[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55195.1

[Show Plain Result]


## Summary of Sequence Search
    1::461
   15::441     e-120  54%  442 aa  TRPB2_METMA RecName: Full=Tryptophan synthase beta chain 2;        
   15::441     e-118  54%  442 aa  TRPB2_METAC RecName: Full=Tryptophan synthase beta chain 2;        
    3::434     e-117  51%  434 aa  TRPB2_AQUAE RecName: Full=Tryptophan synthase beta chain 2;        
    4::446     e-113  48%  449 aa  TRPB2_AERPE RecName: Full=Tryptophan synthase beta chain 2;        
    4::421     e-112  49%  422 aa  TRPB_THELT RecName: Full=Tryptophan synthase beta chain;       
    5::438     e-110  49%  443 aa  TRPB_THEON RecName: Full=Tryptophan synthase beta chain;       
    8::434     e-109  49%  435 aa  TRPB2_ARCFU RecName: Full=Tryptophan synthase beta chain 2;        
    2::435     e-109  47%  446 aa  TRPB2_PYRFU RecName: Full=Tryptophan synthase beta chain 2;        
    7::421     e-109  50%  422 aa  TRPB2_THEMA RecName: Full=Tryptophan synthase beta chain 2;        
   16::444     e-108  47%  459 aa  TRPB_PYRHO RecName: Full=Tryptophan synthase beta chain;       
    3::411     e-108  50%  429 aa  TRPB2_METTH RecName: Full=Tryptophan synthase beta chain 2;        
    5::433     e-108  48%  440 aa  TRPB_THEGJ RecName: Full=Tryptophan synthase beta chain;       
    5::433     e-108  48%  442 aa  TRPB2_PYRKO RecName: Full=Tryptophan synthase beta chain 2;        
    4::414     e-107  49%  417 aa  TRPB_FERNB RecName: Full=Tryptophan synthase beta chain;       
   13::446     e-102  44%  451 aa  TRPB2_PYRAB RecName: Full=Tryptophan synthase beta chain 2;        
    7::419     e-101  47%  420 aa  TRPB_THEAB RecName: Full=Tryptophan synthase beta chain;       
   10::424     e-100  47%  428 aa  TRPB_DESK1 RecName: Full=Tryptophan synthase beta chain;       
    4::408     2e-90  49%  410 aa  TRPB_PYRAE RecName: Full=Tryptophan synthase beta chain;       
    2::416     2e-90  47%  425 aa  TRPB1_SULSO RecName: Full=Tryptophan synthase beta chain 1;        
    2::418     1e-88  45%  422 aa  TRPB1_SULTO RecName: Full=Tryptophan synthase beta chain 1;        
    4::408     4e-88  47%  409 aa  TRPB_PYRAR RecName: Full=Tryptophan synthase beta chain;       
    6::422     9e-87  41%  431 aa  TRPB2_SULTO RecName: Full=Tryptophan synthase beta chain 2;        
    6::422     1e-84  40%  429 aa  TRPB2_SULSO RecName: Full=Tryptophan synthase beta chain 2;        
    4::406     2e-83  44%  420 aa  TRPB_PYRIL RecName: Full=Tryptophan synthase beta chain;       
    3::419     8e-83  41%  426 aa  TRPB_THEVO RecName: Full=Tryptophan synthase beta chain;       
    9::417     6e-81  43%  419 aa  TRPB_PICTO RecName: Full=Tryptophan synthase beta chain;       
    3::417     6e-79  38%  424 aa  TRPB_THEAC RecName: Full=Tryptophan synthase beta chain;       
   55::414     4e-75  46%  427 aa  TRPB1_AERPE RecName: Full=Tryptophan synthase beta chain 1;        
   38::380     9e-29  35%  391 aa  TRPB_THEPX RecName: Full=Tryptophan synthase beta chain;       
   20::396     9e-29  33%  399 aa  TRPB_BACHD RecName: Full=Tryptophan synthase beta chain;       
   66::395     2e-28  39%  406 aa  TRPB_BRUSU RecName: Full=Tryptophan synthase beta chain;       
   66::395     2e-28  39%  406 aa  TRPB_BRUSI RecName: Full=Tryptophan synthase beta chain;       
   66::395     2e-28  39%  406 aa  TRPB_BRUC2 RecName: Full=Tryptophan synthase beta chain;       
   66::395     6e-28  38%  406 aa  TRPB_BRUME RecName: Full=Tryptophan synthase beta chain;       
   66::395     6e-28  38%  406 aa  TRPB_BRUMB RecName: Full=Tryptophan synthase beta chain;       
   66::395     6e-28  38%  406 aa  TRPB_BRUAB RecName: Full=Tryptophan synthase beta chain;       
   66::395     6e-28  38%  406 aa  TRPB_BRUA2 RecName: Full=Tryptophan synthase beta chain;       
   66::395     6e-28  38%  406 aa  TRPB_BRUA1 RecName: Full=Tryptophan synthase beta chain;       
   59::395     1e-27  38%  406 aa  TRPB_OCHA4 RecName: Full=Tryptophan synthase beta chain;       
   20::386     1e-27  36%  404 aa  TRPB_GEOTN RecName: Full=Tryptophan synthase beta chain;       
   20::386     1e-27  36%  404 aa  TRPB_BACST RecName: Full=Tryptophan synthase beta chain;       
   61::402     2e-27  36%  403 aa  TRPB1_METMA RecName: Full=Tryptophan synthase beta chain 1;        
   38::380     4e-27  34%  391 aa  TRPB_THEP3 RecName: Full=Tryptophan synthase beta chain;       
   11::380     2e-26  34%  389 aa  TRPB1_PYRKO RecName: Full=Tryptophan synthase beta chain 1;        
   59::395     2e-26  36%  406 aa  TRPB_RHIEC RecName: Full=Tryptophan synthase beta chain;       
   59::395     4e-26  36%  406 aa  TRPB_RHILW RecName: Full=Tryptophan synthase beta chain;       
   49::378     4e-26  35%  388 aa  TRPB1_PYRAB RecName: Full=Tryptophan synthase beta chain 1;        
   64::395     7e-26  36%  406 aa  TRPB_RHIET RecName: Full=Tryptophan synthase beta chain;       
   59::395     9e-26  36%  406 aa  TRPB_RHIL3 RecName: Full=Tryptophan synthase beta chain;       
   49::378     1e-25  35%  388 aa  TRPB1_PYRFU RecName: Full=Tryptophan synthase beta chain 1;        
   59::395     2e-25  36%  406 aa  TRPB_RHIE6 RecName: Full=Tryptophan synthase beta chain;       
   59::395     2e-25  35%  404 aa  TRPB_AGRRK RecName: Full=Tryptophan synthase beta chain;       
   23::380     4e-25  34%  391 aa  TRPB_THETN RecName: Full=Tryptophan synthase beta chain;       
   22::402     6e-25  31%  402 aa  TRPB_STAES RecName: Full=Tryptophan synthase beta chain;       
   22::402     6e-25  31%  402 aa  TRPB_STAEQ RecName: Full=Tryptophan synthase beta chain;       
   29::409     1e-24  33%  409 aa  TRPB_TRIEI RecName: Full=Tryptophan synthase beta chain;       
   49::386     1e-24  33%  389 aa  TRPB_CLONN RecName: Full=Tryptophan synthase beta chain;       
   24::402     1e-24  35%  403 aa  TRPB1_METAC RecName: Full=Tryptophan synthase beta chain 1;        
   33::387     2e-24  34%  391 aa  TRPB_CLOB8 RecName: Full=Tryptophan synthase beta chain;       
   19::388     2e-24  33%  399 aa  TRPB_BORPA RecName: Full=Tryptophan synthase beta chain;       
   19::388     2e-24  33%  399 aa  TRPB_BORBR RecName: Full=Tryptophan synthase beta chain;       
   29::397     3e-24  34%  410 aa  TRPB_PARDP RecName: Full=Tryptophan synthase beta chain;       
   19::388     3e-24  33%  399 aa  TRPB_BORPE RecName: Full=Tryptophan synthase beta chain;       
   66::395     3e-24  34%  406 aa  TRPB_AGRT5 RecName: Full=Tryptophan synthase beta chain;       
   63::401     4e-24  32%  405 aa  TRPB_CLOBA RecName: Full=Tryptophan synthase beta chain;       
   36::404     4e-24  31%  408 aa  TRPB_BACLD RecName: Full=Tryptophan synthase beta chain;       
   24::404     5e-24  32%  404 aa  TRPB_STAAR RecName: Full=Tryptophan synthase beta chain;       
   59::395     7e-24  34%  406 aa  TRPB_SINMW RecName: Full=Tryptophan synthase beta chain;       
   59::388     7e-24  32%  399 aa  TRPB_LEGPL RecName: Full=Tryptophan synthase beta chain;       
   59::388     7e-24  32%  399 aa  TRPB_LEGPH RecName: Full=Tryptophan synthase beta chain;       
   59::388     7e-24  32%  399 aa  TRPB_LEGPC RecName: Full=Tryptophan synthase beta chain;       
   59::388     7e-24  32%  399 aa  TRPB_LEGPA RecName: Full=Tryptophan synthase beta chain;       
   66::395     7e-24  35%  406 aa  TRPB_AGRVS RecName: Full=Tryptophan synthase beta chain;       
   41::390     9e-24  34%  401 aa  TRPB_RUTMC RecName: Full=Tryptophan synthase beta chain;       
   67::392     9e-24  33%  407 aa  TRPB_RHOBA RecName: Full=Tryptophan synthase beta chain;       
   59::406     9e-24  34%  434 aa  TRPB_POLNA RecName: Full=Tryptophan synthase beta chain;       
   59::395     1e-23  35%  406 aa  TRPB_RHISN RecName: Full=Tryptophan synthase beta chain;       
   63::401     1e-23  32%  405 aa  TRPB_CLOBB RecName: Full=Tryptophan synthase beta chain;       
   24::404     1e-23  32%  404 aa  TRPB_STAAN RecName: Full=Tryptophan synthase beta chain;       
   24::404     1e-23  32%  404 aa  TRPB_STAAM RecName: Full=Tryptophan synthase beta chain;       
   24::404     1e-23  32%  404 aa  TRPB_STAA9 RecName: Full=Tryptophan synthase beta chain;       
   24::404     1e-23  32%  404 aa  TRPB_STAA2 RecName: Full=Tryptophan synthase beta chain;       
   24::404     1e-23  32%  404 aa  TRPB_STAA1 RecName: Full=Tryptophan synthase beta chain;       
   66::397     1e-23  33%  406 aa  TRPB_MESSB RecName: Full=Tryptophan synthase beta chain;       
   24::404     2e-23  32%  404 aa  TRPB_STAAS RecName: Full=Tryptophan synthase beta chain;       
   24::404     2e-23  32%  404 aa  TRPB_STAAB RecName: Full=Tryptophan synthase beta chain;       
   59::395     2e-23  34%  406 aa  TRPB_RHIME RecName: Full=Tryptophan synthase beta chain;       
   58::387     2e-23  33%  401 aa  TRPB_LACLS RecName: Full=Tryptophan synthase beta chain;       
   36::393     2e-23  32%  397 aa  TRPB_BACC1 RecName: Full=Tryptophan synthase beta chain;       
   54::395     3e-23  33%  397 aa  TRPB_LEPIN RecName: Full=Tryptophan synthase beta chain;       
   54::395     3e-23  33%  397 aa  TRPB_LEPIC RecName: Full=Tryptophan synthase beta chain;       
   57::400     3e-23  33%  400 aa  TRPB_LEPBL RecName: Full=Tryptophan synthase beta chain;       
   57::400     3e-23  33%  400 aa  TRPB_LEPBJ RecName: Full=Tryptophan synthase beta chain;       
   58::387     3e-23  33%  401 aa  TRPB_LACLM RecName: Full=Tryptophan synthase beta chain;       
   66::395     3e-23  37%  406 aa  TRPB_CAUCR RecName: Full=Tryptophan synthase beta chain;       
   36::393     3e-23  32%  397 aa  TRPB_BACWK RecName: Full=Tryptophan synthase beta chain;       
   52::406     3e-23  33%  410 aa  TRPB_THEEB RecName: Full=Tryptophan synthase beta chain;       
   36::393     3e-23  32%  397 aa  TRPB_BACC3 RecName: Full=Tryptophan synthase beta chain;       
   36::393     3e-23  32%  397 aa  TRPB_BACAH RecName: Full=Tryptophan synthase beta chain;       
   48::395     3e-23  33%  398 aa  TRPB_ANOFW RecName: Full=Tryptophan synthase beta chain;       
   32::375     3e-23  34%  413 aa  TRPB2_ANASP RecName: Full=Tryptophan synthase beta chain 2;        
   59::390     4e-23  33%  401 aa  TRPB_VESOH RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAAW RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAAT RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAAE RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAAC RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAA8 RecName: Full=Tryptophan synthase beta chain;       
   24::404     4e-23  32%  404 aa  TRPB_STAA3 RecName: Full=Tryptophan synthase beta chain;       
   45::380     6e-23  33%  394 aa  TRPB_CLOAB RecName: Full=Tryptophan synthase beta chain;       
   57::386     6e-23  34%  397 aa  TRPB1_AQUAE RecName: Full=Tryptophan synthase beta chain 1;        
   59::388     7e-23  33%  399 aa  TRPB_BORPD RecName: Full=Tryptophan synthase beta chain;       
   15::388     7e-23  34%  399 aa  TRPB_ACIF5 RecName: Full=Tryptophan synthase beta chain;       
   15::388     7e-23  34%  399 aa  TRPB_ACIF2 RecName: Full=Tryptophan synthase beta chain;       
   32::387     1e-22  34%  402 aa  TRPB_LACLA RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  31%  397 aa  TRPB_BACCZ RecName: Full=Tryptophan synthase beta chain;       
   39::388     1e-22  32%  412 aa  TRPB_METPP RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  31%  397 aa  TRPB_BACHK RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  32%  397 aa  TRPB_BACCR RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  32%  397 aa  TRPB_BACC4 RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  31%  397 aa  TRPB_BACAN RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  31%  397 aa  TRPB_BACAC RecName: Full=Tryptophan synthase beta chain;       
   36::393     1e-22  31%  397 aa  TRPB_BACAA RecName: Full=Tryptophan synthase beta chain;       
   81::405     2e-22  33%  416 aa  TRPB_RHILO RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-22  33%  396 aa  TRPB_LEPBP RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-22  33%  396 aa  TRPB_LEPBA RecName: Full=Tryptophan synthase beta chain;       
   64::399     2e-22  35%  406 aa  TRPB_LACCA RecName: Full=Tryptophan synthase beta chain;       
   31::406     2e-22  34%  447 aa  TRPB_POLSJ RecName: Full=Tryptophan synthase beta chain;       
   22::397     2e-22  33%  409 aa  TRPB_METVO RecName: Full=Tryptophan synthase beta chain;       
   59::389     2e-22  32%  400 aa  TRPB_CHRVO RecName: Full=Tryptophan synthase beta chain;       
   36::393     2e-22  31%  397 aa  TRPB_BACC2 RecName: Full=Tryptophan synthase beta chain;       
   32::404     2e-22  33%  413 aa  TRPB_ANAVT RecName: Full=Tryptophan synthase beta chain;       
   45::399     2e-22  34%  400 aa  TRPB_ALKMQ RecName: Full=Tryptophan synthase beta chain;       
   27::389     2e-22  33%  403 aa  TRPB_ACICA RecName: Full=Tryptophan synthase beta chain;       
   27::389     2e-22  33%  403 aa  TRPB_ACIAD RecName: Full=Tryptophan synthase beta chain;       
   63::398     3e-22  35%  417 aa  TRPB_CORGL RecName: Full=Tryptophan synthase beta chain;       
   58::393     3e-22  32%  397 aa  TRPB_BACCQ RecName: Full=Tryptophan synthase beta chain;       
   53::381     3e-22  34%  392 aa  TRPB1_METTH RecName: Full=Tryptophan synthase beta chain 1;        
   24::403     4e-22  29%  404 aa  TRPB_STAS1 RecName: Full=Tryptophan synthase beta chain;       
   29::403     4e-22  32%  405 aa  TRPB_BRAJA RecName: Full=Tryptophan synthase beta chain;       
  349::683     5e-22  34%  707 aa  TRP_YEAST RecName: Full=Tryptophan synthase;         EC=4.2.1.20;
   21::388     5e-22  33%  407 aa  TRPB_STRPN RecName: Full=Tryptophan synthase beta chain;       
   21::388     5e-22  33%  407 aa  TRPB_STRP7 RecName: Full=Tryptophan synthase beta chain;       
   59::388     5e-22  33%  399 aa  TRPB_DECAR RecName: Full=Tryptophan synthase beta chain;       
   36::385     5e-22  32%  399 aa  TRPB_BACP2 RecName: Full=Tryptophan synthase beta chain;       
   28::392     5e-22  32%  402 aa  TRPB2_WOLSU RecName: Full=Tryptophan synthase beta chain 2;        
   62::389     5e-22  34%  397 aa  TRPB1_ARCFU RecName: Full=Tryptophan synthase beta chain 1;        
   63::398     6e-22  34%  417 aa  TRPB_CORGB RecName: Full=Tryptophan synthase beta chain;       
   21::388     8e-22  32%  407 aa  TRPB_STRZP RecName: Full=Tryptophan synthase beta chain;       
   21::388     8e-22  33%  407 aa  TRPB_STRP4 RecName: Full=Tryptophan synthase beta chain;       
   22::398     8e-22  31%  399 aa  TRPB_OCEIH RecName: Full=Tryptophan synthase beta chain;       
   59::388     8e-22  33%  399 aa  TRPB_NITEC RecName: Full=Tryptophan synthase beta chain;       
   42::410     8e-22  30%  422 aa  TRPB_MYCTU RecName: Full=Tryptophan synthase beta chain;       
   42::410     8e-22  30%  422 aa  TRPB_MYCBO RecName: Full=Tryptophan synthase beta chain;       
   58::393     8e-22  32%  397 aa  TRPB_BACC7 RecName: Full=Tryptophan synthase beta chain;       
   47::393     1e-21  37%  404 aa  TRPB_ACICJ RecName: Full=Tryptophan synthase beta chain;       
   63::390     1e-21  32%  403 aa  TRPB1_WOLSU RecName: Full=Tryptophan synthase beta chain 1;        
   29::401     1e-21  32%  409 aa  TRPB1_ANASP RecName: Full=Tryptophan synthase beta chain 1;        
   21::388     1e-21  33%  407 aa  TRPB_STRZT RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-21  33%  407 aa  TRPB_STRR6 RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-21  32%  407 aa  TRPB_STRPS RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-21  32%  407 aa  TRPB_STRPJ RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-21  32%  407 aa  TRPB_STRPI RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-21  33%  407 aa  TRPB_STRP2 RecName: Full=Tryptophan synthase beta chain;       
   29::393     1e-21  34%  404 aa  TRPB_NOVAD RecName: Full=Tryptophan synthase beta chain;       
   59::389     2e-21  33%  400 aa  TRPB_NEIG2 RecName: Full=Tryptophan synthase beta chain;       
   21::388     2e-21  33%  407 aa  TRPB_STRZJ RecName: Full=Tryptophan synthase beta chain;       
   66::401     2e-21  34%  406 aa  TRPB_PHEZH RecName: Full=Tryptophan synthase beta chain;       
   37::406     2e-21  30%  417 aa  TRPB_MYCLE RecName: Full=Tryptophan synthase beta chain;       
   62::392     3e-21  32%  406 aa  TRPB_PSEF5 RecName: Full=Tryptophan synthase beta chain;       
   57::386     3e-21  33%  397 aa  TRPB_NITEU RecName: Full=Tryptophan synthase beta chain;       
   59::389     3e-21  33%  400 aa  TRPB_NEIMF RecName: Full=Tryptophan synthase beta chain;       
   59::389     3e-21  33%  400 aa  TRPB_NEIMB RecName: Full=Tryptophan synthase beta chain;       
   59::389     3e-21  33%  400 aa  TRPB_NEIMA RecName: Full=Tryptophan synthase beta chain;       
   59::389     3e-21  33%  400 aa  TRPB_NEIM0 RecName: Full=Tryptophan synthase beta chain;       
   76::407     4e-21  32%  418 aa  TRPB_THET8 RecName: Full=Tryptophan synthase beta chain;       
   62::393     4e-21  32%  404 aa  TRPB_THET2 RecName: Full=Tryptophan synthase beta chain;       
   74::417     4e-21  33%  425 aa  TRPB_SYNJB RecName: Full=Tryptophan synthase beta chain;       
   19::390     4e-21  33%  402 aa  TRPB_PSEAE RecName: Full=Tryptophan synthase beta chain;       
   59::389     4e-21  33%  400 aa  TRPB_NEIG1 RecName: Full=Tryptophan synthase beta chain;       
   57::399     4e-21  32%  399 aa  TRPB_LACPL RecName: Full=Tryptophan synthase beta chain;       
   64::399     4e-21  34%  406 aa  TRPB_LACC3 RecName: Full=Tryptophan synthase beta chain;       
   27::390     4e-21  32%  407 aa  TRPB2_VIBPA RecName: Full=Tryptophan synthase beta chain 2;        
   66::396     5e-21  32%  410 aa  TRPB_PSEPF RecName: Full=Tryptophan synthase beta chain;       
   26::392     7e-21  31%  409 aa  TRPB_PSESH RecName: Full=Tryptophan synthase beta chain;       
   35::406     7e-21  33%  417 aa  TRPB_PROM1 RecName: Full=Tryptophan synthase beta chain;       
   59::389     7e-21  35%  400 aa  TRPB_METFK RecName: Full=Tryptophan synthase beta chain;       
   64::399     7e-21  34%  406 aa  TRPB_LACCB RecName: Full=Tryptophan synthase beta chain;       
   39::393     7e-21  30%  396 aa  TRPB_CLOK5 RecName: Full=Tryptophan synthase beta chain;       
   39::393     7e-21  30%  396 aa  TRPB_CLOK1 RecName: Full=Tryptophan synthase beta chain;       
  333::679     9e-21  32%  697 aa  TRP_SCHPO RecName: Full=Tryptophan synthase;         EC=4.2.1.20;
   59::388     9e-21  33%  399 aa  TRPB_THIDA RecName: Full=Tryptophan synthase beta chain;       
   21::388     9e-21  34%  403 aa  TRPB_STRMU RecName: Full=Tryptophan synthase beta chain;       
   60::392     9e-21  32%  409 aa  TRPB_PSESM RecName: Full=Tryptophan synthase beta chain;       
   35::406     9e-21  33%  417 aa  TRPB_PROMT RecName: Full=Tryptophan synthase beta chain;       
  249::680     1e-20  32%  705 aa  TRP_COPCI RecName: Full=Tryptophan synthase;         EC=4.2.1.20;
   66::363     1e-20  35%  404 aa  TRPB_METJA RecName: Full=Tryptophan synthase beta chain;       
   16::360     1e-20  33%  423 aa  TRPB_HALVO RecName: Full=Tryptophan synthase beta chain;       
   53::391     2e-20  33%  393 aa  TRPB_HELPY RecName: Full=Tryptophan synthase beta chain;       
  101::429     2e-20  34%  466 aa  TRPB_CAMAC RecName: Full=Tryptophan synthase beta chain 2,
   50::379     2e-20  32%  391 aa  TRPB2_CHLCV RecName: Full=Tryptophan synthase beta chain 2;        
   67::424     2e-20  32%  427 aa  TRPB_STRCO RecName: Full=Tryptophan synthase beta chain;       
   63::392     2e-20  32%  403 aa  TRPB_RALSO RecName: Full=Tryptophan synthase beta chain;       
   62::408     2e-20  31%  409 aa  TRPB_PSEU2 RecName: Full=Tryptophan synthase beta chain;       
   45::407     2e-20  31%  421 aa  TRPB_MYCIT RecName: Full=Tryptophan synthase beta chain;       
    3::394     2e-20  29%  405 aa  TRPB_METCA RecName: Full=Tryptophan synthase beta chain;       
   36::393     2e-20  34%  407 aa  TRPB_BRASB RecName: Full=Tryptophan synthase beta chain;       
   59::414     3e-20  31%  422 aa  TRPB_ACIAC RecName: Full=Tryptophan synthase beta chain;       
   32::394     3e-20  31%  405 aa  TRPB_XANCP RecName: Full=Tryptophan synthase beta chain;       
   32::394     3e-20  31%  405 aa  TRPB_XANCB RecName: Full=Tryptophan synthase beta chain;       
   32::394     3e-20  31%  405 aa  TRPB_XANC8 RecName: Full=Tryptophan synthase beta chain;       
   67::396     3e-20  32%  420 aa  TRPB_HELHP RecName: Full=Tryptophan synthase beta chain;       
  347::679     4e-20  33%  704 aa  TRP_COPC7 RecName: Full=Tryptophan synthase;         EC=4.2.1.20;
   56::407     4e-20  33%  418 aa  TRPB_SYNSC RecName: Full=Tryptophan synthase beta chain;       
   67::412     6e-20  32%  412 aa  TRPB_SYNY3 RecName: Full=Tryptophan synthase beta chain;       
   26::392     6e-20  31%  409 aa  TRPB_PSE14 RecName: Full=Tryptophan synthase beta chain;       
   51::379     6e-20  32%  390 aa  TRPB_METTM RecName: Full=Tryptophan synthase beta chain;       
   67::402     8e-20  32%  428 aa  TRPB_STRAW RecName: Full=Tryptophan synthase beta chain;       
   65::403     8e-20  32%  404 aa  TRPB_RHOPB RecName: Full=Tryptophan synthase beta chain;       
   60::392     8e-20  31%  405 aa  TRPB_PSEPW RecName: Full=Tryptophan synthase beta chain;       
   60::392     8e-20  31%  405 aa  TRPB_PSEE4 RecName: Full=Tryptophan synthase beta chain;       
   58::400     1e-19  31%  414 aa  TRPB_SULSY RecName: Full=Tryptophan synthase beta chain;       
   64::394     1e-19  32%  408 aa  TRPB_PSESY RecName: Full=Tryptophan synthase beta chain;       
   65::366     1e-19  37%  405 aa  TRPB_PARL1 RecName: Full=Tryptophan synthase beta chain;       
   36::372     1e-19  33%  407 aa  TRPB_BRASO RecName: Full=Tryptophan synthase beta chain;       
   62::405     1e-19  30%  406 aa  TRPB_AZOVD RecName: Full=Tryptophan synthase beta chain;       
   46::386     1e-19  33%  389 aa  TRPB1_MAIZE RecName: Full=Tryptophan synthase beta chain 1;        
   65::375     1e-19  33%  409 aa  TRPB_RHOS4 RecName: Full=Tryptophan synthase beta chain;       
  117::472     1e-19  33%  475 aa  TRBP2_ARATH RecName: Full=Tryptophan synthase beta chain 2,
   60::392     2e-19  30%  405 aa  TRPB_PSEPG RecName: Full=Tryptophan synthase beta chain;       
   72::405     2e-19  34%  416 aa  TRPB_PROMA RecName: Full=Tryptophan synthase beta chain;       
   22::398     2e-19  30%  399 aa  TRPB_EXIS2 RecName: Full=Tryptophan synthase beta chain;       
  100::440     2e-19  32%  443 aa  TRPB2_MAIZE RecName: Full=Tryptophan synthase beta chain 2,
   21::388     2e-19  31%  402 aa  TRPB_STRTD RecName: Full=Tryptophan synthase beta chain;       
   65::394     2e-19  31%  405 aa  TRPB_STRMK RecName: Full=Tryptophan synthase beta chain;       
   65::415     2e-19  31%  416 aa  TRPB_SILPO RecName: Full=Tryptophan synthase beta chain;       
   60::392     2e-19  30%  405 aa  TRPB_PSEPU RecName: Full=Tryptophan synthase beta chain;       
   60::392     2e-19  30%  405 aa  TRPB_PSEPK RecName: Full=Tryptophan synthase beta chain;       
   60::392     2e-19  30%  405 aa  TRPB_PSEP1 RecName: Full=Tryptophan synthase beta chain;       
   54::391     2e-19  33%  392 aa  TRPB_METLZ RecName: Full=Tryptophan synthase beta chain;       
   20::388     2e-19  31%  428 aa  TRPB_LEPCP RecName: Full=Tryptophan synthase beta chain;       
   58::359     2e-19  34%  399 aa  TRPB_BACV8 RecName: Full=Tryptophan synthase beta chain;       
   51::350     2e-19  33%  389 aa  TRPB1_THEMA RecName: Full=Tryptophan synthase beta chain 1;        
  127::467     2e-19  33%  470 aa  TRPB1_ARATH RecName: Full=Tryptophan synthase beta chain 1,
   65::394     3e-19  31%  405 aa  TRPB_XANOM RecName: Full=Tryptophan synthase beta chain;       
   53::391     3e-19  33%  393 aa  TRPB_HELPJ RecName: Full=Tryptophan synthase beta chain;       
   21::388     4e-19  31%  402 aa  TRPB_STRT2 RecName: Full=Tryptophan synthase beta chain;       
   64::402     4e-19  34%  413 aa  TRPB_METPB RecName: Full=Tryptophan synthase beta chain;       
   58::392     4e-19  32%  394 aa  TRPB_BACTN RecName: Full=Tryptophan synthase beta chain;       
   65::394     5e-19  31%  405 aa  TRPB_STRM5 RecName: Full=Tryptophan synthase beta chain;       
   65::410     5e-19  32%  419 aa  TRPB_SILST RecName: Full=Tryptophan synthase beta chain;       
   65::374     5e-19  33%  410 aa  TRPB_ROSDO RecName: Full=Tryptophan synthase beta chain;       
   65::395     5e-19  32%  410 aa  TRPB_DINSH RecName: Full=Tryptophan synthase beta chain;       
   64::394     5e-19  30%  396 aa  TRPB_AZOPC RecName: Full=Tryptophan synthase beta chain;       
   65::394     6e-19  31%  405 aa  TRPB_XANOP RecName: Full=Tryptophan synthase beta chain;       
   59::394     6e-19  32%  435 aa  TRPB_RHOFD RecName: Full=Tryptophan synthase beta chain;       
   35::405     6e-19  31%  414 aa  TRPB_PROM5 RecName: Full=Tryptophan synthase beta chain;       
   59::389     6e-19  31%  400 aa  TRPB_NEIGO RecName: Full=Tryptophan synthase beta chain;       
   64::402     6e-19  34%  413 aa  TRPB_METC4 RecName: Full=Tryptophan synthase beta chain;       
   21::388     1e-18  31%  402 aa  TRPB_STRT1 RecName: Full=Tryptophan synthase beta chain;       
   58::400     1e-18  30%  400 aa  TRPB_LISMF RecName: Full=Tryptophan synthase beta chain;       
   58::400     1e-18  30%  400 aa  TRPB_LISMC RecName: Full=Tryptophan synthase beta chain;       
   54::383     1e-18  30%  394 aa  TRPB_BUCBP RecName: Full=Tryptophan synthase beta chain;       
   58::388     1e-18  33%  390 aa  TRPB_BACFR RecName: Full=Tryptophan synthase beta chain;       
   58::388     1e-18  33%  390 aa  TRPB_BACFN RecName: Full=Tryptophan synthase beta chain;       
   29::403     2e-18  30%  404 aa  TRPB_RHOP2 RecName: Full=Tryptophan synthase beta chain;       
   58::400     2e-18  30%  400 aa  TRPB_LISMH RecName: Full=Tryptophan synthase beta chain;       
   65::394     2e-18  31%  405 aa  TRPB_XANC5 RecName: Full=Tryptophan synthase beta chain;       
   65::394     2e-18  31%  405 aa  TRPB_XANAC RecName: Full=Tryptophan synthase beta chain;       
   65::405     2e-18  32%  405 aa  TRPB_OLICO RecName: Full=Tryptophan synthase beta chain;       
   58::400     2e-18  30%  400 aa  TRPB_LISMO RecName: Full=Tryptophan synthase beta chain;       
   48::367     2e-18  32%  409 aa  TRPB_JANSC RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-18  32%  397 aa  TRPB_ENT38 RecName: Full=Tryptophan synthase beta chain;       
   76::409     2e-18  33%  431 aa  TRPB_DEIRA RecName: Full=Tryptophan synthase beta chain;       
  348::690     3e-18  31%  708 aa  TRP_NEUCR RecName: Full=Tryptophan synthase;         EC=4.2.1.20;
   65::394     4e-18  30%  405 aa  TRPB_XYLFM RecName: Full=Tryptophan synthase beta chain;       
   29::403     4e-18  30%  404 aa  TRPB_RHOP5 RecName: Full=Tryptophan synthase beta chain;       
   51::380     4e-18  31%  389 aa  TRPB_META3 RecName: Full=Tryptophan synthase beta chain;       
   65::394     5e-18  30%  405 aa  TRPB_XYLFA RecName: Full=Tryptophan synthase beta chain;       
   14::389     7e-18  30%  402 aa  TRPB_PASMU RecName: Full=Tryptophan synthase beta chain;       
   57::388     7e-18  30%  398 aa  TRPB_METKA RecName: Full=Tryptophan synthase beta chain;       
   59::394     9e-18  31%  421 aa  TRPB_VEREI RecName: Full=Tryptophan synthase beta chain;       
   55::376     9e-18  34%  416 aa  TRPB_SYNPW RecName: Full=Tryptophan synthase beta chain;       
   21::387     9e-18  29%  400 aa  TRPB_LISW6 RecName: Full=Tryptophan synthase beta chain;       
   58::400     9e-18  29%  400 aa  TRPB_LISIN RecName: Full=Tryptophan synthase beta chain;       
   24::383     9e-18  34%  430 aa  TRPB_HALSA RecName: Full=Tryptophan synthase beta chain;       
   24::383     9e-18  34%  430 aa  TRPB_HALS3 RecName: Full=Tryptophan synthase beta chain;       
   72::401     9e-18  32%  414 aa  TRPB_GLOVI RecName: Full=Tryptophan synthase beta chain;       
   62::391     9e-18  31%  400 aa  TRPB_CHLTE RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-17  32%  396 aa  TRPB_VIBCM RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-17  32%  396 aa  TRPB_VIBCH RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-17  32%  396 aa  TRPB_VIBC3 RecName: Full=Tryptophan synthase beta chain;       
   34::404     2e-17  31%  414 aa  TRPB_PROMP RecName: Full=Tryptophan synthase beta chain;       
   59::387     2e-17  29%  398 aa  TRPB_NITMU RecName: Full=Tryptophan synthase beta chain;       
   29::393     3e-17  30%  404 aa  TRPB_RHOPT RecName: Full=Tryptophan synthase beta chain;       
   29::372     3e-17  31%  404 aa  TRPB_RHOPS RecName: Full=Tryptophan synthase beta chain;       
   29::393     3e-17  30%  404 aa  TRPB_RHOPA RecName: Full=Tryptophan synthase beta chain;       
   64::402     3e-17  31%  413 aa  TRPB_METRJ RecName: Full=Tryptophan synthase beta chain;       
   58::386     3e-17  30%  399 aa  TRPB_BACSK RecName: Full=Tryptophan synthase beta chain;       
   65::394     4e-17  29%  405 aa  TRPB_XYLFT RecName: Full=Tryptophan synthase beta chain;       
   65::394     4e-17  29%  405 aa  TRPB_XYLF2 RecName: Full=Tryptophan synthase beta chain;       
   65::382     4e-17  31%  414 aa  TRPB_BEII9 RecName: Full=Tryptophan synthase beta chain;       
   66::374     5e-17  35%  406 aa  TRPB_METS4 RecName: Full=Tryptophan synthase beta chain;       
   66::374     5e-17  35%  406 aa  TRPB_METNO RecName: Full=Tryptophan synthase beta chain;       
   17::383     6e-17  29%  396 aa  TRPB_PROMH RecName: Full=Tryptophan synthase beta chain;       
   56::407     8e-17  31%  418 aa  TRPB_SYNPX RecName: Full=Tryptophan synthase beta chain;       
   75::396     8e-17  32%  436 aa  TRPB_PROMM RecName: Full=Tryptophan synthase beta chain;       
    5::405     8e-17  29%  414 aa  TRPB_PROM0 RecName: Full=Tryptophan synthase beta chain;       
   26::414     1e-16  32%  439 aa  TRPB2_COREF RecName: Full=Tryptophan synthase beta chain 2;        
   57::378     2e-16  33%  418 aa  TRPB_SYNS9 RecName: Full=Tryptophan synthase beta chain;       
   54::382     2e-16  33%  419 aa  TRPB_SHEHH RecName: Full=Tryptophan synthase beta chain;       
   67::366     2e-16  32%  428 aa  TRPB_STRGG RecName: Full=Tryptophan synthase beta chain;       
   13::353     2e-16  30%  400 aa  TRPB_BACSU RecName: Full=Tryptophan synthase beta chain;       
   57::378     3e-16  32%  418 aa  TRPB_SYNS3 RecName: Full=Tryptophan synthase beta chain;       
   49::392     3e-16  30%  403 aa  TRPB_LEIXX RecName: Full=Tryptophan synthase beta chain;       
   32::397     3e-16  30%  412 aa  TRPB_ELUMP RecName: Full=Tryptophan synthase beta chain;       
   54::389     3e-16  30%  392 aa  TRPB_BUCSC RecName: Full=Tryptophan synthase beta chain;       
   35::405     4e-16  30%  414 aa  TRPB_PROMS RecName: Full=Tryptophan synthase beta chain;       
   54::383     5e-16  30%  396 aa  TRPB_PHOLL RecName: Full=Tryptophan synthase beta chain;       
   35::405     9e-16  30%  414 aa  TRPB_PROM2 RecName: Full=Tryptophan synthase beta chain;       
    5::405     1e-15  29%  414 aa  TRPB_PROM9 RecName: Full=Tryptophan synthase beta chain;       
   58::399     1e-15  30%  408 aa  TRPB_ACIBL RecName: Full=Tryptophan synthase beta chain;       
   22::398     1e-15  31%  418 aa  TRPB1_COREF RecName: Full=Tryptophan synthase beta chain 1;        
    1::376     2e-15  30%  416 aa  TRPB_PROM4 RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-15  30%  396 aa  TRPB_FRAP2 RecName: Full=Tryptophan synthase beta chain;       
   56::394     3e-15  29%  396 aa  TRPB_ACTP7 RecName: Full=Tryptophan synthase beta chain;       
   58::391     6e-15  30%  394 aa  TRPB_PARD8 RecName: Full=Tryptophan synthase beta chain;       
   54::362     6e-15  30%  388 aa  TRPB_BUCAI RecName: Full=Tryptophan synthase beta chain;       
   83::383     7e-15  30%  396 aa  TRPB_VIBHB RecName: Full=Tryptophan synthase beta chain;       
   83::383     7e-15  33%  396 aa  TRPB_PHOPR RecName: Full=Tryptophan synthase beta chain;       
   54::383     1e-14  29%  396 aa  TRPB_ERWT9 RecName: Full=Tryptophan synthase beta chain;       
   54::382     1e-14  28%  399 aa  TRPB_BUCAP RecName: Full=Tryptophan synthase beta chain;       
   12::382     1e-14  29%  393 aa  TRPB_ALTMD RecName: Full=Tryptophan synthase beta chain;       
   56::394     1e-14  28%  396 aa  TRPB_ACTP2 RecName: Full=Tryptophan synthase beta chain;       
    7::389     2e-14  28%  392 aa  TRPB_CHLTR RecName: Full=Tryptophan synthase beta chain;       
   56::394     2e-14  28%  396 aa  TRPB_ACTPJ RecName: Full=Tryptophan synthase beta chain;       
   12::383     2e-14  29%  397 aa  TRPB_TOLAT RecName: Full=Tryptophan synthase beta chain;       
   20::352     3e-14  33%  404 aa  TRPB_CLAMS RecName: Full=Tryptophan synthase beta chain;       
   54::346     5e-14  31%  397 aa  TRPB_EDWI9 RecName: Full=Tryptophan synthase beta chain;       
   85::394     6e-14  29%  397 aa  TRPB_HAEI8 RecName: Full=Tryptophan synthase beta chain;       
   52::388     1e-13  29%  392 aa  TRPB_CAMJR RecName: Full=Tryptophan synthase beta chain;       
   52::388     1e-13  29%  392 aa  TRPB_CAMJJ RecName: Full=Tryptophan synthase beta chain;       
   52::388     1e-13  29%  392 aa  TRPB_CAMJE RecName: Full=Tryptophan synthase beta chain;       
   52::388     1e-13  29%  392 aa  TRPB_CAMJ8 RecName: Full=Tryptophan synthase beta chain;       
   30::384     2e-13  30%  397 aa  TRPB_SHEAM RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-13  29%  396 aa  TRPB_PECCP RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-13  29%  397 aa  TRPB_BUCDN RecName: Full=Tryptophan synthase beta chain;       
   83::383     2e-13  30%  396 aa  TRPB_ALISL RecName: Full=Tryptophan synthase beta chain;       
   54::346     3e-13  31%  396 aa  TRPB_SERP5 RecName: Full=Tryptophan synthase beta chain;       
   52::388     3e-13  29%  392 aa  TRPB_CAMJD RecName: Full=Tryptophan synthase beta chain;       
   83::383     4e-13  31%  396 aa  TRPB_VIBFM RecName: Full=Tryptophan synthase beta chain;       
   56::384     4e-13  30%  396 aa  TRPB_SHEB5 RecName: Full=Tryptophan synthase beta chain;       
   54::383     4e-13  29%  396 aa  TRPB_ERWCT RecName: Full=Tryptophan synthase beta chain;       
   85::395     4e-13  29%  398 aa  TRPB_ACTSZ RecName: Full=Tryptophan synthase beta chain;       
   56::384     5e-13  30%  396 aa  TRPB_SHESW RecName: Full=Tryptophan synthase beta chain;       
   56::384     5e-13  30%  396 aa  TRPB_SHEPC RecName: Full=Tryptophan synthase beta chain;       
   56::384     5e-13  30%  396 aa  TRPB_SHEB9 RecName: Full=Tryptophan synthase beta chain;       
   56::384     5e-13  30%  396 aa  TRPB_SHEB8 RecName: Full=Tryptophan synthase beta chain;       
   57::385     5e-13  29%  400 aa  TRPB_BACA2 RecName: Full=Tryptophan synthase beta chain;       
   85::389     7e-13  29%  398 aa  TRPB_MANSM RecName: Full=Tryptophan synthase beta chain;       
   67::383     7e-13  30%  397 aa  TRPB_AERHH RecName: Full=Tryptophan synthase beta chain;       
   85::394     9e-13  28%  397 aa  TRPB_HAEIN RecName: Full=Tryptophan synthase beta chain;       
   85::394     9e-13  28%  397 aa  TRPB_HAEIE RecName: Full=Tryptophan synthase beta chain;       
   83::383     2e-12  30%  396 aa  TRPB_VIBF1 RecName: Full=Tryptophan synthase beta chain;       
   41::393     2e-12  31%  404 aa  TRPB_CLAM3 RecName: Full=Tryptophan synthase beta chain;       
   67::383     2e-12  29%  397 aa  TRPB_AERS4 RecName: Full=Tryptophan synthase beta chain;       
   54::383     2e-12  27%  396 aa  TRPB_SODGM RecName: Full=Tryptophan synthase beta chain;       
   56::384     3e-12  30%  401 aa  TRPB_SHEDO RecName: Full=Tryptophan synthase beta chain;       
   14::384     3e-12  29%  403 aa  TRPB_SHEFN RecName: Full=Tryptophan synthase beta chain;       
   85::389     3e-12  28%  398 aa  TRPB_HAEIG RecName: Full=Tryptophan synthase beta chain;       
   28::382     6e-12  30%  409 aa  TRPB_SHEPA RecName: Full=Tryptophan synthase beta chain;       
   56::384     8e-12  31%  396 aa  TRPB_SHEON RecName: Full=Tryptophan synthase beta chain;       
   17::364     8e-12  29%  395 aa  TRPB_FUSNN RecName: Full=Tryptophan synthase beta chain;       
   56::384     2e-11  31%  396 aa  TRPB_SHESM RecName: Full=Tryptophan synthase beta chain;       
   56::384     2e-11  31%  396 aa  TRPB_SHESA RecName: Full=Tryptophan synthase beta chain;       
   12::346     2e-11  27%  395 aa  TRPB_PSEA6 RecName: Full=Tryptophan synthase beta chain;       
   54::157     2e-11  38%  396 aa  TRPB_BLOPB RecName: Full=Tryptophan synthase beta chain;       
   17::257     2e-11  32%  396 aa  TRPB_FRATW RecName: Full=Tryptophan synthase beta chain;       
   17::257     2e-11  32%  396 aa  TRPB_FRATT RecName: Full=Tryptophan synthase beta chain;       
   17::257     2e-11  32%  396 aa  TRPB_FRATM RecName: Full=Tryptophan synthase beta chain;       
   17::257     2e-11  32%  396 aa  TRPB_FRAT1 RecName: Full=Tryptophan synthase beta chain;       
   55::397     2e-11  27%  397 aa  TRPB_ENTS8 RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALTY RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALTI RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALSV RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALPK RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALPC RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALPB RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALPA RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALNS RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALHS RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALG2 RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALEP RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALDC RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALCH RecName: Full=Tryptophan synthase beta chain;       
   55::384     4e-11  27%  397 aa  TRPB_SALA4 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-11  28%  398 aa  TRPB_BLOFL RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPY RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPS RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPP RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPN RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPE RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPB RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERPA RecName: Full=Tryptophan synthase beta chain;       
   83::383     6e-11  29%  396 aa  TRPB_YERP3 RecName: Full=Tryptophan synthase beta chain;       
   83::378     6e-11  28%  391 aa  TRPB_VIBME RecName: Full=Tryptophan synthase beta chain;       
   55::384     6e-11  27%  397 aa  TRPB_SALAR RecName: Full=Tryptophan synthase beta chain;       
   17::257     6e-11  31%  396 aa  TRPB_FRATO RecName: Full=Tryptophan synthase beta chain;       
   17::257     6e-11  31%  396 aa  TRPB_FRATH RecName: Full=Tryptophan synthase beta chain;       
   17::257     6e-11  31%  396 aa  TRPB_FRATF RecName: Full=Tryptophan synthase beta chain;       
   55::384     8e-11  28%  397 aa  TRPB_KLEP7 RecName: Full=Tryptophan synthase beta chain;       
   17::257     8e-11  31%  396 aa  TRPB_FRATN RecName: Full=Tryptophan synthase beta chain;       
   55::384     1e-10  28%  397 aa  TRPB_KLEP3 RecName: Full=Tryptophan synthase beta chain;       
   54::384     1e-10  27%  392 aa  TRPB_BUCMH RecName: Full=Tryptophan synthase beta chain;       
   83::383     2e-10  28%  396 aa  TRPB_VIBVY RecName: Full=Tryptophan synthase beta chain;       
   83::383     2e-10  28%  396 aa  TRPB_VIBVU RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-10  27%  397 aa  TRPB_SHIBS RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-10  27%  397 aa  TRPB_SHIB3 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_SHISS RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_SHIDS RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOUT RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOSM RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOLU RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOL6 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOL5 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECOK1 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO81 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO7I RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO5E RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO57 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO45 RecName: Full=Tryptophan synthase beta chain;       
   55::384     5e-10  27%  397 aa  TRPB_ECO27 RecName: Full=Tryptophan synthase beta chain;       
   83::383     7e-10  29%  396 aa  TRPB_YERE8 RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_SHIFL RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_SHIF8 RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECOSE RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECOLI RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECOLC RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECOHS RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECODH RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECO8A RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECO55 RecName: Full=Tryptophan synthase beta chain;       
   55::347     7e-10  28%  397 aa  TRPB_ECO24 RecName: Full=Tryptophan synthase beta chain;       
   83::383     7e-10  28%  396 aa  TRPB1_VIBPA RecName: Full=Tryptophan synthase beta chain 1;        
   55::384     9e-10  27%  397 aa  TRPB_ESCF3 RecName: Full=Tryptophan synthase beta chain;       
   55::384     2e-09  26%  397 aa  TRPB_CITK8 RecName: Full=Tryptophan synthase beta chain;       
   12::350     4e-09  29%  407 aa  TRPB_SHEWM RecName: Full=Tryptophan synthase beta chain;       
   12::350     4e-09  28%  405 aa  TRPB_SHEPW RecName: Full=Tryptophan synthase beta chain;       
   85::389     4e-09  27%  398 aa  TRPB_HAES2 RecName: Full=Tryptophan synthase beta chain;       
   55::351     1e-08  30%  403 aa  TRPB_SHELP RecName: Full=Tryptophan synthase beta chain;       
   83::257     3e-08  33%  396 aa  TRPB_VIBSL RecName: Full=Tryptophan synthase beta chain;       
   15::284     5e-08  31%  311 aa  CYSM_BACSU RecName: Full=Probable cysteine synthase;       
   48::399     9e-08  23%  412 aa  TRPB1_CHLCV RecName: Full=Tryptophan synthase beta chain 1;        
   56::384     4e-07  29%  396 aa  TRPB_SHESR RecName: Full=Tryptophan synthase beta chain;       
    1::461

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQELDDDTAYVDIP
TRPB2_METMA     -------KIILDENEMPKRWYNVXXXXXXXXXXXXXXRTQPINPEALEPIFAKELIRQEMSSDR-YIDIP
TRPB2_METAC     -------KIILDENEMPKKWYNVXXXXXXXXXXXXXXRTQPISPDALEPIFPKALIMQEMSSDR-YIDIP
TRPB2_AQUAE     -------KFLLSEGEIPKKWLNIXXXXXXXXXXXXXXXXXXXVPEKLLAIFPEPLVEQEVSDKE-WIDIP
TRPB2_AERPE     ----ARYRFDLSIEEVPTSWYNIXXXXXXXXXXXXXXKGEPVDPSALAKLFPKALIEQEVSRER-YIEIP
TRPB_THELT      -------RVDLKVDEIPRYWYNLSXXXXXXXXXXXXXXXXXISPDMLSAIFPMPLIEQEVTDKRE-IPIP
TRPB_THEON      ----------LPDSKMPKRWYNIXXXXXXXXXXXXXXXXXXXMEEKLLRIFASELVKQEMSMER-YIDIP
TRPB2_ARCFU     -------KIMLDESEMPKEWYNVXXXXXXXXXXXXXXATQEPVPEDLEPIFPKGLIQQEMSGER-WIRIP
TRPB2_PYRFU     -------KVVLPDGRIPRRWYNIXXXXXXXXXXXXXXTNEPVDPKKLERIFAKELVKQEMSTKR-YIKIP
TRPB2_THEMA     ----------LKPEEIPKHWYNVXXXXXXXXXXXXXXETQPISPEKLSVIFPMSLIEQEVSEER-FIEIP
TRPB_PYRHO      ----------LKDGEIPKRWYNIXXXXXXXXXXXXXXTNETINPEKLTRIFAKELIKQEFSEKR-YIKIP
TRPB2_METTH     ------NKIVLDENEIPKKWYNINPDLPSPPEPKNPEGGKNI--ENLPRVFSRGVLEQEMSMER-WIKIP
TRPB_THEGJ      ----------LPDSKIPKRWYNIXXXXXXXXXXXXXXXXXXXIPEKLLRIFAEELVKQEMSTER-YIEIP
TRPB2_PYRKO     ----------LPDSKIPKRWYNIXXXXXXXXXXXXXXXXXXXMPEKLLRIFAEELVKQEMSTDR-YIEIP
TRPB_FERNB      -------KVYLKFEEMPKVYYNVXXXXXXXXXXXXXXENKPISPEKLLAIFPEPLLEQEVSKER-FIPIP
TRPB2_PYRAB     -------KVVLPDGRIPRRWYNXXXXXXXXXXXXXXXXXXXXXXXXLKRIFAEELVKQEISRER-YIEIP
TRPB_THEAB      ----------LKFEEMPKVWYNVXXXXXXXXXXXXXXENKPMSPEKLLKIFPAPLLEQEVNDTDKFIDIP
TRPB_DESK1      -------------DILPSYWYNIVPDLPEPLPPMIHPSGEPVKRSELEVLFPRSLVDQEISTQSR-IPIP
TRPB_PYRAE      ------------------RWYNIAADLPSVLAPPRDPDEGESRIGLLSKILPSALIDQEFTAER-WVSIP
TRPB1_SULSO     ----------VKEDEIPKYWYNIIXXXXXXXXXXXXXQGAYFSRIDLLSILPKEVLRQQFTIER-YIKIP
TRPB1_SULTO     ----------VNKDLIPKYWYNIXXXXXXXXXXXXXXXAEFSRIELLKKILPKEVLRQQFTIER-FIKIP
TRPB_PYRAR      ------------------RWYNIAADLPAVLAPPKDPDEGESRIGLLTRILPSALIDQEFSAER-WITVP
TRPB2_SULTO     -------RFDLPQDEIPTEWYNIXXXXXXXXXXXXXXTGK--SFEILKQVLPSKVLELEFSKER-YIKIP
TRPB2_SULSO     -------RIDLPQDEIPAQWYNIXXXXXXXXXXXXXXTGK--SLELLKEVLPSKVLELEFAKER-YVKIP
TRPB_PYRIL      ------------------RWYNIAADLPGVLAPPKDPDEGESRIALLTRILPSALIDQEFTAERWXXXXX
TRPB_THEVO      -------RIDLKQDDMPDHWYNILPDLPEELPTPRDETGE--AFETLKKAVPTKVLEYEFSGER-YPKIP
TRPB_PICTO      ----------LSSDIIPENWYNVTXXXXXXXXXXRDTKSDFSSINLLNKILPKEVLKQEFTFKR-YEKIP
TRPB_THEAC      -------RIDLKQDEMPDHWYNILPDLPEELPTPRDETGE--AFDTLKKAVPAKVLEYEFSGER-YPKIP
TRPB1_AERPE     -----------------------------------------------------------------WVDIP
TRPB_THEPX      ----------------------------------------------------------------------
TRPB_BACHD      -----------------------------------VPETLMSAIEEL------ELALNDAMNDEAFIHDY
TRPB_BRUSU      ----------------------------------------------------------------------
TRPB_BRUSI      ----------------------------------------------------------------------
TRPB_BRUC2      ----------------------------------------------------------------------
TRPB_BRUME      ----------------------------------------------------------------------
TRPB_BRUMB      ----------------------------------------------------------------------
TRPB_BRUAB      ----------------------------------------------------------------------
TRPB_BRUA2      ----------------------------------------------------------------------
TRPB_BRUA1      ----------------------------------------------------------------------
TRPB_OCHA4      ----------------------------------------------------------------------
TRPB_GEOTN      ------------------------------PETLMLPLEEIETELDKA--LADESFRQE------YIRI-
TRPB_BACST      ------------------------------PETLMLPLEEIEAELDKA--LADESFKQE------YIRI-
TRPB1_METMA     ----------------------------------------------------------------------
TRPB_THEP3      ----------------------------------------------------------------------
TRPB1_PYRKO     --------------------------------------GQFVPETLIEPLKKLERAYKKFKDDPEFNETL
TRPB_RHIEC      ----------------------------------------------------------------------
TRPB_RHILW      ----------------------------------------------------------------------
TRPB1_PYRAB     ----------------------------------------------------------------------
TRPB_RHIET      ----------------------------------------------------------------------
TRPB_RHIL3      ----------------------------------------------------------------------
TRPB1_PYRFU     ----------------------------------------------------------------------
TRPB_RHIE6      ----------------------------------------------------------------------
TRPB_AGRRK      ----------------------------------------------------------------------
TRPB_THETN      ----------------------------------------------------------ELEREFEEAKKD
TRPB_STAES      -------------------------------------------PETLMPAIIEKKAYEDAKSDTHFKKEF
TRPB_STAEQ      -------------------------------------------PETLMPAIIEKKAYEDAKSDTHFKKEF
TRPB_TRIEI      -------------------------------------------PETLMPALLQETACKKYSQDPTFKQEL
TRPB_CLONN      ----------------------------------------------------------------------
TRPB1_METAC     -------------------------------------------PEVLMPAL------EELDVGEKYKNDP
TRPB_CLOB8      -------------------------------------------------------------DDKEFMDEY
TRPB_BORPA      -------------------------------------------------VFVAETLMHALDEDPSFIDEF
TRPB_BORBR      -------------------------------------------------VFVAETLMHALDEDPSFIDEF
TRPB_PARDP      --------------------------------------------ETLMPLILDEAEYERAKDDASFWAEM
TRPB_BORPE      -------------------------------------------------VFVAETLMHALDEDPSFIDEF
TRPB_AGRT5      ----------------------------------------------------------------------
TRPB_CLOBA      ----------------------------------------------------------------------
TRPB_BACLD      ----------------------------------------------------------ELKDDPSFQKDY
TRPB_STAAR      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_SINMW      ----------------------------------------------------------------------
TRPB_LEGPL      ----------------------------------------------------------------------
TRPB_LEGPH      ----------------------------------------------------------------------
TRPB_LEGPC      ----------------------------------------------------------------------
TRPB_LEGPA      ----------------------------------------------------------------------
TRPB_AGRVS      ----------------------------------------------------------------------
TRPB_RUTMC      -------------------------------------------------------------DDEDFIREF
TRPB_RHOBA      ----------------------------------------------------------------------
TRPB_POLNA      ----------------------------------------------------------------------
TRPB_RHISN      ----------------------------------------------------------------------
TRPB_CLOBB      ----------------------------------------------------------------------
TRPB_STAAN      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAAM      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAA9      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAA2      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAA1      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_MESSB      ----------------------------------------------------------------------
TRPB_STAAS      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAAB      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_RHIME      ----------------------------------------------------------------------
TRPB_LACLS      ----------------------------------------------------------------------
TRPB_BACC1      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_LEPIN      ----------------------------------------------------------------------
TRPB_LEPIC      ----------------------------------------------------------------------
TRPB_LEPBL      ----------------------------------------------------------------------
TRPB_LEPBJ      ----------------------------------------------------------------------
TRPB_LACLM      ----------------------------------------------------------------------
TRPB_CAUCR      ----------------------------------------------------------------------
TRPB_BACWK      ---------------------------------------------------------KEAMQDEAFQKEL
TRPB_THEEB      -------------------------------------------------------------------DFQ
TRPB_BACC3      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_BACAH      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_ANOFW      ----------------------------------------------------------------------
TRPB2_ANASP     -------------------------------------------PETLMPALAEETAYQQYRNDPGFQAEL
TRPB_VESOH      ----------------------------------------------------------------------
TRPB_STAAW      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAAT      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAAE      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAAC      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAA8      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_STAA3      -------------------------------------------PETLMPAIIEKKAYKEAKADPEFQREL
TRPB_CLOAB      ----------------------------------------------------------------------
TRPB1_AQUAE     ----------------------------------------------------------------------
TRPB_BORPD      ----------------------------------------------------------------------
TRPB_ACIF5      ------------------------------------PYGGRFVAETLIPAL-EELERQEAQRDPEFRAEL
TRPB_ACIF2      ------------------------------------PYGGRFVAETLIPAL-EELERQEAQRDPEFRAEL
TRPB_LACLA      --------------------------------------------------------------EEAYVDSK
TRPB_BACCZ      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_METPP      -----------------------------------------------------------------YRDDP
TRPB_BACHK      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_BACCR      ---------------------------------------------------------KEAMQDEAFQKEL
TRPB_BACC4      ---------------------------------------------------------KEAMQDEAFQKEL
TRPB_BACAN      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_BACAC      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_BACAA      ---------------------------------------------------------KEAMEDEAFQKEL
TRPB_RHILO      ----------------------------------------------------------------------
TRPB_LEPBP      ----------------------------------------------------------------------
TRPB_LEPBA      ----------------------------------------------------------------------
TRPB_LACCA      ----------------------------------------------------------------------
TRPB_POLSJ      ----------------------------------------------------------ELKDAYAYQNDP
TRPB_METVO      -------------------------------------------PEVLKPAV-EELKEKELKDDEDFQNEL
TRPB_CHRVO      ----------------------------------------------------------------------
TRPB_BACC2      ---------------------------------------------------------KEAMQDEAFQKEL
TRPB_ANAVT      -------------------------------------------PETLMPALAEETAYQKYRHDPGFQAEL
TRPB_ALKMQ      ----------------------------------------------------------------------
TRPB_ACICA      ----------------------------------------MAALEDLENLYNDEQFLAEFDRDLAYY---
TRPB_ACIAD      ----------------------------------------MAALEDLENLYNDEQFLAEFDRDLAYY---
TRPB_CORGL      ----------------------------------------------------------------------
TRPB_BACCQ      ----------------------------------------------------------------------
TRPB1_METTH     ----------------------------------------------------------------------
TRPB_STAS1      -------------------------------------------PETLMPAIQEKQAYQDAKNDPQFQIEL
TRPB_BRAJA      --------------------------------------------ETLMPLILDEKAYTAAKADPAFQAEM
TRP_YEAST       ----------------------------------------------------------------------
TRPB_STRPN      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRP7      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_DECAR      ----------------------------------------------------------------------
TRPB_BACP2      ----------------------------------------------------------ELKEDPAFEQEY
TRPB2_WOLSU     -------------------------------------------PETLMPALLEESAYNELRFDREFWSEV
TRPB1_ARCFU     ----------------------------------------------------------------------
TRPB_CORGB      ----------------------------------------------------------------------
TRPB_STRZP      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRP4      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_OCEIH      -------------------------------------------PELLMPAVLEEKAYEDALKDESFNEEL
TRPB_NITEC      ----------------------------------------------------------------------
TRPB_MYCTU      -----------------------------------VPEALMAVIEEVTAAYQKERVSQDFLDDLDR----
TRPB_MYCBO      -----------------------------------VPEALMAVIEEVTAAYQKERVSQDFLDDLDR----
TRPB_BACC7      ----------------------------------------------------------------------
TRPB_ACICJ      -------------------------------------------------------------DDPDFMREF
TRPB1_WOLSU     ----------------------------------------------------------------------
TRPB1_ANASP     -------------------------------------------PETLMPALGEETAYQKYRDDASYQTEL
TRPB_STRZT      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRR6      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRPS      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRPJ      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRPI      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_STRP2      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_NOVAD      --------------------------------------------ETLMPLILDEREYNAAKADPAFKAEF
TRPB_NEIG2      ----------------------------------------------------------------------
TRPB_STRZJ      -------------------------------------------PETLMTAVLEEKAYRESQADPSFQEEL
TRPB_PHEZH      ----------------------------------------------------------------------
TRPB_MYCLE      -----------------------------------VPEALMAVIEEVTAAYEKERVNQD------FLDLL
TRPB_PSEF5      ----------------------------------------------------------------------
TRPB_NITEU      ----------------------------------------------------------------------
TRPB_NEIMF      ----------------------------------------------------------------------
TRPB_NEIMB      ----------------------------------------------------------------------
TRPB_NEIMA      ----------------------------------------------------------------------
TRPB_NEIM0      ----------------------------------------------------------------------
TRPB_THET8      ----------------------------------------------------------------------
TRPB_THET2      ----------------------------------------------------------------------
TRPB_SYNJB      ----------------------------------------------------------------------
TRPB_PSEAE      --------------------------------------GQYVA-ETLMPLILD-LAREKAKDDPAF---Q
TRPB_NEIG1      ----------------------------------------------------------------------
TRPB_LACPL      ----------------------------------------------------------------------
TRPB_LACC3      ----------------------------------------------------------------------
TRPB2_VIBPA     -----------------------------------------------------ELEQIMRDINAAYEECP
TRPB_PSEPF      ----------------------------------------------------------------------
TRPB_PSESH      --------------------------------------------ETLMPLVLD--LNREYEAAKADPEFA
TRPB_PROM1      -------------------------------------------PETLIPALIEEQAAKEAWKDSSFNSEL
TRPB_METFK      ----------------------------------------------------------------------
TRPB_LACCB      ----------------------------------------------------------------------
TRPB_CLOK5      -------------------------------------------------------------EDSKFIDEY
TRPB_CLOK1      -------------------------------------------------------------EDSKFIDEY
TRP_SCHPO       ----------------------------------------------------------------------
TRPB_THIDA      ----------------------------------------------------------------------
TRPB_STRMU      -------------------------------------------PETLAVIELDEAYREAKADPSFHEEL-
TRPB_PSESM      ----------------------------------------------------------------------
TRPB_PROMT      -------------------------------------------PETLIPALIEEQAAKEAWKDSSFNSEL
TRP_COPCI       ------------EGQVPQFVENYCREVSGKGEPVRSPGAAQRTPSQLTPQFGGQYVPESLVDALAELEIE
TRPB_METJA      ----------------------------------------------------------------------
TRPB_HALVO      -------------------------------------------PEALMPAITDAYERYVLDNEDGFMDDF
TRPB_HELPY      ----------------------------------------------------------------------
TRPB_CAMAC      ---------------------------------------------------------RSLSGDQVFQKEL
TRPB2_CHLCV     ----------------------------------------------------------------------
TRPB_STRCO      ----------------------------------------------------------------------
TRPB_RALSO      ----------------------------------------------------------------------
TRPB_PSEU2      ----------------------------------------------------------------------
TRPB_MYCIT      ----------------------------------------MAVIEEVTTAYEKERVNQDFLDTLDY----
TRPB_METCA      --------------------------MQDEIQPYDLPD-ELGHFGPYGGIFVAETLMEPLEELKAYLKDP
TRPB_BRASB      -----------------------------------------------------------LDLEKAYADAK
TRPB_ACIAC      ----------------------------------------------------------------------
TRPB_XANCP      ----------------------------------------IAPLQELSAAY--DLARQ----DPAFIAEY
TRPB_XANCB      ----------------------------------------IAPLQELSAAY--DLARQ----DPAFIAEY
TRPB_XANC8      ----------------------------------------IAPLQELSAAY--DLARQ----DPAFIAEY
TRPB_HELHP      ----------------------------------------------------------------------
TRP_COPC7       ----------------------------------------------------------------------
TRPB_SYNSC      -------------------------------------------------------------NDPAFTDEL
TRPB_SYNY3      ----------------------------------------------------------------------
TRPB_PSE14      --------------------------------------------ETLMPLVLD--LNREYEAAKADPEFA
TRPB_METTM      ----------------------------------------------------------------------
TRPB_STRAW      ----------------------------------------------------------------------
TRPB_RHOPB      ----------------------------------------------------------------------
TRPB_PSEPW      ----------------------------------------------------------------------
TRPB_PSEE4      ----------------------------------------------------------------------
TRPB_SULSY      ----------------------------------------------------------------------
TRPB_PSESY      ----------------------------------------------------------------------
TRPB_PARL1      ----------------------------------------------------------------------
TRPB_BRASO      -----------------------------------------------------------LDLEKAYADAK
TRPB_AZOVD      ----------------------------------------------------------------------
TRPB1_MAIZE     ----------------------------------------------------------------------
TRPB_RHOS4      ----------------------------------------------------------------------
TRBP2_ARATH     -------------------------------------------------------------------DFQ
TRPB_PSEPG      ----------------------------------------------------------------------
TRPB_PROMA      ----------------------------------------------------------------------
TRPB_EXIS2      -------------------------------------------PETLMQAVLEEQAYAEVKEDPAFRERM
TRPB2_MAIZE     ----------------------------------------------------------------------
TRPB_STRTD      -------------------------------------------PETLAVIELDKAYREAKEDSSFQAELD
TRPB_STRMK      ----------------------------------------------------------------------
TRPB_SILPO      ----------------------------------------------------------------------
TRPB_PSEPU      ----------------------------------------------------------------------
TRPB_PSEPK      ----------------------------------------------------------------------
TRPB_PSEP1      ----------------------------------------------------------------------
TRPB_METLZ      ----------------------------------------------------------------------
TRPB_LEPCP      --------------------------------------------------FVAETLSHALDELNAYRHDP
TRPB_BACV8      ----------------------------------------------------------------------
TRPB1_THEMA     ----------------------------------------------------------------------
TRPB1_ARATH     ----------------------------------------------------------------------
TRPB_XANOM      ----------------------------------------------------------------------
TRPB_HELPJ      ----------------------------------------------------------------------
TRPB_STRT2      -------------------------------------------PETLAVIELDKAYREAKEDSSFQAELD
TRPB_METPB      ----------------------------------------------------------------------
TRPB_BACTN      ----------------------------------------------------------------------
TRPB_STRM5      ----------------------------------------------------------------------
TRPB_SILST      ----------------------------------------------------------------------
TRPB_ROSDO      ----------------------------------------------------------------------
TRPB_DINSH      ----------------------------------------------------------------------
TRPB_AZOPC      ----------------------------------------------------------------------
TRPB_XANOP      ----------------------------------------------------------------------
TRPB_RHOFD      ----------------------------------------------------------------------
TRPB_PROM5      -------------------------------------------PETLMPALFEEKAASDAWKDKQFVDEL
TRPB_NEIGO      ----------------------------------------------------------------------
TRPB_METC4      ----------------------------------------------------------------------
TRPB_STRT1      -------------------------------------------PETLAVIELDKAYREAKEDSSFQAELD
TRPB_LISMF      ----------------------------------------------------------------------
TRPB_LISMC      ----------------------------------------------------------------------
TRPB_BUCBP      ----------------------------------------------------------------------
TRPB_BACFR      ----------------------------------------------------------------------
TRPB_BACFN      ----------------------------------------------------------------------
TRPB_RHOP2      --------------------------------------------ETLMPILALEKAYAEAKDDPAFRAEM
TRPB_LISMH      ----------------------------------------------------------------------
TRPB_XANC5      ----------------------------------------------------------------------
TRPB_XANAC      ----------------------------------------------------------------------
TRPB_OLICO      ----------------------------------------------------------------------
TRPB_LISMO      ----------------------------------------------------------------------
TRPB_JANSC      -------------------------------------------------------------DDSFWAEMQ
TRPB_ENT38      ----------------------------------------------------------------------
TRPB_DEIRA      ----------------------------------------------------------------------
TRP_NEUCR       ----------------------------------------------------------------------
TRPB_XYLFM      ----------------------------------------------------------------------
TRPB_RHOP5      --------------------------------------------ETLMPLILDEKAYAEAKIDPAFRAEM
TRPB_META3      ----------------------------------------------------------------------
TRPB_XYLFA      ----------------------------------------------------------------------
TRPB_PASMU      --------------------------------------GGMYVPEILMPVLKNEKAFVEAQQDPTF---K
TRPB_METKA      ----------------------------------------------------------------------
TRPB_VEREI      ----------------------------------------------------------------------
TRPB_SYNPW      --------------------------------------------------------------DPAFTAEL
TRPB_LISW6      -------------------------------------------PETLAVIELDEAYRASKTDSAFQKELN
TRPB_LISIN      ----------------------------------------------------------------------
TRPB_HALSA      -------------------------------------------PEVLMPALTDAYERYVLDNEDGFVDDF
TRPB_HALS3      -------------------------------------------PEVLMPALTDAYERYVLDNEDGFVDDF
TRPB_GLOVI      ----------------------------------------------------------------------
TRPB_CHLTE      ----------------------------------------------------------------------
TRPB_VIBCM      ----------------------------------------------------------------------
TRPB_VIBCH      ----------------------------------------------------------------------
TRPB_VIBC3      ----------------------------------------------------------------------
TRPB_PROMP      -------------------------------------------PETLMPALFEEEAASDAWKDKQFVNEL
TRPB_NITMU      ----------------------------------------------------------------------
TRPB_RHOPT      --------------------------------------------ETLMPLILDEKAYAEAKADPAFRAEM
TRPB_RHOPS      --------------------------------------------ETLMPLILEEKAYAEAKDDPAFRTEM
TRPB_RHOPA      --------------------------------------------ETLMPLILDEKAYAEAKADPAFRAEM
TRPB_METRJ      ----------------------------------------------------------------------
TRPB_BACSK      ----------------------------------------------------------------------
TRPB_XYLFT      ----------------------------------------------------------------------
TRPB_XYLF2      ----------------------------------------------------------------------
TRPB_BEII9      ----------------------------------------------------------------------
TRPB_METS4      ----------------------------------------------------------------------
TRPB_METNO      ----------------------------------------------------------------------
TRPB_PROMH      -------------------------------------------PEILIPAL-DQLEQAFIDNDPSFQQEF
TRPB_SYNPX      -------------------------------------------------------------NDPAFTAEL
TRPB_PROMM      --------------------------------------------------------------DPAFTAEL
TRPB_PROM0      ---------FSRKDQ---NYKNDDLNQPSKEGRFGKYGGQYV-PETLMPALFEETAASNAWKDKLFVEEL
TRPB2_COREF     -------------------------------------------PEVLLPAL-DELEREALEDPTFQQELD
TRPB_SYNS9      --------------------------------------------------------------DPAFTGRL
TRPB_SHEHH      ----------------------------------------------------------------------
TRPB_STRGG      ----------------------------------------------------------------------
TRPB_BACSU      ---------------------------------------------DFGGKFVPETLMQPLDEQTAFKQIK
TRPB_SYNS3      --------------------------------------------------------------DSAFTTEL
TRPB_LEIXX      ----------------------------------------------------------------------
TRPB_ELUMP      -----------------------------------VPKELIVPLAEIADCFNNTAFTKEFQDELFYY---
TRPB_BUCSC      ----------------------------------------------------------------------
TRPB_PROMS      -------------------------------------------PETLMPALFEEDAASNAWKDKLFVEEL
TRPB_PHOLL      ----------------------------------------------------------------------
TRPB_PROM2      -------------------------------------------PETLMPALFEETAASNAWKDKLFVKEL
TRPB_PROM9      ---------FSRQDQ---NYKNDDLNQPSKEGRFGKYGGQYV-PETLMPALFEETAASNAWKDKLFVKEL
TRPB_ACIBL      ----------------------------------------------------------------------
TRPB1_COREF     --------------------------------------GQFVA-ESLLPAL--DQLEKAFVDATNHPEFR
TRPB_PROM4      ----------------------MTSTLPSQPKDMELANGGQYVPETLMPXXXXXXXXXXXXQDSSFTNEL
TRPB_FRAP2      ----------------------------------------------------------------------
TRPB_ACTP7      ----------------------------------------------------------------------
TRPB_PARD8      ----------------------------------------------------------------------
TRPB_BUCAI      ----------------------------------------------------------------------
TRPB_VIBHB      ----------------------------------------------------------------------
TRPB_PHOPR      ----------------------------------------------------------------------
TRPB_ERWT9      ----------------------------------------------------------------------
TRPB_BUCAP      ----------------------------------------------------------------------
TRPB_ALTMD      --------------------------------------GGMYVPELLIPAL-DQLEKAFLDEDPSF---N
TRPB_ACTP2      ----------------------------------------------------------------------
TRPB_CHLTR      ------------------------------------PFGGAFLPEELAPIQNLKAEWEILKTQQSFLSEL
TRPB_ACTPJ      ----------------------------------------------------------------------
TRPB_TOLAT      --------------------------------------GGMYSPQILMPVLLEEKAFVDAKDDPEFQAEF
TRPB_CLAMS      -----------------------------------VPESLVAALDELSAAW------EELKVDPAFV---
TRPB_EDWI9      ----------------------------------------------------------------------
TRPB_HAEI8      ----------------------------------------------------------------------
TRPB_CAMJR      ----------------------------------------------------------------------
TRPB_CAMJJ      ----------------------------------------------------------------------
TRPB_CAMJE      ----------------------------------------------------------------------
TRPB_CAMJ8      ----------------------------------------------------------------------
TRPB_SHEAM      --------------------------------------------------------------ETAFVEAP
TRPB_PECCP      ----------------------------------------------------------------------
TRPB_BUCDN      ----------------------------------------------------------------------
TRPB_ALISL      ----------------------------------------------------------------------
TRPB_SERP5      ----------------------------------------------------------------------
TRPB_CAMJD      ----------------------------------------------------------------------
TRPB_VIBFM      ----------------------------------------------------------------------
TRPB_SHEB5      ----------------------------------------------------------------------
TRPB_ERWCT      ----------------------------------------------------------------------
TRPB_ACTSZ      ----------------------------------------------------------------------
TRPB_SHESW      ----------------------------------------------------------------------
TRPB_SHEPC      ----------------------------------------------------------------------
TRPB_SHEB9      ----------------------------------------------------------------------
TRPB_SHEB8      ----------------------------------------------------------------------
TRPB_BACA2      ----------------------------------------------------------------------
TRPB_MANSM      ----------------------------------------------------------------------
TRPB_AERHH      ----------------------------------------------------------------------
TRPB_HAEIN      ----------------------------------------------------------------------
TRPB_HAEIE      ----------------------------------------------------------------------
TRPB_VIBF1      ----------------------------------------------------------------------
TRPB_CLAM3      --------------------------------------------------------------DPAFI---
TRPB_AERS4      ----------------------------------------------------------------------
TRPB_SODGM      ----------------------------------------------------------------------
TRPB_SHEDO      ----------------------------------------------------------------------
TRPB_SHEFN      --------------------------------------GGMYVPQILVPALKQETAFVEAQQDESFIAEF
TRPB_HAEIG      ----------------------------------------------------------------------
TRPB_SHEPA      --------------------------------------------------------------ETAFIEAQ
TRPB_SHEON      ----------------------------------------------------------------------
TRPB_FUSNN      --------------------------------------------------YVPEVVQKALDKEEAYNKYK
TRPB_SHESM      ----------------------------------------------------------------------
TRPB_SHESA      ----------------------------------------------------------------------
TRPB_PSEA6      --------------------------------------GGMYVPELLIPAL--DQLEQAFIDAQNDPEFQ
TRPB_BLOPB      ----------------------------------------------------------------------
TRPB_FRATW      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_FRATT      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_FRATM      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_FRAT1      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_ENTS8      ----------------------------------------------------------------------
TRPB_SALTY      ----------------------------------------------------------------------
TRPB_SALTI      ----------------------------------------------------------------------
TRPB_SALSV      ----------------------------------------------------------------------
TRPB_SALPK      ----------------------------------------------------------------------
TRPB_SALPC      ----------------------------------------------------------------------
TRPB_SALPB      ----------------------------------------------------------------------
TRPB_SALPA      ----------------------------------------------------------------------
TRPB_SALNS      ----------------------------------------------------------------------
TRPB_SALHS      ----------------------------------------------------------------------
TRPB_SALG2      ----------------------------------------------------------------------
TRPB_SALEP      ----------------------------------------------------------------------
TRPB_SALDC      ----------------------------------------------------------------------
TRPB_SALCH      ----------------------------------------------------------------------
TRPB_SALA4      ----------------------------------------------------------------------
TRPB_BLOFL      ----------------------------------------------------------------------
TRPB_YERPY      ----------------------------------------------------------------------
TRPB_YERPS      ----------------------------------------------------------------------
TRPB_YERPP      ----------------------------------------------------------------------
TRPB_YERPN      ----------------------------------------------------------------------
TRPB_YERPE      ----------------------------------------------------------------------
TRPB_YERPB      ----------------------------------------------------------------------
TRPB_YERPA      ----------------------------------------------------------------------
TRPB_YERP3      ----------------------------------------------------------------------
TRPB_VIBME      ----------------------------------------------------------------------
TRPB_SALAR      ----------------------------------------------------------------------
TRPB_FRATO      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_FRATH      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_FRATF      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_KLEP7      ----------------------------------------------------------------------
TRPB_FRATN      -------------------------------------------PQILVPAL--DQLEQEFIKAQADESFK
TRPB_KLEP3      ----------------------------------------------------------------------
TRPB_BUCMH      ----------------------------------------------------------------------
TRPB_VIBVY      ----------------------------------------------------------------------
TRPB_VIBVU      ----------------------------------------------------------------------
TRPB_SHIBS      ----------------------------------------------------------------------
TRPB_SHIB3      ----------------------------------------------------------------------
TRPB_SHISS      ----------------------------------------------------------------------
TRPB_SHIDS      ----------------------------------------------------------------------
TRPB_ECOUT      ----------------------------------------------------------------------
TRPB_ECOSM      ----------------------------------------------------------------------
TRPB_ECOLU      ----------------------------------------------------------------------
TRPB_ECOL6      ----------------------------------------------------------------------
TRPB_ECOL5      ----------------------------------------------------------------------
TRPB_ECOK1      ----------------------------------------------------------------------
TRPB_ECO81      ----------------------------------------------------------------------
TRPB_ECO7I      ----------------------------------------------------------------------
TRPB_ECO5E      ----------------------------------------------------------------------
TRPB_ECO57      ----------------------------------------------------------------------
TRPB_ECO45      ----------------------------------------------------------------------
TRPB_ECO27      ----------------------------------------------------------------------
TRPB_YERE8      ----------------------------------------------------------------------
TRPB_SHIFL      ----------------------------------------------------------------------
TRPB_SHIF8      ----------------------------------------------------------------------
TRPB_ECOSE      ----------------------------------------------------------------------
TRPB_ECOLI      ----------------------------------------------------------------------
TRPB_ECOLC      ----------------------------------------------------------------------
TRPB_ECOHS      ----------------------------------------------------------------------
TRPB_ECODH      ----------------------------------------------------------------------
TRPB_ECO8A      ----------------------------------------------------------------------
TRPB_ECO55      ----------------------------------------------------------------------
TRPB_ECO24      ----------------------------------------------------------------------
TRPB1_VIBPA     ----------------------------------------------------------------------
TRPB_ESCF3      ----------------------------------------------------------------------
TRPB_CITK8      ----------------------------------------------------------------------
TRPB_SHEWM      --------------------------------------GGMYVPQILMPALKQETAFVEAQEDEAFKTEF
TRPB_SHEPW      --------------------------------------GGMYVPQILMPALKQETAFIEAQQDEAFQKEF
TRPB_HAES2      ----------------------------------------------------------------------
TRPB_SHELP      ----------------------------------------------------------------------
TRPB_VIBSL      ----------------------------------------------------------------------
CYSM_BACSU      ----------------------------------------------------------------------
TRPB1_CHLCV     ---------------------------------------------------------EQLKKDPQFRETF
TRPB_SHESR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKAQDLDGITTETGA
TRPB2_METMA     AEILDVYRLWRPSPLFRAHQLEKDLKTPAKIYYKYEGVSPAGSHKTNTSIAQAYYNMKEGTERLTTETGA
TRPB2_METAC     EEVLDVYRLWRPSPLFRAHQLEKVLKSPAKIYYKYEGVSPAGSHKTNTSIAQAYYNMKEGTERLTTETGA
TRPB2_AQUAE     EEVLDIYSLWRPTPLHRAKNLEEFLGTPAKIFYKNESVSPPGSHKPNTAVAQAYYNKISGVKRLTTETGA
TRPB2_AERPE     GEVHEAYISFRPTPLLRAVNLERALNTPAEIYYKYEGVTPTGSHKINTALAQAYYNKLEGVERLVTETGA
TRPB_THELT      EPVLEEYAVFRPTPLFRATYLEEFLQTPARIYYKYEGASPTGSHKTNTALAQAYYNKISGTERLVTETGA
TRPB_THEON      KKVRELYKIGRPTPLFRATNLEKALETPARIYFKYEGATVTGSHKINTALAQAYYAKKQGIERLVTETGA
TRPB2_ARCFU     EDVREIYRIWRPTPLVRAERLEKALKTPARIYFKYEGASPPGSHKPNTAVAQAYYNAKEGVERLTTETGA
TRPB2_PYRFU     EEVRKMYKIGRPTPLFRATNLEKYLNTPARIYFKFEGATVTGSHKINTALAQAYYAKKEGIERLVTETGA
TRPB2_THEMA     EPVLKEYAVYRPTPLIRATFLEEYLQTPARIYYKYEGVSPTGSHKPNTAIAQAYYNKIEGVKRLVTETGA
TRPB_PYRHO      KEVRELYKIGRPTPLFRATNLEKILKTPARIYFKYEGATVTGSHKINTALAQAYYAKKEGIKRLVTETGA
TRPB2_METTH     REVMDVYKIGRPTPLFRAKGLEEMLDTPARIYYKREDYSPTGSHKLNTAIAQAYYARKDGAERLTTETGA
TRPB_THEGJ      KKVRELYKIGRPTPLFRATNLEKALGTPARIYFKYEGATVTGSHKINTALAQAYYAKEQGIERLVTETGA
TRPB2_PYRKO     KEVREIYKIGRPTPLFRATNLERALGTPARIYFKYEGATVTGSHKINTALAQAYYAKRQGIERLVTETGA
TRPB_FERNB      EPVLKEYAVYRPTPLVRATFLEEYLRTRTKIYYKYEGVSPTGSHKVNTAIAQAYYNKIAGTKTLVTETGA
TRPB2_PYRAB     GELRKLYKIGRPTPLFRATNLEKLLGTPARIYFKYEGATVTGSHKINTALAQAYYAKKQGIERLVTETGA
TRPB_THEAB      EEILKEYAVYRPTPLIRANFLEEYLQTPAKIYYKYEGQSPTGSHKTNTALAQAYYNKISGVKKLYTETGA
TRPB_DESK1      EAVRELLMLGRPTPLIRARRLEEALKTNARIFFKYEGVLPTGSHKINTAVAQAYYNAVESVERVSTETGA
TRPB_PYRAE      EEVREAYRVGRPTPLFRAEGLEKALGTGVRIYYKYEGVLPVGSHKLNTALAQAYYAKADGAVEVATETGA
TRPB1_SULSO     EEVRDRYSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTETGA
TRPB1_SULTO     EEVRDRYAIIRPTPLMRAKRLEEYLDTPAKIYFKFEGATPTGSHKINTAVPQAYFAAEEGISHVVTETGA
TRPB_PYRAR      EEVRDAYRVGRPTPLLRAEGLERALGTGVRIYYKYEGVLPVGSHKLNTALAQAYYAKADGAVEVATETGA
TRPB2_SULTO     EEVLQRYQVGRPTPIIRARKLEEYLGGYIKIYMKMESHTYTGSHKINSALAHVYFAKLDNAKFVSTETGA
TRPB2_SULSO     DEVLERYQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETGA
TRPB_PYRIL      XXXXXXXXXXXXTPLLRAEGFERALGTKVHIYYKYEGVLPVGSHKLNTAVAQAYYAKADGAVEVATETGA
TRPB_THEVO      GEIYEKYQVGRPTPIIRAKNLEEFLGGNIKIYLKMESYTYSGSHKINSALAHVFFAKQDNAKFVSTETGA
TRPB_PICTO      DEIIDKYQIGRPTPLIRAKNLEKYLDYGGKIFFKFEGATATGSHKINTAIAQAYYAMNENANGVTTETGA
TRPB_THEAC      DEILERYQVGRPTPIIRAXXXXXXXXXXXXIFLKMESYTYSGSHKINSALAHVFFAREEGAKFVSTETGA
TRPB1_AERPE     GEVRKLARIGRPTPLIRAEGLEKVLGVKGRIYYKSEAVLPTGSHKINTAIAQAYYAKLDGAKEIVTETGA
TRPB_THEPX      ---MEEYRYYRPTPLYYAENLTKKLGG-AKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGA
TRPB_BACHD      KEHLREYA-GRPTALTYAKNMSETLGG-AKIYLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGA
TRPB_BRUSU      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUSI      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUC2      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUME      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUMB      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUAB      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUA2      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_BRUA1      ----------RPSKLYYAEGLSKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_OCHA4      ---LSTYYAGRPSKLYYAEGLTKHLGG-AKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_GEOTN      ---LQHYS-GRPTPLTFAPNLTRQLGG-AKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGA
TRPB_BACST      ---LQHYS-GRPTPLTFAPNLTRQLGG-AKMYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGA
TRPB1_METMA     ----------RETPLYLARNLSKKYGT--KIYLKREDLVHGGAHKLNNAIGQALLAKYMGKTRLIAETGA
TRPB_THEP3      ---MEEYRYYRPTPLYYAENLTKRLGG-AKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGA
TRPB1_PYRKO     EYYLRNWA-GRPTPLYYAERLSKKLGG-AKIYLKREDLLHGGAHKTNNGIGQALLAKFMGKERLIAETGA
TRPB_RHIEC      ---LGAHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_RHILW      ---LGAHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB1_PYRAB     ----------RPTPLYYAERLTKKVGG-AKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
TRPB_RHIET      --------IGRPSPLYFAERLTAELGG-AKIYFKREDMNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_RHIL3      ---LGAHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB1_PYRFU     ----------RPTPLYYAKRLTEKIGG-AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGA
TRPB_RHIE6      ---LGAHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_AGRRK      ---LGTHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_THETN      EKFMEEYRYYRPTPLYYAENLTKRLGG-AKIYLKREDLNHTGAHKINNVLGQVLLAKRMGKKRIIAETGA
TRPB_STAES      NYYLSEY-VGRETPLTFAESYTKLLGG-AKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGA
TRPB_STAEQ      NYYLSEY-VGRETPLTFAESYTKLLGG-AKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGA
TRPB_TRIEI      QQLLRDY-VGRPSPLYFAERLTKPDGTGPQIYLKREDLNHTGAHKINNALGQALLAQRMGKQRIIAETGA
TRPB_CLONN      --------IGRPSLLYYAKRLTKSLGG-AKIYLKREDLNHTGAHKINNAIGQILLAKRMGKKKVIAETGA
TRPB1_METAC     ESLAELDHYLRDTPLYFARNLSKKYGT--KVYLKREDLVHGGAHKLNNALGQALLAKFMGKTRLIAETGA
TRPB_CLOB8      MYYLNYYT-GRPSPLYYAENMTKDLGG-AKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKVIAETGA
TRPB_BORPA      NYELKHF-VGRPSPVYHASRWSQRLGG-AQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGA
TRPB_BORBR      NYELKHF-VGRPSPVYHASRWSQRLGG-AQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGA
TRPB_PARDP      DDLWKHY-VGRPSPLYFAPRLTEELGG-AKIYLKREELNHTGSHKINNVLGQILLARRMGKTRIIAETGA
TRPB_BORPE      NYELKHF-VGRPSPVYHASRWSQRLGG-AQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGA
TRPB_AGRT5      ----------RPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_CLOBA      ----------RPTPVYHCERLSRAIGN-CQIYLKREDLNHTGAHKLNHCMGEGLLAKFMGKKRLIAETGA
TRPB_BACLD      QKLLNDYS-GRPTALTFADQLTKQLGG-AKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGA
TRPB_STAAR      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_SINMW      ---LGRHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_LEGPL      ----------RPNPLYHAVHLSKKIGG-AQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGA
TRPB_LEGPH      ----------RPNPLYHAVHLSKKIGG-AQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGA
TRPB_LEGPC      ----------RPNPLYHAVHLSKKIGG-AQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGA
TRPB_LEGPA      ----------RPNPLYHAVHLSKKIGG-AQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGA
TRPB_AGRVS      ----------RPSPLYFAERLTAELGG-AKIYFKRDELNHTGSHKINNCLGQILLAKRMGKTRIIAETGA
TRPB_RUTMC      EQDLKHY-VGRETPLYHAQNLSKKLDG-AQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRIIAETGA
TRPB_RHOBA      ----------RPSPLYHAKRLSSAVGG-AQIWLKREDLNHTGAHKINNTIGQALLTLRMGKTRVIAETGA
TRPB_POLNA      ----------RPSPIYHAARMSREQGG-AQIYLKREDLNHTGAHKINNTIGQAMLARRMGKQRIIAETGA
TRPB_RHISN      ---LGAHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_CLOBB      ----------RPTPVYHCERLSRAIGN-CQIYLKREDLNHTGAHKLNHCMGEGLLAKFMGKKRLIAETGA
TRPB_STAAN      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAAM      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAA9      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAA2      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAA1      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_MESSB      ----------RPSPLYFAERLTEHLGG-AKVYFKREELNHTGSHKVNNCLGQILLAKRMGKTRIIAETGA
TRPB_STAAS      EYYLSEY-VGRATPLTYAASYTESLGS-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAAB      EYYLSEY-VGRTTPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_RHIME      ---LGTHYIGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGA
TRPB_LACLS      ----------RENPLYFAKRLTEYAGG-AKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGA
TRPB_BACC1      NHYLKTY-VGRETPLYYAENMTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_LEPIN      --------IGRPSPLTYAERLSKVWGG-AKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGA
TRPB_LEPIC      --------IGRPSPLTYAERLSKVWGG-AKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGA
TRPB_LEPBL      --------IGRPSPLTYAERLTK-VWDGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGA
TRPB_LEPBJ      --------IGRPSPLTYAERLTK-VWDGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGA
TRPB_LACLM      ----------RENPLYFAKRLTEYAGG-AKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGA
TRPB_CAUCR      ----------RPSPLYFAERLTEHFGG-AKIYFKRDELNHTGSHKINNALGQILLAMRMGKTRIIAETGA
TRPB_BACWK      NHYLQTY-VGRETPLYFAENMTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_THEEB      AELQQLLRDYRPSPLYFAERLSAHYAVQPQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGA
TRPB_BACC3      NHYLNTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACAH      NHYLNTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_ANOFW      -----MHHLYRPTALTFAKNLTERLGG-AKMYFKREDLNHTGAHKINNAIGQALLAKRMGKRKIIAETGA
TRPB2_ANASP     QQLLRDY-VGRATPLYFAERLTRPDGTGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGA
TRPB_VESOH      ----------RETPLYYAKNLSKKL-RGAQIYLKREDLNHTGSHKINNTIGQALLAKRMGKTRIIAETGA
TRPB_STAAW      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAAT      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAAE      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAAC      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAA8      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_STAA3      EYYLSEY-VGRATPLTYAASYTESLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGA
TRPB_CLOAB      ---LEKY-VGRETPLYFAENMTKNLGG-AKIYLKREDLNHTGSHKLNNALGQVLLAKRMGKKRVIAETGA
TRPB1_AQUAE     ----------RPTPLYFAEKLTKYVGG-AKIYLKREDLLHTGAHKINNTIGQCLLTKRMGKKRVIAETGA
TRPB_BORPD      ----------RPSPVYHAARWSRELGG-AQIWFKREDLNHTGAHKVNNCIGQALLARHMGKPRVIAETGA
TRPB_ACIF5      HSELRQF-VGRPNPLYHAGRLSRELGG-AQIYLKREDLNHTGAHKINNAVGQALLARRMGKKRVIAETGA
TRPB_ACIF2      HSELRQF-VGRPNPLYHAGRLSRELGG-AQIYLKREDLNHTGAHKINNAVGQALLARRMGKKRVIAETGA
TRPB_LACLA      KDPLELLKDYRENPLYYAKRLTEYAGG-AKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGA
TRPB_BACCZ      NHYLKTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_METPP      EFVAEFHFVGRPSPIYHAARMSRELGG-AQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGA
TRPB_BACHK      NHYLKTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACCR      NHYLKTY-IGRETPLYYAENMTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACC4      NHYLKTY-VGRETPLYFAENLTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACAN      NHYLKTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACAC      NHYLKTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_BACAA      NHYLKTY-VGRETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_RHILO      ----------------REVSSAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLAKRMGKKRIIAETGA
TRPB_LEPBP      ----------RPSPLTYAERLTKQWGG-ARIWLKREDLNHTGAHKINNAIGQALIAKFMGKKRIIAETGA
TRPB_LEPBA      ----------RPSPLTYAERLTKQWGG-ARIWLKREDLNHTGAHKINNAIGQALIAKFMGKKRIIAETGA
TRPB_LACCA      ----------RPSLLYYAKNMTEDLGG-AKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETGA
TRPB_POLSJ      EFLAEFHSVGRPSPIYHAARMSREQGG-AQIYLKREDLNHTGAHKINNTIGQAMLARRMGKTRIIAETGA
TRPB_METVO      AYYLKHYA-GRETPLYYAKNLTEKLGG-AKIYLKREDLLHGGAHKTNNTIGQALLAKKMGKTRIIAETGA
TRPB_CHRVO      ----------RPSPVYHAKRWSEQLGG-AQIWFKREDLNHTGAHKINNAIGQALLARRMGKKRVIAETGA
TRPB_BACC2      NHYLKTY-VGRETPLYFAENMTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_ANAVT      QQLLRDY-VGRATPLYFAERLTRPDGTGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGA
TRPB_ALKMQ      ----EMYRYYRPTPLYYAENLTKKLGG-GKIYLKREDLNHTGAHKINNVIGQVLLARKMKKKRIIAETGA
TRPB_ACICA      --------VGRPSPLYYAERWSKKLGG-AQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGA
TRPB_ACIAD      --------VGRPSPLYYAERWSKKLGG-AQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGA
TRPB_CORGL      ----------RPTPLTECSNLPLAGEGKARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIAETGA
TRPB_BACCQ      ----------RETPLYFAENMTKYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB1_METTH     ----------KPTGLYYARNLSEKLG--CRVYLKREDMLHTGAHKINNTIGQALLARYMGKTRIIAETGA
TRPB_STAS1      DDYLKDY-VGRETPLTYAKSYSELLGG-AKIYLKREDLNHTGAHKINNALGQALLAKRMGKNKLVAETGA
TRPB_BRAJA      NGYLKNY-VGRPSPLYFAERLTEHLGG-AKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAETGA
TRP_YEAST       --------IGRPSSLHKAERLEHCQG--AQIWLKREDLNHTGSHKINNALAQVLLAKRLGKKNVIAETGA
TRPB_STRPN      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRP7      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_DECAR      ----------RPSPIYHAKRWSEMLGG-AQIYLKREDLNHTGAHKVNNCIGQAMLAKRMGKPRVIAETGA
TRPB_BACP2      LSLLHNYS-GRPTALTYADQLSAYLGG-AKIYLKREDLNHTGAHKINNALGQALLAKKMGKSNIIAETGA
TRPB2_WOLSU     DYYLKEY-VGRPSPLYYAERLSDELG--AKIYLKREDLNHTGAHKINNTVIQGLLAKRLGKKKIIAETGA
TRPB1_ARCFU     ----------RPTPLYFAENLSRELGV--KIYLKREDLLHGGAHKINNTIGQALLAKFMGKKRVIAETGA
TRPB_CORGB      ----------RPTPLTECSNLPLSGEGKARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIAETGA
TRPB_STRZP      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRP4      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_OCEIH      QTYLTEY-IGRETPLYHAKKLTEHAGG-AQIYLKREDLNHTGAHKINNTIGQALLTLRMGKKKVVAETGA
TRPB_NITEC      ----------RPSPIYHARRWSDHLGG-AQILLKREDLNHTGAHKINNTVGQALLARRMGKSRIIAETGA
TRPB_MYCTU      ---LQANYAGRPSPLYEATRLSQHAGS-ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGA
TRPB_MYCBO      ---LQANYAGRPSPLYEATRLSQHAGS-ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGA
TRPB_BACC7      ----------RETPLYFAENMTEYCGG-AKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGA
TRPB_ACICJ      QYYLQHY-VGRPSPLWFAERLTKELGG-AKVYFKRDELNHTGAHKINNCIGQILLAKRMGKTRIIAETGA
TRPB1_WOLSU     ----------RPTPLYYARRLSQKAGGAA-IYLKREDLNHTGAHKLNHCMXXXXXXXXXXXXXXXXETGA
TRPB1_ANASP     QNLLRDY-VGRPSPLYFAERLTEYYGTGAQIYLKREDLNHTGAHKINNALAQVLLAKRIGKQRVIAETGA
TRPB_STRZT      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRR6      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRPS      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRPJ      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRPI      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_STRP2      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_NOVAD      DDLLEHY-VGRPSPLYFAPRLTEELGG-AQVWFKRDELNHTGAHKINNCIGQILLAMRMGKTRIIAETGA
TRPB_NEIG2      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGA
TRPB_STRZJ      NQLLRQY-VGRETPLYYAKNLTQHIGG-AKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGA
TRPB_PHEZH      ----------RPSPLYFAERLTRHYGG-AKIYLKREELNHTGSHKINNCMGQILLAQRMGKTRIIAETGA
TRPB_MYCLE      DKLQANYA-GRPSPLYEATRLSEYAGS-VRIFLKREDLNHTGSHKINNVLGQTLLAQRMGKTRVIAETGA
TRPB_PSEF5      ----------RPSPLYFAERLTEHCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGA
TRPB_NITEU      ----------RPSPIYHAKRWSEHLGG-AQILLKREDLNHTGAHKVNNTVGQALLARRMGKGRIIAETGA
TRPB_NEIMF      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGA
TRPB_NEIMB      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGA
TRPB_NEIMA      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGA
TRPB_NEIM0      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGA
TRPB_THET8      ----------RPTPLYHAKRLSEYWGG-AQVFLKREDLLHTGAHKINNTLGQALLARRMGKRRVIAETGA
TRPB_THET2      ----------RPTPLYHAKRLSEYWGG-AQVFLKREDLLHTGAHKINNTLGQALLARRMGKRRVIAETGA
TRPB_SYNJB      ----------RPSPLYFAQRLTEYYGGP-QIYLKREDLNHTGAHKINNALGQVLLAVRMGKRRIIAETGA
TRPB_PSEAE      EELAYFQRDYRPSPLYFAERLTEHCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGA
TRPB_NEIG1      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGA
TRPB_LACPL      ----------RPSLLYHAQRLSDQLGG-AQIYFKREDLNHTGAHKINNVLGQALLAKKMGKKRLIAETGA
TRPB_LACC3      ----------RPSLLYYAKNMTEDLGG-AKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETGA
TRPB2_VIBPA     EFKDELARLYRPSPIFHAANLSKKYG--ADIYLKREDLNHTGAHKINHCLGEAILAKKMGKKKLIAETGX
TRPB_PSEPF      ----------RPSPLYFAERLTEFCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGA
TRPB_PSESH      KEMAYFQRDYRPNPLYFAERLTEFCDG-AKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
TRPB_PROM1      NHLLKTY-VGRSTPLYEATRLKNTLKGP-RIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_METFK      ----------RPSPVYYAERLTQKAGG-ARIYLKREDLNHTGAHKVNNTIGQALLAKRMGKPRVIAETGA
TRPB_LACCB      ----------RPSLLYYAKNMTEDLGG-AKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETGA
TRPB_CLOK5      MYYLQEYS-GRPTPLYYAENLTKNLGG-AKIYLKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETGA
TRPB_CLOK1      MYYLQEYS-GRPTPLYYAENLTKNLGG-AKIYLKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETGA
TRP_SCHPO       EKFWEEFRSYRPSALDYAKRLTEYCGG-AHIWLKREDLNHGGSHKINNCIGQILLAKRLGKNRIIAETGA
TRPB_THIDA      ----------RPSPVYHARRLSEEYGG-AQIYLKREDLNHTGAHKINNTIGQALLARRMGKKRVIAETGA
TRPB_STRMU      DALLKDY-VGRETPLYFAKRLTDYIGG-AKIYLKREDLNHTGAHKINNALGQVLLAKRMGKNKIIAETGA
TRPB_PSESM      --------IGRPNPLYFAERLTEFCGG-AKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
TRPB_PROMT      NHLLKTY-VGRSTPLYEATRLKNTLKGP-RIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRP_COPCI       DPAFEVRSLYRPSNLYLAENLTKEAGG-ANIWLKREDLNHTGSHKINNALGQILLAKRIGKTRIIAETGA
TRPB_METJA      ----------RPTPLYYAERLSEELG--CKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAETGA
TRPB_HALVO      RARLRDFG-GRPTPLQRADRLSERYDR--EVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGA
TRPB_HELPY      ----------RPSPLTLCQNIVS--NPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGA
TRPB_CAMAC      DGILKDY-VGRESPLYFAERLKRPNGEGPEIYLKREDLNHTGAHKINNAVAQALLAKRLGKKRIIAETGA
TRPB2_CHLCV     ----------RPTPLTEIKNFAKAIHGP-RIFLKREDLLHTGAHKINNALGQCLLAKHLGKTRIIAETGA
TRPB_STRCO      ----------RPSALTEVPRFAAEAGG-ARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAETGA
TRPB_RALSO      ----------RPSPIYHARRLTEHCGG-AQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGA
TRPB_PSEU2      ----------RPNPLYFAERLTEFCGG-AKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
TRPB_MYCIT      ---LQANYAGRPSPLYEAPRLSEQAG--ARIFLKREDLNHTGSHKINNVLGQALLAQRMGKKRVIAETGA
TRPB_METCA      EFLAELHYVGRPSPIYHAERLSRELGG-AQIFFKREDLNHTGAHKVNNTVGQALLAKRMGKRRVIAETGA
TRPB_BRASB      QAEMNSYRTHRPSPLYYAERLTQHLGG-AKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKRRIIAETGA
TRPB_ACIAC      ----------RPSPIYHAARMSREMGG-AQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGA
TRPB_XANCP      DKDLKHY-VGRPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_XANCB      DKDLKHY-VGRPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_XANC8      DKDLKHY-VGRPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_HELHP      ----------RPTPLIYAHNASKILKND--IYLKFEGLANTGAHKINNALGQVLLAKHMKKKRVIAETGA
TRP_COPC7       ----------RPSNLYLAENLTKEAGG-ANIWLKREDLNHTGSHKINNALGQILLAKRIGKTRIIAETGA
TRPB_SYNSC      NRLLKNY-VGRATPLYEAERLRRADGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGA
TRPB_SYNY3      ----------RSSPLYFAERLSRPDGTYPLIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGA
TRPB_PSE14      KEMAYFQRDYRPNPLYFAERLTEFCDG-AKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
TRPB_METTM      ----------RPTGLYHARNLSEKLG--CRVYLKREDMLHTGAHKINNTIGQALLAGYMGKRRLIAETGA
TRPB_STRAW      ----------RPSALTEVSRFAEHAGG-ARVFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVIAETGA
TRPB_RHOPB      ----------RPSPLYFAERLTDHLGG-AKIYFKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAETGA
TRPB_PSEPW      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_PSEE4      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_SULSY      ----------RPTPLYFASRLTDVVGG-AKIYLKREDLLHTGAHKINNTLGQVLLTKKIGKKRIIAETGA
TRPB_PSESY      ----------RPSPLYFAERLTEFCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGA
TRPB_PARL1      ----------RPSPLYLAARLTEHFGG-AKIYFKRDELNHTGSHKINNCLGQILLARRMGKTRIIAETGA
TRPB_BRASO      QGEMNSYRTHRPSPLYYAERLTEHLGG-AKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKKRIIAETGA
TRPB_AZOVD      ----------RPSPLYFAERLTEHCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKQRIIAETGA
TRPB1_MAIZE     ----------RESPLYFAERLKRADGTGPLIYLKREDLNHRGAHKINNAVAQALLAKRLGKQRIIAETGA
TRPB_RHOS4      ----------RPSPLYFAPRLTEHLGG-AKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGA
TRBP2_ARATH     RELAEILKDYRESPLYFAERLRRENGEGPLIYLKREDLNHTGAHKINNAVAQALLAKRLGKKRIIAETGA
TRPB_PSEPG      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_PROMA      ----------RETPLYEATRLTKHYGTVGRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_EXIS2      NDLLENY-VGRQTPLYYAEHLTRTIGG-AKIYLKREDLNHTGAHKINNTIGQALLAERMGKRKIVAETGA
TRPB2_MAIZE     ----------RESPLYFAERLKRADGTGPLIYLKREDLNHTGAHKINNAVAQALLAKRLGKQRIIAETGA
TRPB_STRTD      D-LLKNY-VGRETPLYHAKRLTDHIGG-AQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGA
TRPB_STRMK      ----------RPSPIYHAQRLSDHVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAETGA
TRPB_SILPO      ----------RPSPLYFAERLTEHLGG-AKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGA
TRPB_PSEPU      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_PSEPK      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_PSEP1      --------IGRPNPLYFAERLTEHCGG-AKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
TRPB_METLZ      ----------RETPLTFCRNMSEYCG--CKVYLKREDLVHGGAHKLNNTLGQALLAKAMGKKRLIAETGA
TRPB_LEPCP      EFIAEFHFVGRPSPVYHAARMSREVGG-AQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGA
TRPB_BACV8      ----------RPSPLYLANRLSKKYG--CKIYLKREDLNHTGAHKINNAIGQVLLAKRMGKKRIIAETGA
TRPB1_THEMA     ----------RPTPLYFARRLSEKYG--ARIYLKREDLLHTGAHKINNAIGQVLLAKKMGKTRIIAETGA
TRPB1_ARATH     ----------RESPLYFAERLRRENGEGPLIYLKREDLNHTGAHKINNAVAQALLAKRLGKKRIIAETGA
TRPB_XANOM      ----------RPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_HELPJ      ----------RPSPLTLCQNIVS--NPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGA
TRPB_STRT2      D-LLKNY-VGRETPLYHAKRLTDHIGG-AQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGA
TRPB_METPB      --------IGRPSPLYYAERLTEHLGQGAKIYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGA
TRPB_BACTN      ----------RPSPLYLARRLSEKYG--CKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGA
TRPB_STRM5      ----------RPSPIYHAQRLSDHVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAETGA
TRPB_SILST      ----------RPSPLYFAERLTNHLGG-AKVYMKRDELNHTGAHKVNNVLGQILLARRMGKTRIIAETGA
TRPB_ROSDO      ----------RPSPLYFAERLTDHLGG-AKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGA
TRPB_DINSH      ----------RPSPLYFAERLTERLGG-AKVYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGA
TRPB_AZOPC      ----------RPSPLYFAKRLSDK--HKCRIYIKREDLNHTGSHKINNTLGQILLSRKMGKTRIIAETGA
TRPB_XANOP      ----------RPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_RHOFD      ----------RPSPVYHADRMSREQGG-AQIFLKREDLNHTGAHKINNTIGQAMLARRMGKPRVIAETGA
TRPB_PROM5      NHLLKTY-VGRETPLYEAKRLTEHYQTKSRIWLKREDLNHTGAHKINNALGQALLAIRMGKERIIAETGA
TRPB_NEIGO      ----------RPSPVYHAARLSEHLGG-AQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGA
TRPB_METC4      --------IGRPSPLYFAERLTEHLGQGAKIFFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGA
TRPB_STRT1      D-LLKNY-VGRETPLYHAKRLTDYIGG-AQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGA
TRPB_LISMF      ----------RETPLYFAEQLTAHAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGA
TRPB_LISMC      ----------RETPLYFAEQLTAHAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGA
TRPB_BUCBP      ----------RPTPLTLCKNITK--NTNTKLYLKREDLLHGGAHKTNQVLGQALLAKKMSKKEIIAETGA
TRPB_BACFR      ----------RPSPLYPARRLSEKYG--CKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGA
TRPB_BACFN      ----------RPSPLYPARRLSEKYG--CKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGA
TRPB_RHOP2      DGYLKHY-VGRPSPLYFAERLTEHFGG-AKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAETGA
TRPB_LISMH      ----------RETPLYFAEQLTAHAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGA
TRPB_XANC5      ----------RPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_XANAC      ----------RPSPIYHAERLSREVGG-AQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGA
TRPB_OLICO      ----------RPSPLYFAERLTEHLGG-AKIYLKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAETGA
TRPB_LISMO      ----------RETPLYFAEQLTAHAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGA
TRPB_JANSC      D--LWTHYVGRPSPLYFAKRLTERLGG-AKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGA
TRPB_ENT38      ----------RPTALTKCRNLTE--GTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_DEIRA      ----------RPNSLYLAERLTEHAGG-AKIYLKREDQNFTGAHKINNCLAQALLAKRMGKQKIIAETGA
TRP_NEUCR       ----EEYRSYRPGQLHKAERLTEYAGG-ANIWLKREDLNHTGSHKIXXXXXXXXXXXXXXXXKIIAETGA
TRPB_XYLFM      ----------RPSPIYHAERLSRKVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGA
TRPB_RHOP5      DGHLKHY-VGRPSPLYFAERLTDHFGG-AKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAETGA
TRPB_META3      ----------RETPLYFAENLTKKMGG-AKIYLKREDLLLGGAHKINNSLGQALLAKRIGKTRIIAETGA
TRPB_XYLFA      ----------RPSPIYHAERLSRKVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGA
TRPB_PASMU      ETFLDLLKNYRPTALTRCRNLTQ--GSKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_METKA      ----------RPTPLYYARNLSRKLGV--KVYLKREDLVHGGAHKLNNTLGQALLADRMGKDRIIAETGA
TRPB_VEREI      ----------RPAPIYHAARSSREIGG-AQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGA
TRPB_SYNPW      NRLLKSY-VGRATPLYEAERLRRADGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRVIAETGA
TRPB_LISW6      YYLKEY--VGRETPLYFAEQLTAHAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKHKVVAETGA
TRPB_LISIN      ----------RETPLYFAEQLTAYAGG-AKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGA
TRPB_HALSA      RQRIRSFG-GRPTPLTHAPTLSQRHGVD--VYLKREDLLHGGAHKLNNALGQVLLAKYMGKDRIVAETGA
TRPB_HALS3      RQRIRSFG-GRPTPLTHAPTLSQRHGVD--VYLKREDLLHGGAHKLNNALGQVLLAKYMGKDRIVAETGA
TRPB_GLOVI      ----------RPTPLYFAERLTAHWGG-GRIFLKREDLNHTGAHKINNALGQALLALRMGKRRIIAETGA
TRPB_CHLTE      ----------RPTPLYHASRLSEKQGG-AQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGA
TRPB_VIBCM      ----------RPTALTLTQNITK--GTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGA
TRPB_VIBCH      ----------RPTALTLTQNITK--GTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGA
TRPB_VIBC3      ----------RPTALTLTQNITK--GTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGA
TRPB_PROMP      NHLLKTY-VGRETPLYEAKRLTEHYQTKSRIWLKREDLNHTGAHKINNALGQALLAIRMGKQRIIAETGA
TRPB_NITMU      ----------RPTPIYHAKRWSAQLGG-AQILLKREDLNHTGAHKINNAMGQALLARRMGKSRVIAETGA
TRPB_RHOPT      DNHLKHY-VGRPSALYFAERLTEHFGG-AKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAETGA
TRPB_RHOPS      DGYLKHY-VGRPSPLYFAERLTEHFGG-AKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKQRIIAETGA
TRPB_RHOPA      DNHLKHY-VGRPSALYFAERLTEHFGG-AKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAETGA
TRPB_METRJ      --------IGRPSPLYYAERLTEHLGQGAKVYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGA
TRPB_BACSK      ----------RETPLTFAKNISAKLGG-ANIYLKREDLVHTGAHKLNNAIGQGLLAKRMGKNKLVAETGA
TRPB_XYLFT      ----------RPSPIYHAERLSRKVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGA
TRPB_XYLF2      ----------RPSPIYHAERLSRKVGG-AQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGA
TRPB_BEII9      ----------RPSPLYYAERLTEHVXXXXKVYFKREELNHTGAHKINNVLGQILLARRMGKTRIIAETGA
TRPB_METS4      ----------RPSPLYFAERLSAHFGG-AKIYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGA
TRPB_METNO      ----------RPSPLYFAERMSAHFGG-AKIYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGA
TRPB_PROMH      QDLLKNYA-GRPTALTLCRNLTQ--GTRTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SYNPX      NQLLKNY-VGRATPLYEAERLRRADGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGA
TRPB_PROMM      DRLLRSY-VGRATPLYEAERLTRSDGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGA
TRPB_PROM0      NHLLKTY-VGRETPLYEAKRLTEHYKTKQRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB2_COREF     D----LYTNYRPTPITECANLPQGRGT-ARIFLKREDLVHGGAHKGNQTIGQALLAKRLGKTRLIAETGA
TRPB_SYNS9      NHLLKTY-VGRATPLYEAERLRRDDGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGA
TRPB_SHEHH      ----------RPTALTLTRNLSP--NPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_STRGG      ----------RPSALTEVPRFAEHAGG-ARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAETGA
TRPB_BACSU      DDPAEYYKLLRPTALTYADRVTEYLGG-AKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGA
TRPB_SYNS3      NRLLKSY-VGRATPLYEAERLSRSDGGP-RIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGA
TRPB_LEIXX      ----ELHRSYRPSIVTEVPRFAEH-GGGARLLLKREDLNHTGSHKINNVLGQAILTKRIGKTRVIAETGA
TRPB_ELUMP      ------YKNYRPSPLYYAANISCG---GAKIYLKREDLNHTGAHKINHCIGEVLLAKKMGKKRVIAEXXX
TRPB_BUCSC      ----------RPTPLTLCRNLTK--GTNTRIYLKREDLLHGGAHKTNQVLGQALLAKQMKKKEIIAETGA
TRPB_PROMS      NHLLKTY-VGRETPLYEAKRLKNKQATP-RIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_PHOLL      ----------RPTALTLCRNLTK--GTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGA
TRPB_PROM2      NHLLKTY-VGRETPLYEAKRLTEYYKTKKKIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_PROM9      NHLLKTY-VGRETPLYEAKRLTEHYKTKTRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_ACIBL      EEIESLLREYRPTPLFLAKNLTQKLGG-AKIYLKREDLLHTGAHKINNCIGQGLLARRMGKHRIIAETGA
TRPB1_COREF     QELAAYLRDYRPTPLTECSNLPQGRGY-ARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGA
TRPB_PROM4      SHLLKTY-VGRATPLYEAKRLSQHYGGP-RIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGA
TRPB_FRAP2      ----------RPTALTKTRNIVK--NTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_ACTP7      ----------RPTALTLCRNLTK--GSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGA
TRPB_PARD8      ----------RPSPLYLAKRLSEKYG--CKIYLKREDLNHTGAHKINNTIGQILLARRMGKSRIIAETGA
TRPB_BUCAI      ----------RPTPLTLCKNLTK--GTKTKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGA
TRPB_VIBHB      -----------------------------------------GAHKTNQVLGQALLAKRMGKNEIIAETGA
TRPB_PHOPR      -----------------------------------------GAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_ERWT9      ----------RPTALTRCLNLTK--GSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_BUCAP      ----------RPTPLTLCNNLTN--GTKTRIYLKREDLLHGGAHKTNQVLGQAMLAVKMKKKEIIAETGA
TRPB_ALTMD      EEFLSLLKDYAGRPTAMTLTRNLVSNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKKEVIAETGA
TRPB_ACTP2      ----------RPTALTLCRNLTK--GSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGA
TRPB_CHLTR      DCILKNYA-GRQTPLTEVKNFARAIDGP-RVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGA
TRPB_ACTPJ      ----------RPTALTLCRNLTK--GSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGA
TRPB_TOLAT      QHLLTEYA-GRPTPLTLCRNLTK--GTKTKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGA
TRPB_CLAMS      EELKELHRTYRPSLITEVPRFAEHAGG-ARIILKREDLNHTGSHKINNVLGQALLTKKIGKKRIIAETGA
TRPB_EDWI9      ----------RPTALTLCRNL--TAGTRTRLYLKREDLLHGGAHKTNQVLGQALLARRMGKTEIIAETGA
TRPB_HAEI8      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_CAMJR      ----------RPTPLYFARNLSKKY--QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAEXXX
TRPB_CAMJJ      ----------RPTPLYFARNLSKKY--QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAEXXX
TRPB_CAMJE      ----------RPTPLYFARNLSKKY--QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAEXXX
TRPB_CAMJ8      ----------RPTPLYFARNLSKKY--QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAEXXX
TRPB_SHEAM      EFLTEFHDLLRPTALTLTRNLSP--NPKVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_PECCP      ----------RPTALTLCQNL--TAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_BUCDN      ----------RPTPLTLCNNLTK--GTKTRIYLKREDLLHGGAHKTNQVLGQAILAIRMKKNEIIAETGA
TRPB_ALISL      -----------------------------------------GAHKTNQVLGQALLALRMGKKEIIAETGA
TRPB_SERP5      ----------RPTALTLCRNL--TAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_CAMJD      ----------RPTPLYFARNLSKKY--QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAEXXX
TRPB_VIBFM      -----------------------------------------GAHKTNQVLGQALLAKRMGKDEIIAETGA
TRPB_SHEB5      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_ERWCT      ----------RPTALTLCKNL--TAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_ACTSZ      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_SHESW      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEPC      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEB9      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEB8      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_BACA2      ----------RPTALTFADRVSEYLGG-AKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETXX
TRPB_MANSM      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_AERHH      -------------------------GTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_HAEIN      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_HAEIE      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_VIBF1      -----------------------------------------GAHKTNQVLGQALLAKRMGKDEIIAETGA
TRPB_CLAM3      EELKELHRSYRPSLITEVPRFAEHAGG-ARIILKREDLNHTGSHKINNVLGQALLTKKIGKKRIIAETGA
TRPB_AERS4      -------------------------GTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SODGM      ----------RPTPLTLCRNL--TAGTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHEDO      ----------RPTALTLTRNLSP--NPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEFN      TDLLKNYA-GRPTALTLTRNLSP--NPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_HAEIG      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_SHEPA      EDFTELLKNYRPTALTLTRNLSPNPLT--KIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEON      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_FUSNN      EEFLKEYHHYRETPLYFAESLTNYLGG-AKIYLKREDLNHLGAHKLNNVIGQILLAKRMGKKKVIAETXX
TRPB_SHESM      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHESA      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_PSEA6      KEFMELLTDYAGRPTAMTLSRNLVSNPNVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGA
TRPB_BLOPB      ----------RPTPLTLCRNLTK--GTRAKLYLKREDLLHGGSHKTNQVLGQALLAKRMSKTEIIAETGA
TRPB_FRATW      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_FRATT      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_FRATM      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_FRAT1      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_ENTS8      ----------RPTALTKCQNLTE--GTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SALTY      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALTI      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALSV      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALPK      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALPC      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALPB      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALPA      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALNS      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALHS      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALG2      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALEP      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALDC      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALCH      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_SALA4      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_BLOFL      ----------RPTPLTLCQNLTS--GTCSKLYLKREDLLHGGSHKTNQVLGQALLAKRMHKKEIIAETGA
TRPB_YERPY      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPS      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPP      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPN      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPE      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPB      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERPA      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERP3      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_VIBME      -----------------------------------------GAHKTNEVLGQGLVGKRMGKSAIIAETGA
TRPB_SALAR      ----------RPTALTKCQNI--TAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
TRPB_FRATO      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGA
TRPB_FRATH      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGA
TRPB_FRATF      QEFKELLQEYRPTALTKTRNIVK--NTRTKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGA
TRPB_KLEP7      ----------RPTALTKCRNLTE--GTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_FRATN      QEFKELLQEYRPTALTKTRNIVK--NTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_KLEP3      ----------RPTALTKCRNLTE--GTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_BUCMH      ----------RPTPLTLCRNLTK--GTKTKIYLKREDLLHGGAHKTNQVLGQAXXXXXXXXXXXXXXTGA
TRPB_VIBVY      -----------------------------------------GAHKTNQVLGQALLAKRMGKNEIIAETGA
TRPB_VIBVU      -----------------------------------------GAHKTNQVLGQALLAKRMGKNEIIAETGA
TRPB_SHIBS      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHIB3      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHISS      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHIDS      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOUT      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGA
TRPB_ECOSM      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOLU      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOL6      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOL5      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOK1      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGA
TRPB_ECO81      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO7I      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO5E      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO57      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO45      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGA
TRPB_ECO27      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_YERE8      -----------------------------------------GAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHIFL      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHIF8      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOSE      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOLI      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOLC      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECOHS      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECODH      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO8A      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO55      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_ECO24      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB1_VIBPA     -----------------------------------------GAHKTNQVLGQALLAKRMGKHEIIAETGA
TRPB_ESCF3      ----------RPTALTKCQNI--TAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_CITK8      ----------RPTALTKCQNI--TAGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
TRPB_SHEWM      NDLLKNYA-GRPTALTLTRNLSP--NPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_SHEPW      TDLLKNYA-GRPTALTLTRNLSP--NPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_HAES2      -----------------------------------------GAHKTNQVLGQILLAKRMGKTRIIAETGA
TRPB_SHELP      ----------RPTALTLTRNLSP--NPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA
TRPB_VIBSL      -----------------------------------------GAHKTNQVLGQALLAKRMGKQEIIAETGA
CYSM_BACSU      ------------TPLVRLNRLQPE--NAAQVYLKLEFFNPSGSVKDRAAYQMIIEAEQNGLGSVIIEPTS
TRPB1_CHLCV     HHILKNYA-GRPTPLTEVKNFSRAINGP-RIFLKREDLLHTGAHKINNVLGQCLIAKFQGKTRVVAETXX
TRPB_SHESR      ----------RPTALTLTRNLSP--NPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGA


                         +         .         .         .         .         *         .:210
query           GQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETFDAHVTPSPSDTTEIGRKMLAEHPDSSGSLG
TRPB2_METMA     GQWGSALSLACNYFDLECKVYMVRSSYY