG
EFTS_HAHCH      MAAISASMVKELRERTGLGMMECKKALVEAEGDIEKAIEDLRKSSGMXXXXXXGRVSADGVVAVKVSDDN
EFTS_BURPP      MAAITASMVAELRAKTDAPMMECKKALTEADGDMARAEELLRVKLGNKASKAASRVTAEGVVASFIGGNA
EFTS_STRCO      MANYTAADVKKLRELTGAGMMDCKKALDEAEGNVEKAVEALRIKGQKGVAKREGRSAENGAVVSIIADDN
EFTS_MICLC      MANYTAADIKALRERTGAGMMDVKKALDEADGDAEKAIEIIRVKGLKGATKREGRSAAEGLVAATVENGV
EFTS_DICNV      --AVSAQLVKQLRERTGAGMMECKKALTETNGDIDAAIELMRKTGMAKADKKASRVAAEGTLVVSISDDQ
EFTS_NITWN      MATITAAMVKELREITGVGMMDCKQALTENNGDMQAAIDWXXXXXXXXXXXXXXXVAAEGLIGVVTSGN-
EFTS_ACTPJ      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIG--A
EFTS_BRAJA      MATITAAMVKDLRESTGAGMMDCKAALTENDGNMEAAQDWXXXXXXXXXXXXXXXVAAEGLIGALTK--G
EFTS_PASMU      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIG--A
EFTS_HAMD5      MAHISATLVKELRERTGAGMMECKKALVDTQGDVELAIDNMRKSGQXXXXXXSGRVASEGVILLEISSEQ
EFTS_RHORT      MAEITAALVKSLREQTGAGMMDCKKALTETAGDVEAAIDWXXXXXXXXXXXXXXXTASEXXXXXXXXXXX
EFTS_JANMA      MAVITAAMVGELRALTDAPMMECKKALTEADGDPVKAEEILRVKLGSKASKAATRVTAEGVVAAYVSGNV
EFTS_BACWK      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_STRAW      MANYTAADVKKLRELTGAGMMDCKKALDEAEGNVEKAVEALRIKGQKGVAKREGRSAENGAVVSVIADDN
EFTS_RICBR      ---ISASDVRELREKTGAGMMDCKKALIETKGNLEEAVDFLRTXXXXXXXXXXXXXXXXXLTAAKV--DG
EFTS_RICB8      ---ISASDVRELREKTGAGMMDCKKALIETKGNLEEAVDFLRTXXXXXXXXXXXXXXXXXLTAAKV--DG
EFTS_NEIG1      MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKSGAKAGKLAGRTAAEGVLAYAINGNV
EFTS_DINSH      --AITAALVKELRDKTGAGMMDAKKALTETDGDMEAAVDWLRTKGLAKAAKKSGR--TXXXXXXXXXXXX
EFTS_CHLPB      MSQISAKAVKELRDKTGVGMMDCKKALDESGGDMQKAVEYXXXXXXXXXXXXXXXXXXXXVVIVKINDAA
EFTS_BACSU      --AITAQQVKELREKTGAGMMDCKKALTETDGDMDKAIDLLXXXXXXXXXXXXXXXXXXXSTL--IKTDG
EFTS_ACTP7      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIG--A
EFTS_ACTP2      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIG--A
EFTS_NEIMF      MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKSGAKAGKLAGRTAAEGVLAYAINGNV
EFTS_NEIM0      MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKSGAKAGKLAGRTAAEGVLAYAINGNV
EFTS_MANSM      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIAEG-
EFTS_BRASO      MANITAAMVKDLRESTGAGMMDCKAALTETGGDMQAAQDWXXXXXXXXXXXXXXXVAAEGLIGALTS--G
EFTS_BACC2      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_NEIMB      MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKSGAKAGKLAGRTAAEGVLAYAINGNV
EFTS_NEIMA      MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKSGAKAGKLAGRTAAEGVLAYAINGNV
EFTS_GEOKA      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDWLXXXXXXXXXXXXXXXXXXX--MAYIAVEG
EFTS_CELJU      MSAVTPALVKELRDRTGLGMMECKKALGDANGDIELAIENLRKVSGLKAAKKEGRTXXXXXXXXXXXXXN
EFTS_STAES      --AISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVHVEVKDN-
EFTS_STAEQ      --AISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVHVEVKDN-
EFTS_RHOP2      MATITAAMVKELRETTGVGMMDCKQALAENDGNMEAAVDWXXXXXXXXXXXXXXXVAAEGLIGALT--DG
EFTS_BACCN      --AITAQMVKELREKTGAGMMDCKKALTEMNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTYIETKG
EFTS_AGRVS      MTEITAAMVKELREKSGAGMMDCKKALAENGGDMEASIDWLRAKGIAKADKKSGRTAAEGLIG--IASSG
EFTS_AERHH      MANISAALVKELRERTAAGMMDCKKALEEAAGDIELAIENMRKSGQXXXXXXXXXXXXEGVIFA--RTEG
EFTS_STRRA      MANYTAADVKKLRELTGAGMMDCKKALDEAEGNVEKAVEALRIKGQKGVAKREGRSAENGAVVSIIADDN
EFTS_STAAW      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAT      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAS      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAR      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAC      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAA8      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAA3      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_RICPR      ---ISAVVVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRKKGLAAAVKKSGRIASEG--LTAVKVDG
EFTS_RICM5      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_PARDP      --AITAAMVKDLRETTGAGMMDAKKALTETNGDMEAAIDWLRTKGLAKAAKKSXXXXXXXXXXXXXXXXX
EFTS_HAES2      MAEITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVIRVRIG--S
EFTS_HAES1      MAEITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVIRVRIG--S
EFTS_BACHK      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACCZ      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACC3      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACC0      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACAN      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACAH      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACAC      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACAA      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_AERS4      MANVTAALVKELRERTAAGMMDCKKALEEAAGDIELAIENMRKSGQXXXXXXXXXXXXEGVIFA--RTEG
EFTS_BACA2      --AITAQQVKELRQKTGAGMMDCKKALTETDGDMDKAIDLLXXXXXXXXXXXXXXXXXXXSTL--IKTDG
EFTS_CHRSD      MAAISASLVKELRERTGLGMMECKKALTEADGDIETAIENLRKNSGLXXXXXXERTAAEGGVVTRVAEDG
EFTS_BDEBA      --SISATLVKELREKTNAGMMDCKKALEATSGDFNAAVEWLRVKGLXXXXXXXXXXXXXXXVFAELHGN-
EFTS_BACCQ      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACC7      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACC1      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_STAAN      MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAM      MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAE      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAAB      MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAA9      MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAA2      MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_STAA1      MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVH--VETKG
EFTS_PORGI      --AVTIQDIAKLRKMSGAGMMDCKNALEESNNDFEKAMEIIRKKGQAVAAKRSDREAAEGCVLS--ADKD
EFTS_PORG3      --AVTIQDIAKLRKMSGAGMMDCKNALEESNNDFEKAMEIIRKKGQAVAAKRSDREAAEGCVLS--ADKD
EFTS_LEUCK      --AITAAQVKELRDKTSVGMMDAKKALVEADGDLEKAIDLLREKGMAKAAKKGDRVAAEG--MTFVAVKG
EFTS_STAHJ      --AISAKLVKELRERTGAGMMDCKKALTETDGDIDKAIDYLXXXXXXXXXXXXXXXXXXXLVHVEVK--G
EFTS_RICSI      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_RICRS      ---ISAVAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_RICRO      ---ISAVAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_RICCN      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_RHIE6      MSEITAAMVKELREKTGAGMMDCKKALAETNGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--VSSEG
EFTS_GRABC      MAEITAALVKELRETTGAGMMDCKKALSETNGDLEAAIDWXXXXXXXXXXXXXXXVAAEGLVG--VASAP
EFTS_RHOPS      MATITAAMVKELRETTGVGMMDCKQALAENDGNMEAAVDWXXXXXXXXXXXXXXXVAAEGLIGALT--DG
EFTS_POLNS      MVAITAAMVGELRAKTDAPMMECKKALTEADGDMARAEEILRVKLGSKAGKAASRVTAEGIVAA--SINS
EFTS_MAGSA      MAEITASLVKELREKTGAGMMDCKKALGETAGDVEAAIDWXXXXXXXXXXXXXXXXXXEGLVG--IAAAG
EFTS_LARHH      MAEITAKMVADLRAATGLGMMECKKALVESEGDMAKAEEILRIKSGAKAGKLXXXXXXXXXXXXFSSADG
EFTS_HAEPS      MAEITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARIG--A
EFTS_HAEIG      MAEITASLVKELRDRTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARVENG-
EFTS_HAEI8      MAEITASLVKELRDRTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARVENG-
EFTS_AZOVD      MAEITAALVKELRERTGQGMMECKKALVAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVKVSDDN
EFTS_SILPO      --AITAALVKELRDSTGAGMMDAKKALTETDGDMEAAVDWLRTKGLAKAAKKSGR--TXXXXXXXXXXXX
EFTS_RICAE      ---ISAVAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_ERYLH      MAGFTAADVKKLREMSGAGMMDAKKALEETGGDLEAAVDALRAKGLAAVQKKSSRTAAEGLVGVAV--EG
EFTS_RICAH      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFXXXXXXXXXXXXXXXXXXEG--LTAVKVDG
EFTS_RHILW      MSEITAAMVKELREKTGAGMMDCKKALAETGGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--VSSQG
EFTS_FRAP2      MSNISAKLVKELRERTGAGMMECKKALVEAAGDIEKAAEEMRISGQAKADKKASRIAAEGVIEVYAADG-
EFTS_RICCK      ---ISAVVVKALREKTGAGMMDCKNALIETRGNFEEAIDFXXXXXXXXXXXXXXXITSEGLTAAKV--EG
EFTS_HERAR      MAVITAAMVGELRALTDAPMMECKKALTEADGDPVKAEEILRVKLGSKASKAASRVTAEGVVASCVVGNV
EFTS_BACCR      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_BACC4      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDFLXXXXXXXXXXXXXXXXXXX--LTFIETNG
EFTS_HAEIN      MAEITASLVKELRDRTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARVENG-
EFTS_HAEIE      MAEITASLVKELRDRTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILARVENG-
EFTS_YERPY      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPS      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPP      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPN      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPG      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPE      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPB      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERPA      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERP3      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_YERE8      MVAITAALVKELRERTAAGMMECKKALVEANGDIELAIDNMRKSXXXXXXXXXXXXXXXXXXLAKVSADG
EFTS_HELHP      MADIPAQLVKQLREMTDAGMMDCKKALVETEGNLEKAVEYLREKGLSKAAKKADRIASEGIVSVEVANDF
EFTS_RICPU      ---ISAAAVKELREKTGAGMMDCKKALIETSGNFEKASDFXXXXXXXXXXXXXXXIASEGLTAAKV--DG
EFTS_POLSQ      MAAITAAMVGELRAKTDAPMMECKKALTEADGDMARAEEILRVKLGSKAGKAASRVTAEGIVATAI--NG
EFTS_LEUMM      --AITAAQVKELRDKTSVGMMDAKKALVEADGDLDKAIDLLREKGMAKAAKKGDRVAAEG--MTAVAVKG
EFTS_RHIEC      MSEITAAMVKELREKTGAGMMDCKKALAETSGDMEAAIDWLRAKGIAKADKKSGRTAAEGLVG--VSSEG
EFTS_PHOLL      MSGITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGIILAEVAADG
EFTS_LACF3      MAEISAKQVMELRKKSGAGIMDAKKALVASEGDMDKAMDYLREKGIAKAAKKSDRIAAEGLTDIVVK--G
EFTS_GEOTN      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDWLXXXXXXXXXXXXXXXXXXX--MTYIATEG
EFTS_ACIC1      MATFTTADVKRLRELTAAGMMDCKKALEEADGDFDKAVELLRIKGAKDVGKRAERTTANGLVAAATDDGV
EFTS_RHOP5      MATITAGMVKELRETTGVGMMDCKQALSENDGNMEAAIDWXXXXXXXXXXXXXXXVAAEGLIGALT--DG
EFTS_LEGPH      MSTISAALVMQLRERTGAGMMECKKFLIATNGDIEQAIIEMRXXXXXXXXXXXXRVAAEGIIVIARSSDE
EFTS_LEGPC      MSTISAALVMQLRERTGAGMMECKKFLIATNGDIEQAIIEMRXXXXXXXXXXXXRVAAEGIIVIARSSDE
EFTS_LEGPA      MSTISAALVMQLRERTGAGMMECKKFLIATNGDIEQAIIEMRXXXXXXXXXXXXRVAAEGIIVIARSSDE
EFTS_GEOSW      --AITAQMVKELREKTGAGMMDCKKALTETNGDMEKAIDWLXXXXXXXXXXXXXXXXXXX--MTLVEVDG
EFTS_CHLCH      MSQISAADVKNLRDITGAGMMDCKKALDETGGDMQQAIDFLXXXXXXXXXXXXXXXXHEGMIQVKLANDC
EFTS_CAMHC      ---ITAKMVKDLRESTGAGMMDCKKALVEANGDMEQAIKVLHEKGLGKAAKKADRLASEGLVCVLVNSDF
EFTS_ALCBS      -------MVKELRERTGLGMMECKKALVEADGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EFTS_LEGPL      MSTISAALVMQLRERTGAGMMECKKFLIATNGDIEQAIIEMRXXXXXXXXXXXXRVAAEGIIVIARSSDE
EFTS_BIFA0      MAAITAALIKQVREETGAGMMDVKKALTEADGDVARAKEIIRAKGIQAAGKREGRKAQEGTIASTVIDSA
EFTS_DEIDV      --------IKKLRELTGAGMMDVKKALSDAGNDEDKAVALLRERGIVXXXXXXXXXXXXGIVRFVV--EG
EFTS_RUTMC      ---ITASLVKELRQRTSAGMMDCKQALTETNGDMEAAIDLMRTSGAAKATRKAGRITIEGLVKVNISADK
EFTS_METS4      MANITAAMVKDLREKTGAGMMDCKSALNETAGDIEAAVDWXXXXXXXXXXXXXXXXXXEGLV--AVESAG
EFTS_METRJ      MANITAAMVKELREKTGAGMMDCKGALNETQGDIEAAVDWXXXXXXXXXXXXXXXXXXEGLV--AVESAG
EFTS_FRATW      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRATT      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRAT1      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_ARTCA      MANYTAADIKALRERTGAGMMDVKKALDEANGDAEKAIEIIRIKGLKGATKREGRSTAEGLVAAKVSNGV
EFTS_RHOPT      MATITAAMVKELRETTGVGMMDCKQALAETDGNIDAAIDWXXXXXXXXXXXXXXXVAAEGLIGALT--DG
EFTS_RHOPA      MATITAAMVKELRETTGVGMMDCKQALAETDGNIDAAIDWXXXXXXXXXXXXXXXVAAEGLIGALT--DG
EFTS_CAMC5      ---ITAQMVKELRESTGAGMMDCKKALSEADGDMQKAVDILREKGLGQAAKKADRLASEGLVSVEVCEHC
EFTS_ACTSZ      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVIVARIANG-
EFTS_MARAV      MAAITAAMVKELRERTGLGMMECKKALVEAEGNVETAIEEXXXXXXXXXXXXXXXTAAEGVSLVKVSDDN
EFTS_CHLPD      MSQISAKDVKHLRDTTGVGMMDCKKALEETGGDMQKAVEYXXXXXXXXXXXXXXXXXXEGIVCIALGDDH
EFTS_CAMC1      ---ITAQMVKELRESTGAGMMDCKKALGEANGDMEKAVDILREKGLGQAAKKADRLASEGLVSVEVCSKC
EFTS_ENT38      MAEITASLVKELRERTGAGMMDCKKALVEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVILTKI--DG
EFTS_METNO      MANITAAMVKDLREKTGAGMMDCKSALNETAGDIEAAVDWXXXXXXXXXXXXXXXXXXEGLVA--VESAG
EFTS_FRATO      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRATN      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRATM      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRATH      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_FRATF      MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISGQAKADKKASRVAAEGVIEVYAADG-
EFTS_STRGG      MANYTAADVKKLRELTGAGMMDCKKALDEADGNVDKAVEALRIKGQKGVAKREGRSAENGAVVSLISEDQ
EFTS_OENOB      MAQITAALVKELREKTSAGIMDAKKALVETNGNMEKAIDVLKERGXXXXXXXXXXXXXEG--MTDVIEAG
EFTS_LACCB      MAQITAAQVKELRDRTQVGMMDAKKALVAADGDMDKAIDVLREKGLAKAAKKSGNIAAEG--LAEIAVNG
EFTS_LACC3      MAQITAAQVKELRDRTQVGMMDAKKALVAADGDMDKAIDVLREKGLAKAAKKSGNIAAEG--LAEIAVNG
EFTS_DELAS      MAAITASMVAELRAKTDAPMMECKKALTEAEGDLVKAEELLRVKLGTKAGKAASRVTAEGVIAAFI--NG
EFTS_AZOPC      --AVTKLDVQYLRKMTGAGVMDCRNALREAEGNYDKAVEVIRKKGKVIASKRESREASEGCVLA--SSKQ
EFTS_ACISJ      MAAITASMVAELRGKTDAPMMECKKALTEADGDMAKAEELLRVKLGTKAGKAASRVTAEGVVASFINGNV
EFTS_METFK      MAEITASMVKELRERTDAPMMDCKKALTEAEGDMARAEEILRVRFGNKASKXXXXXXXXXXXXXSIKADG
EFTS_TOLAT      MADITAAMVKELRERTAAGMMDCKKALTEANGDIELAIENMXXXXXXXXXXXXXXXXXXXXXXXXXXXNV
EFTS_SALRD      --SVSAKQVKELRDATGVGMMDCKEALQETDGDFDEAVSLLRKKGQXXXXXXXXXXXXXGLVVTAVSDDG
EFTS_SPHWW      MAEITAAAVKELREKSGAGMMDCKKALTETNGDMEAAVDWLRTKGLXXXXXXXXXXXXEGLVG--VSVEG
EFTS_ENTS8      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--EG
EFTS_CHLP8      MSQISAKDVKELRDTTGVGMMECKKALEETGGDMQKAVEYLXXXXXXXXXXXXXXXXSEGAVCILMSDDQ
EFTS_PSEAE      MAEITAAMVKELRERTGLGMMECKKALTAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVKIAADN
EFTS_PSEAB      MAEITAAMVKELRERTGLGMMECKKALTAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVKIAADN
EFTS_PSEA7      MAEITAAMVKELRERTGLGMMECKKALTAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVKIAADN
EFTS_SPIPL      MAAVTAALVKELRERTGLGMMECKKALVEAEGDIERAIDDLRKSXXXXXXXXXXXXXXXXXIAVAVSGDG
EFTS_SPICI      ---VTAQLVKELRDRTGAGMLDCKKALEDTGGNIEEAITWLREKGITKAAKKSDRVAAEGLVGLVTKGD-
EFTS_RHIL3      MSEITAAMVKELREKTGAGMMDCKKALAETAGDMEAAIDWLRAKGIAKADKKSGRTAAEGLIG--VSSQG
EFTS_PSEA8      MAEITAAMVKELRERTGLGMMECKKALTAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVKIAADN
EFTS_PELPB      MSQISAKDVKNLRDITGAGMMDCKKALDETGGDMQQAIDYXXXXXXXXXXXXXXXXXXEGMVEIKMTADH
EFTS_PHOPR      MATVTAALVKELRERTAAGMMDCKKALVEADGDIELAIDNMRXXXXXXXXXXXXNIAAEGTI--IIKEVD
EFTS_EXIS2      --AITAAMVKELREKTGAGMLDCKKALVEADGDMNAAIDFL--XXXXXXXXXXXXXXXXXXXLTAVAVNG
EFTS_CHLL2      MSQISAKDVKDLRDITGVGMMDCKKALEESAGDMQKAIEYXXXXXXXXXXXXXXXXXXXXMVAIRLSEDR
EFTS_XANP2      MAAITAGLVKELRDKTGAGMMDCKSALTETNGDIEAAIDWXXXXXXXXXXXXXXXXXXEGLV--AVESSG
EFTS_TREDE      ---IKASDVKELRDKTGAGMMECKKALQHCNGDAKEAEKYLKEKGLAAVEKRADRVTSEGII--VIKSDH
EFTS_PSEU5      MAEITAALVKELRERTGQGMMECKKALVAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVRV--EG
EFTS_KLEP7      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--EG
EFTS_KLEP3      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--EG
EFTS_PSEA6      --AVTAALVKELRERTAAGMLDCKNALVEANGDIELAIENMRKNGQXXXXXXXXXXXXEGVILTKVANGV
EFTS_PELLD      MSQISAKDVKDLRDTTGIGMMDCKKALEETGGDMEKAIEYLRXXXXXXXXXXXXXXXSEGMICIRVSADR
EFTS_HALOH      --------IKELRSRTGAGVLDCKKALAETNGDIDAAVEYLXXXXXXXXXXXXXXXXXXXXXNVYISDDR
EFTS_METPB      MANITAALVKELREKTGAGMMDCKGALNETNGDLEAAVDWXXXXXXXXXXXXXXXXXXEGLV--AVESAG
EFTS_SACD2      --AVSASLVKELRERTGLGMMECKKALVETDGDIDVAIENLRKASGLKAAKKADRTXXXXXXXXXXXXDG
EFTS_RHOSK      --AITAQMVKELRESTGAGMMDAKKALTETDGDMEAAVDWXXXXXXXXXXXXXXXXXXEGLVGVCV--DG
EFTS_RHOS4      --AITAQMVKELRESTGAGMMDAKKALTETDGDMEAAVDWXXXXXXXXXXXXXXXXXXEGLVGVCV--DG
EFTS_RHOS1      --AITAQMVKELRESTGAGMMDAKKALTETDGDMEAAVDWXXXXXXXXXXXXXXXXXXEGLVGVCV--DG
EFTS_CITK8      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_AZOC5      MAAITAGLVKELRDKTGAGMMDCKAALTENNGDIEAAIDWXXXXXXXXXXXXXXXXXXEGLV--AVESSG
EFTS_XYLFT      ---ITASLVKELRERTGVGMMECKKALSENAGNIDASVEWLRKSGLVKADKKAGRIAAEGRI--VVVHDG
EFTS_KINRD      MAAYTAADVKALREKTGAGMLDCKNALVESEGDVEKAIELLRIKGQKGVAKREDRDASNGLV--AVHTDG
EFTS_SHISS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SHIFL      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SHIF8      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SHIDS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SHIBS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SHIB3      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ESCF3      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOUT      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOSM      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOSE      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOLU      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOLI      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOLC      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOL6      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOL5      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOHS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECODH      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECOBW      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO8A      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO81      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO7I      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO5E      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO57      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO55      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO45      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO27      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_ECO24      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_CAMFF      ---ISASMVKELRESTGAGMMDCKKALQESNGDMQKAVDILREKGLGKAAKKADRLASEGLVSVVVSENN
EFTS_EXISA      --AVTAAMVKELREKTGAGMLDCKKALVETDGDMQAAIDFL--XXXXXXXXXXXXXXXXXXXLTAVAVEG
EFTS_WOLSU      MAEITAQLVKQLREMTDAGMMDCKKALVETDGDIEKAVEYLREKGLSKAAKKADRXXXXXXXXXXXXXDF
EFTS_NEOSM      MSKINLEDLKSLSKETSAGLVHCKQALSEAHGDLTRAREILKELGHAVSVKKANRGARDGVVGALSS--G
EFTS_METEP      MANITAALVKELREKTGAGMMDCKGALNETNGDLEAAVDWXXXXXXXXXXXXXXXXXXEGLV--AVESAG
EFTS_METC4      MANITAALVKELREKTGAGMMDCKGALNETNGDLEAAVDWXXXXXXXXXXXXXXXXXXEGLV--AVESAG
EFTS_SERP5      MADITAALVKELRERTGAGMMDCKKALVESNGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--EG
EFTS_PSEF5      MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--AIKDDG
EFTS_PARUW      MAAVTPALIKELRERTGVGMGKCKEALEEANGDMELAIANLRKAGMASAVKKEGRETKEG--MIGTAENE
EFTS_CHLMU      MSDFSMETLKSLRQRTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAGKKEHRETKEGVIAASV--DE
EFTS_ALISL      MATVTAALVKELRERTAAGMMECKKALVEAEGDIELAIENMRKSXXXXXXXXXXXXXXXXTI--IIKEEA
EFTS_XYLFA      ---ITASLVKELRERTGVGMMECKKALSENAGNIDAAVEWLRKSGLVKADKKAGRIAAEGRI--VVVHDG
EFTS_RHOPB      MATITAAMVKDLRETTGVGMMDCKQALTENDGDMQAAIDWXXXXXXXXXXXXXXXVAAEGLIGALT--DK
EFTS_PSEFS      MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--ALKEDG
EFTS_SALTY      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALTI      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALSV      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALNS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALHS      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALG2      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALEP      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALDC      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALCH      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALAI      MSNFTAADVKKLRDLTGAGMMDSKKALTEAEGDFDKAIEILRVKGAKDVGKRAGRTAANGLV-------A
EFTS_COXBU      MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIXXXXXXXXXXXXXXXXXXXXEGVIVIAISKDQ
EFTS_COXBR      MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIXXXXXXXXXXXXXXXXXXXXEGVIVIAISKDQ
EFTS_COXBN      MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIXXXXXXXXXXXXXXXXXXXXEGVIVIAISKDQ
EFTS_COXB2      MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIXXXXXXXXXXXXXXXXXXXXEGVIVIAISKDQ
EFTS_ACIAC      MAAITASMVAELRAKTDAPMMECKKALTEADGDLAKAEELLRVKLGTKAGKAAARITAEGVVASFI--EG
EFTS_VIBCM      --AVTAALVKELRERTGAGMMECKKALVETNGDIELAIENMRKSXXXXXXXXXXXXXXXXTIM--IKEGE
EFTS_VIBCH      --AVTAALVKELRERTGAGMMECKKALVETNGDIELAIENMRKSXXXXXXXXXXXXXXXXTIM--IKEGE
EFTS_VIBC3      --AVTAALVKELRERTGAGMMECKKALVETNGDIELAIENMRKSXXXXXXXXXXXXXXXXTIM--IKEGE
EFTS_SALPK      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_SALPA      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_METPP      MPAITASMVAELRAKTDAPMMECKKALTEAEGDLNKAEELLRVKLGSKASKAASRVTAEGIVVAHIS--G
EFTS_XANCP      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_XANC8      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_VIBHB      MATVTAALVKELRERTGAGMMECKKALVEANADIELAIENMRKSXXXXXXXXXXXXXXXXXI--IIKEEN
EFTS_NAUPA      MANITAAMVKALREKTGAGMMDCKKALVEAEGNEEKAVEILRXXXXXXXXXXXXXXXXEGRVEIYISDDY
EFTS_WOLWR      --------IRELRDRTGLGLSDCKKALEECDGDIKKAVDKLRTIGLAKADKKSDRVASDGLVAMCLTENC
EFTS_VIBVY      --AVTAALVKELRERTGAGMMECKKALVETNGDVELAIENMRKSXXXXXXXXXXXXXXXXXI--FIKEEN
EFTS_VIBVU      --AVTAALVKELRERTGAGMMECKKALVETNGDVELAIENMRKSXXXXXXXXXXXXXXXXXI--FIKEEN
EFTS_SALA4      MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKINGNV
EFTS_PSYWF      MSKISAKLVKELRDRTGLGMMECKKALEETNGDVEQAIDNLRKSXXXXXXXXXXXXXXXXXI--VIAQEG
EFTS_MYCUA      MANFTAADVKRLRELTGAGMLACKNALAESDGDFDKAVEALRIKGAKDVGKRAERATAEGLVA------A
EFTS_MYCMM      MANFTAADVKRLRELTGAGMLACKNALAESDGDFDKAVEALRIKGAKDVGKRAERATAEGLVA------A
EFTS_COXB1      MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIXXXXXXXXXXXXXXXXXXXXEGVIVIAISKDQ
EFTS_ALTMD      --AVTAALVKELRERTGAGMLDCKKALVETDGDIELAIENMRKSGQXXXXXXXXXXXXEGVILTKV--EG
EFTS_SALTO      MSNFTAADVKKLRDLTGAGMMDSKKALTEAEGDFDKAVEVLRVKGAKDVGKRAGRTAANGLV-------A
EFTS_PECCP      MAEITASLVKELRERTAAGMMECKKALVEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_MESFL      --AVNAQLIKELREITQAGMMDCKKALEATDGNIEDAIVWLRENGLAKAAKKSDRVAAEG--VALAKEDD
EFTS_SODGM      MADITAALVKELRERTGAGMMECKKALVEAQGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILTKIAQDG
EFTS_PROVI      MSQISAKDVKDLRDTTGVGMMDCKKALEETGGDMQKAVEYLRXXXXXXXXXXXXXXXSEGMICIKVAEDR
EFTS_ONYPE      ---ITAEMIKDLRQKTHAGMKECHKALQQTEGNIEKAIVFLREKGIIKAAQKQGRATSEGITNIVF--DG
EFTS_ERWT9      MADITAALVKELRERTGAGMMDCKKALTEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTRI--EG
EFTS_CORA7      MANYTAADVKALREATGAGMLDCKKALDESQGDYDKAVEYLRIKGAKNVSKRAEREATEGLI-------A
EFTS_VESOH      ---ITASLVKKLRQRMGAGMMDCKKALNATNGNIEKAIDLMRTLNTTKSAKKLDRITIEGLVKINISANK
EFTS_VARPS      MAAITASMVGELRAKTDAPMMECKKALTEADGNMEKAEELLRIKLGNKAGKASGRITAEGVVTAFV--DG
EFTS_RHOCS      MAEISAALVKELREKTGAGMMDCKKALTETSGDMEAAVDWLRXXXXXXXXXXS--XXXXXXXXXXXXXXP
EFTS_MYCA9      MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEVLRIKGAKDVGKRAERATAEGLVV------A
EFTS_BIFAA      MAAITAALIKQVREETGAGMMDVKKALTEAEGDVARAKEIIRAKGIQAAGKREGRKAQEGTIASTVVESA
EFTS_WOLPM      --------IRELRDRTGLGLSDCKKALEECDGDIKKAVDKLRTIGLAKADKKSDRVASDGLVAMCLTENC
EFTS_RHOE4      MANYTAADVKRLRELTGSGMMACKNALADADGDFDKAVEQLRIKGAKDVGKRAERTTAEGLVV------A
EFTS_PSEU2      MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--AIKDDG
EFTS_PSE14      MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--AIKDDG
EFTS_ERWCT      MAEITASLVKELRERTAAGMMECKKALVEANGDIELAIENMRXXXXXXXXXXXXXXXXXXVIKTKI--DG
EFTS_PSESM      MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--AIKDDG
EFTS_CLAM3      MANFTAADVKELRDRLGAGMMDSKNALVEADGDIEKAIEILRLKGQKGNAKRGDRSTAEGLVAASTQDGA
EFTS_LEIXX      MANISIADIKALREQLGTGMVDTKKALEEAGGDLEKATEILRLKGAKGNAKRADRSTSEGLVAAKENANG
EFTS_HELPG      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVVALEVAPDF
EFTS_EDWI9      MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSGQXXXXXXXXXXXXEGVILTKVAADG
EFTS_DECAR      MAAITAGMVAELRGKTDAPMMECKKALTEADGDMAKAEEILRVKLGNKASKAAVRIAAEGIVAVSISADG
EFTS_COLP3      --AITAAMVKELRERTAAGMMDCKNALVEAEGDMELAIENMRXXXXXXXXXXXXXXXXXXXXLIKTTDGL
EFTS_CLAMS      MANFTAADVKELRDRLGAGMMDSKNALVEADGDIEKAIEILRLKGQKGNAKRGDRSTAEGLVAASEQDGA
EFTS_BAUCH      MVAITTTLVKQLRDRTNAGLMKCKKALIEANGDIELAIDNLRKSGQITAANKSSRITAQGIILTKINHNS
EFTS_HELPY      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVVALEVAPDF
EFTS_AYWBP      ---ITAEMIKDLRQKTHAGMNECHKALQQTEGNIEKAIVFLREKGIIKAAQKQGRVTSEGITNIVFA--G
EFTS_RENSM      MANYTAADIKALRERTGAGMMDVKKALDEADGNAEKALELIRIKGLKGATKREGRSTAEGLVAA--TXXX
EFTS_PSYA2      ---VSAKMVKELRDRTGLGMMECKKALEESNGDVETAIDNLRXXXXXXXXXXXXXXXXXXXXXXXXXE--
EFTS_NOCFA      MANYTAADVKRLRELTGSGMMDCKNALAETDGDFDKAVELLRIKGAKDVGKRAERTTAEGLVA------A
EFTS_HELP2      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVVALEVAPDF
EFTS_BEUC1      MANYTAADIKTLREKSGAGMLDVKKALDEADGDAEKALEIIRVKGLKGVAKREGRSASEGLVAVKVTDAG
EFTS_PSEPF      MAAITAALVKELRERTGEGMMDCKKALEKAGGDIEKAIDDMRXXXXXXXXXXXXXXXXXXXI--AIKDDG
EFTS_MYCA1      MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEALRIKGAKDVGKRAERATAEGLVA------A
EFTS_BLOPB      ---INSDLIKELRKRTSIGVVECKQALIKANGDLELAIDNMRRSGLKTACKKSGHITSSGLIAVEITSNK
EFTS_MYCSS      MANYTAADVKRLRELTGAGMMASKNALVEADGDFDKAVELLRIKGAKDVGKRAERATAEGLVA------A
EFTS_MYCSK      MANYTAADVKRLRELTGAGMMASKNALVEADGDFDKAVELLRIKGAKDVGKRAERATAEGLVA------A
EFTS_MYCSJ      MANYTAADVKRLRELTGAGMMASKNALVEADGDFDKAVELLRIKGAKDVGKRAERATAEGLVA------A
EFTS_HELPH      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVIALEVAPDF
EFTS_HELAH      MSEISAQLVKKLRDLTDVGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIASEGVVALEVAPDF
EFTS_CHLTB      MSDFSMETLKNLRQQTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAGKKEHRETKEGVIAALV--DE
EFTS_BEII9      MANVTAAMVKELREKTGTGMMDCKNALNETGGDIEAAVDWXXXXXXXXXXXXXXXVAAEGLIALDV--EG
EFTS_PSYCK      ---VSAKMVKELRDRTGLGMMECKKALEESNGDVETAIDNLRXXXXXXXXXXXXXXXXXXXXXXXXXXX-
EFTS_MYCLE      MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVGKRAERATAEGLVA------A
EFTS_MYCLB      MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVGKRAERATAEGLVA------A
EFTS_HELPJ      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVVALEVAPDF
EFTS_ACIAD      MTAITASMVKELRDRTGLAMMECKKALTEANGDIELAIDNLRKSXXXXXXXXXXXXXXXXXITIV--QDG
EFTS_MYCPA      MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEALRIKGAKDVGKRAERATAEGLVA------A
EFTS_CORGB      MANYTAADVKKLRELTGSGMLDCKKALEESAGDFDKAVEILRVKGAKDVGKRAERNATEGLV-------A
EFTS_CAMJR      MAEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDF
EFTS_CAMJJ      MAEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDF
EFTS_CAMJ8      MAEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDF
EFTS_PSEMY      MAEITAALVKELRERTGQGMMECKKALVAAGGDIEKAIDDMRXXXXXXXXXXXXXXXXEGSIAVRV--EG
EFTS_MYCS2      MANYTAADVKRLRELTGAGMLDSKNALVEADGDFDKAVELLRIKGAKDVGKRAERATAEGLVA------A
EFTS_WOLTR      --------IRELRDRTGLGLSDCKKALEECSGDIKEAIGKLRAIGLAKADKKIDRVASDGLIAMHLAE--
EFTS_CORK4      MANYTAADVKKLREITGAGMMSCKKALEEADGDFDKAVEFLRIKGAKDVGKRAERTAAEGLI-------A
EFTS_CHLFF      MSNFSMETLKLLRQQTGVGLTKCKEALAECNGNLEEAVVYLRKLGLASASKKEHRETKEGVIAA--KSDA
EFTS_CHLT2      MSDFSMETLKNLRQQTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAGKKEHRETKEGVIAARV--DE
EFTS_CAMJD      MAEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDF
EFTS_CHLCV      MSNFSMETLKLLRQQTGVGLTKCKEALAECNGNLEEAVVHLRKLGLASASKKEHRETKEGVIAA--KSDA
EFTS_CAMJE      MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDF
EFTS_CHLTR      MSDFSMETLKNLRQQTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAGKKEHRETKEGVIAARV--DE
EFTS_XANAC      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_WOLPP      -----SSSIRELRDRTGLGLSDCKKALEECDGDIKKAVDRLRTIGFAKADKKSDRVASDGLIAMCLAKN-
EFTS_PELUB      --------VKQLREATGAGFKDCNLAIKESGGDLDKAVEILRVKGISKASKKMSRDAKEGVI--ATSGDE
EFTS_CHLAB      MSNFSMETLKLLRQQTGVGLTKCKEALAECNGNLEEAVVYLRKLGLASASKKEHRETKEGVIAA--KSDS
EFTS_BUCAP      MSHITALLIKELRLRTGAGFMECKRALIEEKGDIELSIDNLRKSGQARAEKKIHNITNQGLIFAKIKNKI
EFTS_EHRRW      ---VDINAIKELRDLTGAGVGDCKDALTSCNGDIEKAKTYLREQGIAKAYKKSNKDVSDGLVAICI--DG
EFTS_EHRRG      ---VDINAIKELRDLTGAGVGDCKDALTSCNGDIEKAKTYLREQGIAKAYKKSNKDVSDGLVAICI--DG
EFTS_EHRCJ      ---IDISAIKKLRDLTGAGVGDCKEALSSCDGDIEKAKNYLREQGIAKAYKKSTKDVSDGLIAIHV--DG
EFTS_CHLTA      MSDFSMETLKNLRQQTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAGKKEHRETKEGVIAALV--DE
EFTS_XANOR      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_XANOP      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_XANOM      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_HELPS      MSGISAQLVKKLRDLTDAGMMDCKKALVEVAGDLQKAIDFLREKGLSKAAKKADRIAAEGVIALEVVPDF
EFTS_ARTS2      MANYTAADIKALRERTGAGMMDVKKALDEANGDAEKAIEIIRIKGLKGATKREGRST--XXXXXXXXXXX
EFTS_XANC5      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_CORGL      MANYTAADVKKLRELTGSGMLDCKKALEESAGDFDKAVEILRVKGAKDVGKRAERNATEGLV-------A
EFTS_BIFLO      MAAITAALIKQVREDTGAGMLDVKKALTEAEGDVXXXXXXXXXXXXXXXXXXXXXXXQEGTIASKVVETA
EFTS_BIFLI      MAAITAALIKQVREDTGAGMLDVKKALTEAEGDVXXXXXXXXXXXXXXXXXXXXXXXQEGTIASKVVETA
EFTS_BIFLD      MAAITAALIKQVREDTGAGMLDVKKALTEAEGDVXXXXXXXXXXXXXXXXXXXXXXXQEGTIASKVVETA
EFTS_SPHAL      MAEITAALVKELRDRTGAGMMDCKKALAENNGDIEASIDWLRTXXXXXXXXXXXXXXXXXLVG--FATDG
EFTS_NITSB      --AISAAQVKELRERTGAGMMDCKKALQEANGDMDKAIEILRXXXXXXXXXXXDRVASEGTIAVQVSEDY
EFTS_CORDI      MANYTAADVKKLREITGSGMLDCKKALEETNGDFDKAVEVLRIKGAKDVGKRAERNATEGLI-------A
EFTS_XANCB      ---ITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLXXXXXXXXRVAAEGRI--ATAQAG
EFTS_RHOSR      MANYTAADVKRLRELTGSGMMACKNALAEAEGDFDKAVEQLRIKGAKDVGKRAERTTAEGLV---VSKD-
EFTS_RHOOB      MANYTAADVKRLRELTGSGMMACKNALAEAEGDFDKAVEQLRIKGAKDVGKRAERTTAEGLV---VSKD-
EFTS_POLSJ      --AITASMVAELRAKTDAPMMECKKALTEADGNFEKAEEILRVKLGNKAGKAASRVTAEGVI--AYHSEG
EFTS_BORHD      --SISPQEVKKLRDATGAGFGDCKKALDAVGGDFELAKKKLREMGIASADKRSGRDAKEGRVFSYVNKER
EFTS_VIBSL      MATVTAALVKELRERTAAGMMECKKALVAAEGDIELAIENMRKSXXXXXXXXXXXXXXXXXXXXXXXXXX
EFTS_MYCVP      MANYTAADVKRLRELTGAGMLDSKNALVEAEGDFDKAVELLRIKGAKDVGKRAERATAEGLVA------A
EFTS_ANAPZ      ---IDVEVIKELRQITGAGIGDCKEALESCSGDMDKAREYLREKGLSKAYKKSHRDVADGLVAVFAEGDV
EFTS_RHOS5      --AITAQMVKELRESTGAGMMDAKKALTETDGDMEAAVDWXXXXXXXXXXXXXXXXXXEXXXXXXXXXXX
EFTS_SACEN      M