[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55248.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
    5::185     1e-23  39%  188 aa  YIEF_SHIFL RecName: Full=Uncharacterized protein yieF;
    5::185     1e-23  39%  188 aa  YIEF_ECOLI RecName: Full=Uncharacterized protein yieF;
    5::185     1e-23  39%  188 aa  YIEF_ECO57 RecName: Full=Uncharacterized protein yieF;
    7::147     3e-18  38%  194 aa  NQR_SOLTU RecName: Full=NAD(P)H:quinone oxidoreductase;       
   11::195     8e-18  33%  196 aa  NQR_ARATH RecName: Full=NADPH:quinone oxidoreductase;       
   17::174     2e-17  40%  197 aa  NQR1_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 1;  
   10::154     1e-15  38%  203 aa  NQR2_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 2;  
    1::90      5e-07  33%  174 aa  AZR_BACSU RecName: Full=FMN-dependent NADPH-azoreductase;        
    1::120     3e-06  35%  193 aa  AZOR1_XANAC RecName: Full=FMN-dependent NADH-azoreductase 1;       
    1::120     4e-06  35%  194 aa  AZOR1_XANC5 RecName: Full=FMN-dependent NADH-azoreductase 1;       
    1::128     2e-05  28%  197 aa  SSUE_PSEPU RecName: Full=FMN reductase;         EC=1.5.1.29;
   43::201     8e-05  30%  214 aa  AZOR_RHOE4 RecName: Full=FMN-dependent NADH-azoreductase;       
    7::106     1e-04  32%  166 aa  Y517_MYCPN RecName: Full=Uncharacterized protein MG342 homolog;
    1::128     1e-04  27%  197 aa  SSUE_PSEPK RecName: Full=FMN reductase;         EC=1.5.1.29;
    1::166     1e-04  34%  202 aa  AZOR_CHRVO RecName: Full=FMN-dependent NADH-azoreductase;       
    6::137     2e-04  28%  186 aa  MSUE_PSEAE RecName: Full=FMN reductase;         EC=1.5.1.29;
    1::128     2e-04  28%  191 aa  SSUE_ECOLI RecName: Full=FMN reductase;       
    1::90      2e-04  30%  178 aa  AZRB_BACOY RecName: Full=NADPH azoreductase;         EC=1.7.1.6;
   43::96      4e-04  32%  168 aa  Y342_MYCGE RecName: Full=Uncharacterized protein MG342;
    3::132     4e-04  41%  217 aa  AZOR_POLNA RecName: Full=FMN-dependent NADH-azoreductase;       
    1::120     5e-04  33%  194 aa  AZOR_XANOR RecName: Full=FMN-dependent NADH-azoreductase;       
    1::120     5e-04  33%  194 aa  AZOR_XANOM RecName: Full=FMN-dependent NADH-azoreductase;       
   17::143     7e-04  35%  217 aa  AZOR_STRAW RecName: Full=FMN-dependent NADH-azoreductase;       
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
YIEF_SHIFL      LQVVTLLGSLRKGSFNRTLPKIAPASMEVNAPSIA-------DIPLYDADVEEGFPATVEALAEQIRQAD
YIEF_ECOLI      LQVVTLLGSLRKGSFNRTLPKIAPASMEVNAPSIA-------DIPLYDADVEEGFPATVEALAEQIRQAD
YIEF_ECO57      LQVVTLLGSLRKGSFNRTLPKIAPASMEVNAPSIA-------DIPLYDADVEEGFPATVEALAEQIRQAD
NQR_SOLTU       IKVAGLCGSLRKGSYNRGLLNAAMEICKDSITGMEIEYVDISPLPFLNTDLEVNGPPVVEAFRKKIEEAD
NQR_ARATH       IRVAALSGSLRKTSFHTGLLRAAIDLTKESVPGLQIEYIDISPLPLINTDLEVNGPPVVEAFRQKILEAD
NQR1_ORYSJ      -------GSLRKASYNGGLLRAAAGVCEESIPGLRVDHVDISGLPLLNTDLETADPPAVEAFRDKVRQAD
NQR2_ORYSJ      LRVAAISGSLRRGSANTGLIRAAKEICEESIPGMVIDHVDIPDLPLLNTDMEDGFPPAVEAFRASVRAAD
AZR_BACSU       MNMLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVL-----PVFNGEAEQSELLKVQELKQRVTKAD
AZOR1_XANAC     MKLLHLDSSLGANSISRELSAAVVEQQRRLHPEVSYRDLDRDPIPHLTQTLAQTDPXXXXXVMQQFLQAD
AZOR1_XANC5     MKLLHLDSSLGANSVTRVLSAAVVEQQRRRHPEVSYRDLDRDPIPHLTQTLAQTDPXXXXXVMQQFLQAD
SSUE_PSEPU      MLVVSIGGSPSTRSRSGVLLERSRQWLQDR----GVEVVSFQVRDFPAEDLLHARFDSVQHFQQLVAQAD
AZOR_RHOE4      -------------------------LHRDPLPHLADAALHYAPRLRVEGEIPDPAAEALQRVIEQLTAAD
Y517_MYCPN      --ILLLANS--KNSINRKFAKALEQQLNAELIEVDY------QVDFYCEDLEKDHPEKIKSLVRKLHDHK
SSUE_PSEPK      MLVVSIGGSPSLRSRSGVLLERSRQWLQDR----GVEVVTFQVRDFPAEDLLHARFDSVQHFQQLVAQAD
AZOR_CHRVO      MKLLHLDSSLADNSVTRELSAVVADTLRQRHAETSYRDLAANPIAHLSGEIVGAAPEATQRSEAALSEAD
MSUE_PSEAE      -KVVAVSGGTYRPSRTLVLTQALIAELGQSLP-IDSRVIELTDIPLGATLARNQAPAELQAVLDEIESAD
SSUE_ECOLI      MRVITLAGXXXXXXXXXXXXEYA----REKLNGLDVEVYHWNLQNFAPEDLLYARFDALKTFTEQLQQAD
AZRB_BACOY      MKLVVINGTPRKFGRTRVVAKYIADQFEGELYDLAI-----EELPLYNGEESQRDLEXXXXXXXXXXXXD
Y342_MYCGE      -------------------------------------------VDFYSVDLEATNPDKIKTLVRKIKEHS
AZOR_POLNA      -KLLHIDSSLGSNSVSRQLTAQIVASWRAAHPEVSYLDLAMDSPSHLSVEFRLPAGTAVQQRENAISEAD
AZOR_XANOR      MKLLHLDSSLGATSISRELSAAIVAQQRRLYPEVEYRDLDRDPIPHLTQTLAQTDPXXXXXVMQQFLQAE
AZOR_XANOM      MKLLHLDSSLGATSISRELSAAIVAQQRRLYPEVEYRDLDRDPIPHLTQTLAQTDPXXXXXVMQQFLQAE
AZOR_STRAW      -------------SASRAVAETFRTAWQEQHPDVIYRDLSANPVPHITADAHTPGQAAAFAEREKLEQAD


                         .         .         *         .         .         .         .:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
YIEF_SHIFL      GVVIVTPEYNYSVPGGLKNAIDWLSR----LPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAM
YIEF_ECOLI      GVVIVTPEYNYSVPGGLKNAIDWLSR----LPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAM
YIEF_ECO57      GVVIVTPEYNYSVPGGLKNAIDWLSR----LPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAM
NQR_SOLTU       CFLFASPEYNYSITGPLKNAIDWASRP-----PNVWADKAAAMVSA-XXXXXXXRSQYHLRQIGVFLDLH
NQR_ARATH       SILFASPEYNFSVSAPLKNALDWASRP-----PNVWADKPAAII-STXXXXXXXRSQYHLRQIGVFLDLH
NQR1_ORYSJ      CFLFGSPEYNYSIATPLKNALDWASRGQNC-----WADKPAAIVSA-XXXXXXXRSQYHLRQVGVFLDLH
NQR2_ORYSJ      CFLFASPEYNYSISGPLKNALDWGSRPPNCWADR----XXXXXXXXXXXXXXRSMYHIRQVGV--FLDIH
AZR_BACSU       AIVLLSPEYHSGMSGALKNALDFLS---------------------------------------------
AZOR1_XANAC     VIVIGAPMYNFAIPSTLKAWIDRIA--VAGRTFQYTANGPEGLAG-------------------------
AZOR1_XANC5     VIVIGAPMYNFAIPSTLKAWIDRIA--VAGRTFQYTANGPEGLAG-------------------------
SSUE_PSEPU      GLVVATPVYKASFAGALKTLLDLL--PERALEHKIVL--PIATGGSIAHMLAVDYALKPVLSAL------
AZOR_RHOE4      VVVIGAPMYNWSIPSTLKAWIDYVTTVPFDTRTQPLAGKPVVIVGNTYAPGSGNEANDQVLGVSMGMDVS
Y517_MYCPN      TLIFVTPEHNGFVPAFAKNTIDWMTRDTQYGKNQFLKE--------------------------------
SSUE_PSEPK      GLIVSTPVYKASFSGALKTLLDLL--PERALAHKIVL--PIATGGSIAHMLAVDYALKPVLSAL------
AZOR_CHRVO      VLVIGAPMYNFSIPTQLKSWIDRVARTFKYTEVGLVPNKKVVLVSARGGVHSGEQGEDYVVKVLGFL---
MSUE_PSEAE      LLLVASPVYRGSYPGLLKHLFDLI-------DLNALIDTPVLLAATGGTERHALVLDHQLRPLFSFFQA-
SSUE_ECOLI      GLIVATPVYKAAYSGALKTLLDLL--PERALQGKVVL--PLATGGTVAHLLAVDYALKPVLSAL------
AZRB_BACOY      GVVLCTPEYHNAMSGALKNSLDYLS---------------------------------------------
Y342_MYCGE      NLIFVTPEHNGFIPAFAKNIIDWMTR--------------------------------------------
AZOR_POLNA      VLVIGAPLYNFSIPSQLK---AWIDRVAQAGRTFKYTEKPVGLAG-------------------------
AZOR_XANOR      VIVIGAPMYNFAIPSTLKAWIDRIA--VAGRTFHYTANGPEGLAG-------------------------
AZOR_XANOM      VIVIGAPMYNFAIPSTLKAWIDRIA--VAGRTFHYTANGPEGLAG-------------------------
AZOR_STRAW      AVLIGAPMYNYAIPSTLKAWLDILMGRTAANENSKVTGTPVTV----IASRGGSYA--------------


                         +         .         .         .         .         *         .:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVEREQG
YIEF_SHIFL      VMNKPEFMGGVIQNKVDPQGEVIDQGTLDHLTGQLTAFGEFIQR---
YIEF_ECOLI      VMNKPEFMGGVIQNKVDPQGEVIDQGTLDHLTGQLTAFGEFIQR---
YIEF_ECO57      VMNKPEFMGGVIQNKVDPQGEVIDQGTLDHLTGQLTAFGEFIQR---
NQR_SOLTU       FINKP------------------------------------------
NQR_ARATH       FINKPEFTLNAFPQKFDAEGNLVDEVTKERLKQVLLSLQAFTLRLQG
NQR1_ORYSJ      FINKPEL-----AVKAFEQPP-KFDSDGNLIDAQ-------------
NQR2_ORYSJ      FINKPEVFI--------------------------------------
AZR_BACSU       -----------------------------------------------
AZOR1_XANAC     -----------------------------------------------
AZOR1_XANC5     -----------------------------------------------
SSUE_PSEPU      -----------------------------------------------
AZOR_RHOE4      VITAELTLAQRIPAMAPEQGDASLRAA--------------------
Y517_MYCPN      -----------------------------------------------
SSUE_PSEPK      -----------------------------------------------
AZOR_CHRVO      -----------------------------------------------
MSUE_PSEAE      -----------------------------------------------
SSUE_ECOLI      -----------------------------------------------
AZRB_BACOY      -----------------------------------------------
Y342_MYCGE      -----------------------------------------------
AZOR_POLNA      -----------------------------------------------
AZOR_XANOR      -----------------------------------------------
AZOR_XANOM      -----------------------------------------------
AZOR_STRAW      -----------------------------------------------