[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55249.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    7::97      5e-11  40%  221 aa  HUPD_THIRO RecName: Full=Hydrogenase expression/formation protein
    2::153     9e-11  28%  164 aa  HYBD_ECOLI RecName: Full=Hydrogenase 2 maturation protease;        
   12::105     1e-10  38%  202 aa  HUPD_RHILV RecName: Full=Hydrogenase expression/formation protein
    9::100     1e-10  38%  192 aa  HUPD_BRAJA RecName: Full=Hydrogenase expression/formation protein
    4::96      4e-08  33%  195 aa  HYAD_ECOLI RecName: Full=Hydrogenase 1 maturation protease;      
    8::106     5e-08  33%  210 aa  HUPD_RHOCA RecName: Full=Hydrogenase expression/formation protein
    7::154     9e-08  29%  158 aa  FRHD_METTH RecName: Full=Coenzyme F420 hydrogenase subunit
   20::105     1e-07  38%  209 aa  HUPM_AZOCH RecName: Full=Hydrogenase expression/formation protein
   18::103     1e-07  38%  207 aa  HOXM_AZOVI RecName: Full=Hydrogenase expression/formation protein
    7::92      4e-06  35%  202 aa  HOXM_RALEH RecName: Full=Hydrogenase expression/formation protein
   12::105     6e-05  27%  159 aa  HYDD_WOLSU RecName: Full=Protein hydD;
    5::99      1e-04  34%  156 aa  HYCI_ECOLI RecName: Full=Hydrogenase 3 maturation protease;        
    5::99      1e-04  34%  156 aa  HYCI_ECO57 RecName: Full=Hydrogenase 3 maturation protease;        
  457::540     4e-04  33%  686 aa  DNLJ_HAEDU RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    6::154     6e-04  23%  154 aa  Y253_METJA RecName: Full=Putative hydrogenase maturation protease
  439::511     8e-04  30%  652 aa  DNLJ_STRU0 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxARRIAVFCVGNKLMLDDGVGPAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDG
HUPD_THIRO      ------ILVLGIGNLLWADEGFGVRAVEALQRHWVMSSNVQLLDGGTQGIYLVDRVRKADVLVVFDAVD-
HYBD_ECOLI      -----RILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLIIADAIVS
HUPD_RHILV      ---APRILVLGIGNILWADEGFGVRAVEAFHKAYELSDNVTILDGGTQGLYLVQFVNEHDRLIVFDAID-
HUPD_BRAJA      -----RILVLGIGNILWADEGFGVRAVEEFHRRYAVPDNVTILDGGTQGLYLVNYLEEADRLIVFDAID-
HYAD_ECOLI      ----QRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAID-
HUPD_RHOCA      -----RVLVLGIGNVLWADEGFGVRCVERMAETHALPANVRLLDGGTQGLYLLPFLEEAEALIVFDAVD-
FRHD_METTH      ------ILVVGCGNILFKDDGFGPEVLEEYFKDREKPDNVMFIDAGTGGPHFVFSLEEWKKMIVVDVVE-
HUPM_AZOCH      ------------------DEGFGVRCVELLNERYRFPDGVRLMDGGTQGIYLVQHVQQADCLIVFDAVDY
HOXM_AZOVI      ------------------DEGFGVRCVELLNERYRFPDGVRLMDGGTQGIYLVQHVQQADCLIVFDAVDY
HOXM_RALEH      -----------IGNVLWADEGFGVRCIETLQQRYQFAPQVCLVDGGTQGLYLIHHVQAASRLLIFDAID-
HYDD_WOLSU      --------------------------------RFEGPHQVDVIDGGTLAQLLIPLITSYDYVIVIDCVDA
HYCI_ECOLI      --------LLCVGNSMMGDDGAGPLLAEKCAAA--PKGNWVVIDGGSAPENDIVAIRELTRLLIVDATD-
HYCI_ECO57      --------LLCVGNSMMGDDGAGPLLAEKCAAA--PKGNWVVIDGGSAPENDIVAIRELTRLLIVDATD-
DNLJ_HAEDU      -----------VSRKAMNIDGVGEKLIEQLMARELIHTPADLFKLDPLSLMRLERMGEKSAQNALNSIE-
Y253_METJA      ------ILIVGCGNLLFGDDGFGCEVVSKL-EKMNLPDNVEVIDAGASAYYLMTLXXXXXXXXXXXXXXX
DNLJ_STRU0      --------------------GLGPAIVEKLFSAQLIHDVADIYQLSLDSLLTLEGIKEKSAQKLLDAIQS


                         .         .         *         .         .         .         .:140
query           TDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDXXXXXXXXXXXXXXXMQVENPSPAVVTVGLTPKV
HUPD_THIRO      YGLPPGTMKRVEDDEVPRFLGAKMSLH-------------------------------------------
HYBD_ECOLI      KKNAPGTMMILRDEEVPALFTNKISPHQLGLADVLSALRFTGEFPKKLTLVGVI--PESLEPHIGLTPTV
HUPD_RHILV      YGLEPGTMKVVEDDEVPKFTGAKMSLH-------------------------------------------
HUPD_BRAJA      YGLEPGRLKLVRDDEVPRFTGAKMSLH-------------------------------------------
HYAD_ECOLI      YGLEPGTLRTYAGERIPAYSAKKMSLH-------------------------------------------
HUPD_RHOCA      FGFTPGTLVTMRDDDVPAFMGAKMSLHQTGFQDV------------------------------------
FRHD_METTH      FNAEPGTLRKFDVTEIPK--GSYENMHTWPVSQPLHELSEKIDVVVIGCKPKEISAPN---VEMGLTPPV
HUPM_AZOCH      GLA-PGTLKVVRDDEVPRFMGARMSLHQTGFQDV------------------------------------
HOXM_AZOVI      GLA-PGTLKIVRDDEVPRFMGARMSLHQTGFQDV------------------------------------
HOXM_RALEH      YGLPPGTLRIIEDEAVPKFLGAKMSLH-------------------------------------------
HYDD_WOLSU      GGGKIGEVYFFDFDNVPNVITWQGSAHEVEMLQTL--------------RMTEVNGDLPPVKIVGVIPSI
HYCI_ECOLI      MGLNPGEIRIIDPDDIAEMFMMTT--HNMPLNYLID----------------------------------
HYCI_ECO57      MGLNPGEIRIIDPDDIAEMFMMTT--HNMPLNYLID----------------------------------
DNLJ_HAEDU      -KAKHTTLARFLFSLGIRDVGETTALN-------------------------------------------
Y253_METJA      FDLEPGTIKKIDVDELPNIKKYSFDAHNVPLAPLKDLHNKGIEVVVIGCQGKEFTMPD---IKPGLSEEV
DNLJ_STRU0      SKSNSADKLLF--GLGIRHVGAKAS---------------------------------------------


                         +         .         .         .         .         *         .:210
query           DAALPLLVETVAGELARLGxxxxxxx
HUPD_THIRO      --------------------------
HYBD_ECOLI      EAMIEPALEQVLAALRESG-------
HUPD_RHILV      --------------------------
HUPD_BRAJA      --------------------------
HYAD_ECOLI      --------------------------
HUPD_RHOCA      --------------------------
FRHD_METTH      KKAIPRAIQMILDEI-----------
HUPM_AZOCH      --------------------------
HOXM_AZOVI      --------------------------
HOXM_RALEH      --------------------------
HYDD_WOLSU      --------------------------
HYCI_ECOLI      --------------------------
HYCI_ECO57      --------------------------
DNLJ_HAEDU      --------------------------
Y253_METJA      AKAVDKAIEIILGEIKK---------
DNLJ_STRU0      --------------------------