[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55343.1

[Show Plain Result]


## Summary of Sequence Search
    1::71
   27::92      5e-06  29%  102 aa  CEBA_BACAM RecName: Full=BamHI control element;
   12::63      2e-05  35%  196 aa  Y4DL_RHISN RecName: Full=Uncharacterized HTH-type transcriptional
    3::55      1e-04  42%   90 aa  IMMF_BPPH1 RecName: Full=ImmF control region 10 kDa protein;
    8::67      4e-04  33%  178 aa  YDCN_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   22::80      4e-04  32%  140 aa  Y474_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
   85::142     8e-04  37%  161 aa  MBF1_MAGGR RecName: Full=Multiprotein-bridging factor 1;
   33::74      0.001  38%  370 aa  KDPD_SYNY3 RecName: Full=Putative sensor protein kdpD;       
    1::71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLID
CEBA_BACAM      ------RLLFGQKVRQIRSKSNMSQEKLAFECDLHRTYISDIERGTRNVSLDNIEKISKALGVQPKDLLD
Y4DL_RHISN      -------------LRAAREAQKMSQRELSARSGLTQSHISQIERGTMEPGLGSLVDVARALDLEI-----
IMMF_BPPH1      ---DGKK--LGALIKDKRKEKHLKQTEMAKALGMSRTYLSDIENGRYLPSTKTLSRIA------------
YDCN_ECOLI      ---------LSTTLKQLRQQRGWSLSRLAEATGVSKAMLGQIERNESSPTVATLWKIATGLNVPFSTFI-
Y474_MYCTU      ---------IGSFIRSQRETAHVSMRQLAERSGVSNPYLSQVERGLRKPSADVLSQIAKALRVSAEVL--
MBF1_MAGGR      ---------LGMYIMQNREQKKLGNREFGKKVGINEKDLARIEKGEVPITQDQVNRIERGLEMFIR----
KDPD_SYNY3      ---------VGKTYRMLEEGQQLKQEGFDVVIGLLETH-GREETAQKAIGLE------------------


                         .         .         *         .         .         .         .:140
query           F
CEBA_BACAM      F
Y4DL_RHISN      -
IMMF_BPPH1      -
YDCN_ECOLI      -
Y474_MYCTU      -
MBF1_MAGGR      -
KDPD_SYNY3      -