[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55382.1

[Show Plain Result]


## Summary of Sequence Search
    1::164
    6::156     4e-04  27%  229 aa  FLGH_CUPTR RecName: Full=Flagellar L-ring protein;AltName:
  158::224     8e-04  27%  255 aa  Y1613_METJA RecName: Full=Uncharacterized protein MJ1613;
    1::164

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxGAMAVVLAFVPFLSGCAANDAEDNPQAQQELNADEQSRNEAEGSIGETVQYGQVMAMNGS
FLGH_CUPTR      ----------GARALVLAGVAMLSGCALMPREPLVQMPTTARAEPRPIGPASGSIFQSSYAGNPLFEDGD
Y1613_METJA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TATVVVGTLANANDGSGSQAFNAGQDEITFDEGDVSIVDESGAELEGRTLSADDVIVMRGTGSGTDFKPT
FLGH_CUPTR      ILTILITENVNASKNSGTNTSRTGNAALAFDSVPRALGGLFGTSQNANINGANTMKASGGASAANTFNGT
Y1613_METJA     TVNIILITNANLTDGAMARAIITITEAKTNAFQELNIRSTKHPELQATGTGTDNIVVVKGFGSGVDY---


                         +         .         .         .         .         *         .:210
query           TIEILDVAGAGxxxxxxxxxxxxx
FLGH_CUPTR      TVTVLEVLANG-------------
Y1613_METJA     ------------------------