[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55525.1

[Show Plain Result]


## Summary of Sequence Search
    1::948
    3::919       0.0  51%  930 aa  SYI_MOOTA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  50%  921 aa  SYI_KOSOT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::927       0.0  49%  932 aa  SYI_THETN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::920       0.0  50%  927 aa  SYI_PELCD RecName: Full=Isoleucyl-tRNA synthetase;       
    3::927       0.0  48%  932 aa  SYI_THEPX RecName: Full=Isoleucyl-tRNA synthetase;       
    3::927       0.0  48%  932 aa  SYI_THEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::917       0.0  50%  925 aa  SYI_CARHZ RecName: Full=Isoleucyl-tRNA synthetase;       
    3::922       0.0  50%  923 aa  SYI_GEOSL RecName: Full=Isoleucyl-tRNA synthetase;       
    6::922       0.0  48%  927 aa  SYI_SYNWW RecName: Full=Isoleucyl-tRNA synthetase;       
    3::919       0.0  49%  922 aa  SYI_DESHD RecName: Full=Isoleucyl-tRNA synthetase;       
    3::919       0.0  49%  922 aa  SYI_DESHY RecName: Full=Isoleucyl-tRNA synthetase;       
    3::914       0.0  47%  929 aa  SYI_HALOH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::910       0.0  48%  919 aa  SYI_THEMA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::910       0.0  48%  919 aa  SYI_THEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::908       0.0  48%  910 aa  SYI_THEAB RecName: Full=Isoleucyl-tRNA synthetase;       
    3::909       0.0  47%  918 aa  SYI_THENN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935       0.0  47%  937 aa  SYI_DESAD RecName: Full=Isoleucyl-tRNA synthetase;       
    3::917       0.0  48%  925 aa  SYI_BREBN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  48%  938 aa  SYI_DESVM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  47%  919 aa  SYI_PETMO RecName: Full=Isoleucyl-tRNA synthetase;       
    7::926       0.0  49%  938 aa  SYI_SYMTH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::921       0.0  48%  931 aa  SYI_DESRM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::922       0.0  47%  926 aa  SYI_NATTJ RecName: Full=Isoleucyl-tRNA synthetase;       
    3::903       0.0  46%  908 aa  SYI_THEM4 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::926       0.0  47%  939 aa  SYI_DESPS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::929       0.0  49%  938 aa  SYI_DESDA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  45%  920 aa  SYI_CALS8 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::908       0.0  47%  913 aa  SYI_FERNB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  48%  934 aa  SYI_DESDG RecName: Full=Isoleucyl-tRNA synthetase;       
    6::932       0.0  47%  933 aa  SYI_FUSNN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::907       0.0  46%  912 aa  SYI_FERPE RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  47%  938 aa  SYI_DESVH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  47%  938 aa  SYI_DESVV RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  47%  921 aa  SYI_BACWK RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  48%  921 aa  SYI_BACC4 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  48%  921 aa  SYI_BACC2 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  48%  921 aa  SYI1_BACCR RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::911       0.0  48%  921 aa  SYI_BACCQ RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  48%  921 aa  SYI_BACC7 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  48%  921 aa  SYI1_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::911       0.0  47%  921 aa  SYI_BACC0 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  47%  921 aa  SYI_BACAC RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  47%  921 aa  SYI_BACAA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  47%  921 aa  SYI1_BACHK RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::911       0.0  47%  921 aa  SYI1_BACAN RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::911       0.0  48%  921 aa  SYI1_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::911       0.0  47%  921 aa  SYI_BACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::924       0.0  48%  939 aa  SYI_SULSY RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  47%  921 aa  SYI_BACCN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::903       0.0  45%  911 aa  SYI_THELT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  44%  920 aa  SYI_ANATD RecName: Full=Isoleucyl-tRNA synthetase;       
    4::933       0.0  45%  937 aa  SYI_LAWIP RecName: Full=Isoleucyl-tRNA synthetase;       
    3::928       0.0  45%  930 aa  SYI_DESAP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  48%  936 aa  SYI_COXB2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  48%  936 aa  SYI_COXB1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::927       0.0  48%  941 aa  SYI_HALHL RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  48%  936 aa  SYI_COXBU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  48%  936 aa  SYI_COXBN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::912       0.0  46%  918 aa  SYI1_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::934       0.0  46%  947 aa  SYI_PERMH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::914       0.0  47%  924 aa  SYI_GEOTN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  48%  936 aa  SYI_COXBR RecName: Full=Isoleucyl-tRNA synthetase;       
    3::922       0.0  44%  923 aa  SYI_BRAHW RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  46%  923 aa  SYI_GEOSW RecName: Full=Isoleucyl-tRNA synthetase;       
    3::914       0.0  46%  924 aa  SYI_GEOKA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  47%  937 aa  SYI_THISH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915       0.0  45%  923 aa  SYI_BACSK RecName: Full=Isoleucyl-tRNA synthetase;       
    4::938       0.0  47%  944 aa  SYI_IDILO RecName: Full=Isoleucyl-tRNA synthetase;       
    3::908       0.0  45%  915 aa  SYI_STACT RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  45%  928 aa  SYI_LACCB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_CITK8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  45%  928 aa  SYI_LACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  46%  940 aa  SYI_NITOC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOL6 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO81 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOL5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOUT RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOSM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOK1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO7I RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO45 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO27 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::949       0.0  45%  956 aa  SYI_AQUAE RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOLC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO5E RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO57 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_SHIB3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ESCF3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOLU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO24 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_SHISS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOSE RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOLI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECODH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOBW RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO8A RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECO55 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_SHIFL RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_SHIBS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_SHIDS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  47%  938 aa  SYI_ECOHS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALTY RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALTI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALG2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALEP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALCH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  46%  942 aa  SYI_VIBPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALPK RecName: Full=Isoleucyl-tRNA synthetase;       
    4::930       0.0  46%  944 aa  SYI_SALPA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::933       0.0  47%  939 aa  SYI_METCA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::938       0.0  46%  944 aa  SYI_PSYIN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  45%  938 aa  SYI_ERWT9 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  46%  940 aa  SYI_SHEPW RecName: Full=Isoleucyl-tRNA synthetase;       
    4::913       0.0  44%  931 aa  SYI_LACDB RecName: Full=Isoleucyl-tRNA synthetase;       
    1::927       0.0  45%  941 aa  SYI_HAEIN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::914       0.0  44%  921 aa  SYI_BACHD RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  46%  932 aa  SYI_SACD2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935       0.0  48%  941 aa  SYI_ALHEH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::925       0.0  45%  939 aa  SYI_MARAV RecName: Full=Isoleucyl-tRNA synthetase;       
    1::927       0.0  45%  941 aa  SYI_HAEIG RecName: Full=Isoleucyl-tRNA synthetase;       
    4::913       0.0  44%  931 aa  SYI_LACDA RecName: Full=Isoleucyl-tRNA synthetase;       
    1::927       0.0  45%  941 aa  SYI_HAEI8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::943       0.0  45%  949 aa  SYI_VIBCM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::943       0.0  45%  949 aa  SYI_VIBCH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::944       0.0  45%  948 aa  SYI_VIBVU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  43%  928 aa  SYI_LACJO RecName: Full=Isoleucyl-tRNA synthetase;       
    1::927       0.0  45%  941 aa  SYI_HAEIE RecName: Full=Isoleucyl-tRNA synthetase;       
    3::912       0.0  44%  922 aa  SYI_BACLD RecName: Full=Isoleucyl-tRNA synthetase;       
    4::944       0.0  45%  948 aa  SYI_VIBVY RecName: Full=Isoleucyl-tRNA synthetase;       
    4::928       0.0  45%  934 aa  SYI_TERTT RecName: Full=Isoleucyl-tRNA synthetase;       
    4::919       0.0  44%  932 aa  SYI_LACLA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  46%  938 aa  SYI_ACTP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  45%  942 aa  SYI_VIBHB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  43%  922 aa  SYI_RUTMC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::940       0.0  46%  954 aa  SYI_PHOPR RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_XANCB RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  44%  914 aa  SYI_MACCJ RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_XANCP RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_XANC8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERE8 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::949       0.0  47%  953 aa  SYI_THEEB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::943       0.0  45%  949 aa  SYI_VIBC3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::908       0.0  44%  916 aa  SYI_STAS1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEHH RecName: Full=Isoleucyl-tRNA synthetase;       
    6::935       0.0  44%  941 aa  SYI_PSYA2 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::929       0.0  45%  943 aa  SYI_STRMK RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  44%  935 aa  SYI_HAEDU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::946       0.0  44%  952 aa  SYI_VIBSL RecName: Full=Isoleucyl-tRNA synthetase;       
    4::949       0.0  44%  955 aa  SYI_VESOH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHESH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  44%  942 aa  SYI_PSEHT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::911       0.0  44%  911 aa  SYI_EXIS2 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::949       0.0  46%  955 aa  SYI_CYAP4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  46%  940 aa  SYI_SHEAM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::890       0.0  44%  921 aa  SYI_BACSU RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_STRM5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::946       0.0  45%  952 aa  SYI_ALISL RecName: Full=Isoleucyl-tRNA synthetase;       
    1::919       0.0  45%  925 aa  SYI_CHRVO RecName: Full=Isoleucyl-tRNA synthetase;       
    4::946       0.0  45%  952 aa  SYI_VIBF1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHELP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::914       0.0  44%  926 aa  SYI_ENTFA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::915       0.0  43%  927 aa  SYI_LACH4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::946       0.0  45%  952 aa  SYI_VIBFM RecName: Full=Isoleucyl-tRNA synthetase;       
    7::945       0.0  46%  971 aa  SYI_ACAM1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  45%  938 aa  SYI_ACTP2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPY RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPG RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPE RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_YERP3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::914       0.0  42%  927 aa  SYI_LACAC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  43%  931 aa  SYI_LACS1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_HAEPS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  948 aa  SYI_EDWI9 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::936       0.0  44%  942 aa  SYI_PSEA6 RecName: Full=Isoleucyl-tRNA synthetase;       
   11::924       0.0  45%  938 aa  SYI_MANSM RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  44%  943 aa  SYI_XANAC RecName: Full=Isoleucyl-tRNA synthetase;       
    8::912       0.0  44%  915 aa  SYI_LEPBP RecName: Full=Isoleucyl-tRNA synthetase;       
    8::912       0.0  44%  915 aa  SYI_LEPBA RecName: Full=Isoleucyl-tRNA synthetase;       
    1::926       0.0  43%  932 aa  SYI_PASMU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::922       0.0  45%  936 aa  SYI_PROMH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::918       0.0  43%  924 aa  SYI_DICNV RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  45%  929 aa  SYI_NEIG1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATT RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRAT1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::939       0.0  45%  953 aa  SYI_AERHH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEON RecName: Full=Isoleucyl-tRNA synthetase;       
    4::925       0.0  44%  940 aa  SYI_MARMS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRAP2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  45%  929 aa  SYI_NEIG2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATW RecName: Full=Isoleucyl-tRNA synthetase;       
    4::918       0.0  44%  937 aa  SYI_LACBA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935       0.0  45%  941 aa  SYI_HAHCH RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  44%  943 aa  SYI_XANC5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHESR RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  937 aa  SYI_PHOLL RecName: Full=Isoleucyl-tRNA synthetase;       
    8::979       0.0  46%  983 aa  SYI_GLOVI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::931       0.0  43%  937 aa  SYI_HAES1 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::909       0.0  44%  914 aa  SYI_LEPBL RecName: Full=Isoleucyl-tRNA synthetase;       
    8::909       0.0  44%  914 aa  SYI_LEPBJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::931       0.0  43%  937 aa  SYI_HAES2 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::956       0.0  46%  960 aa  SYI_ANASP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATO RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATF RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917       0.0  45%  931 aa  SYI_LEGPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHESW RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917       0.0  45%  931 aa  SYI_LEGPC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHESM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::920       0.0  43%  935 aa  SYI_FRATM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEPC RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  929 aa  SYI_NEIM0 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915       0.0  43%  916 aa  SYI_STAEQ RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISIN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917       0.0  45%  931 aa  SYI_LEGPL RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHESA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::955       0.0  46%  959 aa  SYI_NOSP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISMH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  44%  938 aa  SYI_SODGM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISW6 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEB8 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISMO RecName: Full=Isoleucyl-tRNA synthetase;       
    4::914       0.0  43%  933 aa  SYI_PEDPA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISMF RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  43%  921 aa  SYI_LISMC RecName: Full=Isoleucyl-tRNA synthetase;       
   15::967       0.0  45%  974 aa  SYI_SYNPX RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  937 aa  SYI_ALCBS RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAR RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI1_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  45%  938 aa  SYI_KLEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_XANOR RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  45%  943 aa  SYI_XANOM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917       0.0  45%  931 aa  SYI_LEGPH RecName: Full=Isoleucyl-tRNA synthetase;       
    5::950       0.0  45%  954 aa  SYI_SYNP6 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915       0.0  42%  916 aa  SYI_STAES RecName: Full=Isoleucyl-tRNA synthetase;       
   14::968       0.0  44%  969 aa  SYI_PROMA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  45%  937 aa  SYI_PECCP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEB5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEB2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  937 aa  SYI_ERWCT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAW RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  45%  940 aa  SYI_SHEB9 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917       0.0  44%  929 aa  SYI_NEIMF RecName: Full=Isoleucyl-tRNA synthetase;       
    4::934       0.0  44%  940 aa  SYI_SHEWM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::947       0.0  44%  953 aa  SYI_COLP3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::947       0.0  45%  953 aa  SYI_AERS4 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::909       0.0  44%  914 aa  SYI_LEPIN RecName: Full=Isoleucyl-tRNA synthetase;       
    6::955       0.0  46%  959 aa  SYI_CYAA5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  929 aa  SYI_NEIMA RecName: Full=Isoleucyl-tRNA synthetase;       
    8::909       0.0  44%  914 aa  SYI_LEPIC RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAE RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAC RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAA9 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAA8 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAA3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAA2 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAA1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::984       0.0  44%  988 aa  SYI_SYNY3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  43%  917 aa  SYI_STAAB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::923       0.0  44%  929 aa  SYI_NEIMB RecName: Full=Isoleucyl-tRNA synthetase;       
    3::910       0.0  44%  911 aa  SYI_NAUPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  45%  929 aa  SYI_THIDA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::933       0.0  45%  937 aa  SYI_HYDS0 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::966       0.0  44%  968 aa  SYI_SYNS3 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::955       0.0  45%  959 aa  SYI_CYAP8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::948       0.0  45%  952 aa  SYI_MICAN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915       0.0  42%  916 aa  SYI_STAHJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::952       0.0  44%  957 aa  SYI_LARHH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::918       0.0  45%  919 aa  SYI_ARCB4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  42%  930 aa  SYI_STRSV RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  45%  938 aa  SYI_ENTS8 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::918       0.0  44%  918 aa  SYI_SULNB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  43%  930 aa  SYI_STRGC RecName: Full=Isoleucyl-tRNA synthetase;       
    3::913       0.0  45%  918 aa  SYI_NITSB RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931       0.0  44%  945 aa  SYI_ACIAD RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  43%  943 aa  SYI_XYLFM RecName: Full=Isoleucyl-tRNA synthetase;       
    3::831       0.0  44%  871 aa  SYI_STAEP RecName: Full=Isoleucyl-tRNA synthetase;       
    3::895       0.0  44%  896 aa  SYI_ACHLI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::927       0.0  43%  932 aa  SYI_DECAR RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  41%  929 aa  SYI_STRT2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  41%  929 aa  SYI_STRT1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  41%  929 aa  SYI_STRTD RecName: Full=Isoleucyl-tRNA synthetase;       
    4::916       0.0  42%  928 aa  SYI_LACSS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891       0.0  43%  930 aa  SYI_STRA5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891       0.0  43%  930 aa  SYI_STRA3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891       0.0  43%  930 aa  SYI_STRA1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::914       0.0  43%  932 aa  SYI_LACPL RecName: Full=Isoleucyl-tRNA synthetase;       
   14::967       0.0  43%  967 aa  SYI_PROMT RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  43%  943 aa  SYI_XYLFA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRZJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRPN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRR6 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::962       0.0  43%  969 aa  SYI_PROM4 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::966       0.0  43%  968 aa  SYI_PROMM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  42%  930 aa  SYI_STRP4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRPI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  42%  930 aa  SYI_STRZT RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  42%  943 aa  SYI_XYLFT RecName: Full=Isoleucyl-tRNA synthetase;       
    1::937       0.0  42%  943 aa  SYI_XYLF2 RecName: Full=Isoleucyl-tRNA synthetase;       
   12::935       0.0  44%  941 aa  SYI_ZYMMO RecName: Full=Isoleucyl-tRNA synthetase;       
   14::967       0.0  42%  967 aa  SYI_PROM1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::850       0.0  43%  933 aa  SYI_STRPM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRPS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRPJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891       0.0  43%  933 aa  SYI_STRP3 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::933       0.0  44%  939 aa  SYI_NITEU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::912       0.0  42%  930 aa  SYI_LACF3 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  41%  938 aa  SYI_BAUCH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRZP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::921       0.0  42%  930 aa  SYI_STRP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::850       0.0  43%  933 aa  SYI_STRP1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::926       0.0  44%  932 aa  SYI_AZOSB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::850       0.0  43%  933 aa  SYI_STRP8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::850       0.0  43%  933 aa  SYI_STRP6 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::955       0.0  44%  959 aa  SYI_CYAP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::924       0.0  42%  938 aa  SYI_SERP5 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::947       0.0  42%  953 aa  SYI_BORA1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891       0.0  41%  930 aa  SYI_STRMU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  43%  943 aa  SYI_PSEPW RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  43%  943 aa  SYI_PSEPG RecName: Full=Isoleucyl-tRNA synthetase;       
    3::892       0.0  42%  907 aa  SYI_METI4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEE4 RecName: Full=Isoleucyl-tRNA synthetase;       
   16::940       0.0  43%  945 aa  SYI_BURXL RecName: Full=Isoleucyl-tRNA synthetase;       
    3::918       0.0  43%  919 aa  SYI_CAMC5 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::939       0.0  42%  953 aa  SYI_BORPD RecName: Full=Isoleucyl-tRNA synthetase;       
   14::964       0.0  41%  965 aa  SYI_PROM2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::913       0.0  42%  931 aa  SYI_LACRJ RecName: Full=Isoleucyl-tRNA synthetase;       
   16::940       0.0  42%  945 aa  SYI_BURPP RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  43%  943 aa  SYI_PSEA7 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::931       0.0  43%  946 aa  SYI_CHRSD RecName: Full=Isoleucyl-tRNA synthetase;       
   28::960       0.0  43%  960 aa  SYI_GLUOX RecName: Full=Isoleucyl-tRNA synthetase;       
   14::964       0.0  42%  968 aa  SYI_PROM9 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEPK RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSE14 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::964       0.0  41%  968 aa  SYI_PROM0 RecName: Full=Isoleucyl-tRNA synthetase;       
   16::931       0.0  43%  945 aa  SYI_BURP8 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEU2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSESM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEAE RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEAB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   21::945       0.0  43%  959 aa  SYI_HERAR RecName: Full=Isoleucyl-tRNA synthetase;       
    4::928       0.0  40%  942 aa  SYI_BLOPB RecName: Full=Isoleucyl-tRNA synthetase;       
   14::964       0.0  42%  968 aa  SYI_PROMS RecName: Full=Isoleucyl-tRNA synthetase;       
    3::917       0.0  42%  918 aa  SYI_CAMC1 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_AZOVD RecName: Full=Isoleucyl-tRNA synthetase;       
    3::919       0.0  41%  919 aa  SYI_SULDN RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEFS RecName: Full=Isoleucyl-tRNA synthetase;       
    3::916       0.0  42%  916 aa  SYI_CAMFF RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  43%  943 aa  SYI_PSEPF RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI_PSEMY RecName: Full=Isoleucyl-tRNA synthetase;       
    6::868       0.0  43%  892 aa  SYI_MYCAP RecName: Full=Isoleucyl-tRNA synthetase;       
    3::919       0.0  41%  921 aa  SYI_CAMHC RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931       0.0  41%  945 aa  SYI_BURTA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937       0.0  42%  943 aa  SYI1_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 1;       
    4::937       0.0  41%  943 aa  SYI_PSEU5 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::921       0.0  42%  930 aa  SYI_HELHP RecName: Full=Isoleucyl-tRNA synthetase;       
   16::960       0.0  41%  966 aa  SYI_CUPTR RecName: Full=Isoleucyl-tRNA synthetase;       
   13::958       0.0  40%  964 aa  SYI_RALEH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::925       0.0  41%  939 aa  SYI_AZOSE RecName: Full=Isoleucyl-tRNA synthetase;       
    3::914       0.0  42%  915 aa  SYI_WOLSU RecName: Full=Isoleucyl-tRNA synthetase;       
    4::947       0.0  41%  953 aa  SYI_BLOFL RecName: Full=Isoleucyl-tRNA synthetase;       
    7::888       0.0  39%  888 aa  SYI_MYCPU RecName: Full=Isoleucyl-tRNA synthetase;       
   13::953     e-180  41%  959 aa  SYI_RALME RecName: Full=Isoleucyl-tRNA synthetase;       
    3::947     e-180  41%  953 aa  SYI_BORPA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::947     e-180  41%  953 aa  SYI_BORBR RecName: Full=Isoleucyl-tRNA synthetase;       
   13::954     e-180  41%  959 aa  SYI_RALPJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::937     e-180  41%  943 aa  SYI_PSEF5 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::947     e-180  41%  953 aa  SYI_BORPE RecName: Full=Isoleucyl-tRNA synthetase;       
    8::938     e-179  46%  969 aa  SYI_CAUCR RecName: Full=Isoleucyl-tRNA synthetase;       
   10::965     e-178  44%  993 aa  SYI_RHILO RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-178  41%  945 aa  SYI_BURM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::957     e-177  41%  963 aa  SYI_RALEJ RecName: Full=Isoleucyl-tRNA synthetase;       
   14::964     e-177  40%  965 aa  SYI_PROMP RecName: Full=Isoleucyl-tRNA synthetase;       
    9::963     e-176  43%  972 aa  SYI_BRUAB RecName: Full=Isoleucyl-tRNA synthetase;       
    9::963     e-176  43%  972 aa  SYI_BRUA2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::945     e-176  41%  967 aa  SYI2_BURPS RecName: Full=Isoleucyl-tRNA synthetase 2;       
    4::945     e-176  41%  967 aa  SYI2_BURMA RecName: Full=Isoleucyl-tRNA synthetase 2;       
    4::934     e-175  39%  939 aa  SYI_BUCBP RecName: Full=Isoleucyl-tRNA synthetase;       
    9::963     e-175  43%  972 aa  SYI_BRUSU RecName: Full=Isoleucyl-tRNA synthetase;       
    9::963     e-175  43%  972 aa  SYI_BRUME RecName: Full=Isoleucyl-tRNA synthetase;       
   10::962     e-175  44%  971 aa  SYI_BARHE RecName: Full=Isoleucyl-tRNA synthetase;       
   10::937     e-174  43%  967 aa  SYI_AGRT5 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-174  41%  945 aa  SYI_BURVG RecName: Full=Isoleucyl-tRNA synthetase;       
    3::893     e-174  38%  905 aa  SYI_PELUB RecName: Full=Isoleucyl-tRNA synthetase;       
    2::924     e-174  39%  938 aa  SYI_BUCAP RecName: Full=Isoleucyl-tRNA synthetase;       
   17::963     e-173  40%  965 aa  SYI_PROM5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935     e-173  38%  940 aa  SYI_BUCAT RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935     e-173  38%  940 aa  SYI_BUCAI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::935     e-173  38%  940 aa  SYI_BUCA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::989     e-173  44%  999 aa  SYI_NITWN RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-173  40%  945 aa  SYI_BURS3 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-173  41%  945 aa  SYI_BURCC RecName: Full=Isoleucyl-tRNA synthetase;       
   18::944     e-172  41%  958 aa  SYI_JANMA RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-172  40%  945 aa  SYI_BURCM RecName: Full=Isoleucyl-tRNA synthetase;       
   12::969     e-172  42%  970 aa  SYI_SILPO RecName: Full=Isoleucyl-tRNA synthetase;       
   16::992     e-172  43% 1002 aa  SYI_BRAJA RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-171  40%  945 aa  SYI_BURCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-171  40%  945 aa  SYI_BURA4 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-171  40%  945 aa  SYI_BURCH RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-171  40%  945 aa  SYI_BURCA RecName: Full=Isoleucyl-tRNA synthetase;       
    1::909     e-170  39%  915 aa  SYI_MYCMS RecName: Full=Isoleucyl-tRNA synthetase;       
   13::931     e-170  40%  945 aa  SYI1_BURPS RecName: Full=Isoleucyl-tRNA synthetase 1;       
   13::931     e-170  40%  945 aa  SYI1_BURMA RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::912     e-170  40%  921 aa  SYI_CAMLR RecName: Full=Isoleucyl-tRNA synthetase;       
    1::884     e-169  38%  885 aa  SYI_MYCMO RecName: Full=Isoleucyl-tRNA synthetase;       
    1::881     e-169  37%  900 aa  SYI_ONYPE RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915     e-168  40%  917 aa  SYI_CAMJE RecName: Full=Isoleucyl-tRNA synthetase;       
   14::994     e-168  42% 1005 aa  SYI_RHOPA RecName: Full=Isoleucyl-tRNA synthetase;       
   10::962     e-168  42%  971 aa  SYI_BARQU RecName: Full=Isoleucyl-tRNA synthetase;       
    1::890     e-167  39%  897 aa  SYI_MYCS5 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-167  39%  920 aa  SYI_HELPG RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-167  39%  920 aa  SYI_HELPY RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-166  39%  920 aa  SYI_HELP2 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::908     e-166  39%  908 aa  SYI_MESFL RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-166  39%  920 aa  SYI_HELPH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::915     e-165  39%  917 aa  SYI_CAMJR RecName: Full=Isoleucyl-tRNA synthetase;       
    5::899     e-164  38%  901 aa  SYI_MYCGA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-164  38%  920 aa  SYI_HELPJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891     e-163  38%  900 aa  SYI_MYCPE RecName: Full=Isoleucyl-tRNA synthetase;       
   60::1011    e-162  39% 1012 aa  SYIM_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial;   
    4::877     e-161  38%  900 aa  SYI_UREPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-160  39%  921 aa  SYI_HELAH RecName: Full=Isoleucyl-tRNA synthetase;       
    4::917     e-160  39%  920 aa  SYI_HELPS RecName: Full=Isoleucyl-tRNA synthetase;       
   41::1033    e-158  38% 1034 aa  SYIM_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
    1::781     e-157  39%  940 aa  SYI_WIGBR RecName: Full=Isoleucyl-tRNA synthetase;       
    4::880     e-157  37%  886 aa  SYI_MYCHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   41::990     e-157  38%  993 aa  SYIM_MACFA RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    4::880     e-156  36%  886 aa  SYI_MYCH2 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::880     e-156  37%  886 aa  SYI_MYCH7 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::1009    e-156  38% 1012 aa  SYIM_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial;   
   46::990     e-151  38% 1000 aa  SYIM_CHICK RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   16::852     e-146  38% 1045 aa  SYI_METTM RecName: Full=Isoleucyl-tRNA synthetase;       
   10::889     e-143  37% 1058 aa  SYI_METBU RecName: Full=Isoleucyl-tRNA synthetase;       
   16::852     e-142  38% 1044 aa  SYI_METTH RecName: Full=Isoleucyl-tRNA synthetase;       
   23::998     e-138  36% 1002 aa  SYIM_YEAST RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    1::528     e-138  51%  529 aa  SYI_AQUPY RecName: Full=Isoleucyl-tRNA synthetase;       
   19::765     e-137  40% 1018 aa  SYI_ARCFU RecName: Full=Isoleucyl-tRNA synthetase;       
    5::778     e-137  35%  941 aa  SYI_BUCCC RecName: Full=Isoleucyl-tRNA synthetase;       
   21::851     e-136  39% 1059 aa  SYI_METMJ RecName: Full=Isoleucyl-tRNA synthetase;       
   21::794     e-135  39% 1062 aa  SYI_METHJ RecName: Full=Isoleucyl-tRNA synthetase;       
    4::857     e-135  36% 1058 aa  SYI_METBF RecName: Full=Isoleucyl-tRNA synthetase;       
    7::775     e-133  39% 1047 aa  SYI_SULTO RecName: Full=Isoleucyl-tRNA synthetase;       
   15::798     e-132  37% 1058 aa  SYI_METMA RecName: Full=Isoleucyl-tRNA synthetase;       
   34::968     e-132  34%  973 aa  SYIM_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   21::826     e-131  37% 1066 aa  SYI_METLZ RecName: Full=Isoleucyl-tRNA synthetase;       
   22::792     e-131  38% 1049 aa  SYI_METTP RecName: Full=Isoleucyl-tRNA synthetase;       
   21::828     e-129  39% 1080 aa  SYI_METKA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::846     e-129  35% 1058 aa  SYI_METAC RecName: Full=Isoleucyl-tRNA synthetase;       
   14::790     e-127  36% 1049 aa  SYI_SULIM RecName: Full=Isoleucyl-tRNA synthetase;       
   14::790     e-127  36% 1049 aa  SYI_SULIA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::846     e-127  35%  861 aa  SYI_MYCPN RecName: Full=Isoleucyl-tRNA synthetase;       
   11::779     e-125  37% 1050 aa  SYI_SULAC RecName: Full=Isoleucyl-tRNA synthetase;       
   17::823     e-124  37% 1070 aa  SYI_HALSA RecName: Full=Isoleucyl-tRNA synthetase;       
   21::878     e-123  34% 1059 aa  SYI_HALWD RecName: Full=Isoleucyl-tRNA synthetase;       
    8::775     e-121  36% 1039 aa  SYI_METJA RecName: Full=Isoleucyl-tRNA synthetase;       
   21::851     e-121  36% 1076 aa  SYI_METB6 RecName: Full=Isoleucyl-tRNA synthetase;       
   22::921     e-121  36% 1104 aa  SYI_UNCMA RecName: Full=Isoleucyl-tRNA synthetase;       
   11::886     e-120  34% 1065 aa  SYI_PYRKO RecName: Full=Isoleucyl-tRNA synthetase;       
   21::727     e-120  37%  986 aa  SYI_SULSO RecName: Full=Isoleucyl-tRNA synthetase;       
    4::891     e-119  32%  895 aa  SYI_MYCGE RecName: Full=Isoleucyl-tRNA synthetase;       
   23::886     e-118  35% 1066 aa  SYI_PYRHO RecName: Full=Isoleucyl-tRNA synthetase;       
   26::804     e-117  36% 1064 aa  SYI_AERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   23::886     e-116  34% 1066 aa  SYI_PYRFU RecName: Full=Isoleucyl-tRNA synthetase;       
    9::886     e-115  34% 1067 aa  SYI_PYRAB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::829     e-115  35% 1061 aa  SYI_NATPD RecName: Full=Isoleucyl-tRNA synthetase;       
   21::780     e-114  36% 1040 aa  SYI_META3 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::786     e-114  33% 1038 aa  SYI_CLONN RecName: Full=Isoleucyl-tRNA synthetase;       
   19::784     e-111  34% 1035 aa  SYI_CLOAB RecName: Full=Isoleucyl-tRNA synthetase;       
   13::786     e-110  33% 1036 aa  SYI_CLOTE RecName: Full=Isoleucyl-tRNA synthetase;       
    8::851     e-107  33% 1034 aa  SYI_METMP RecName: Full=Isoleucyl-tRNA synthetase;       
    2::799     e-105  35% 1056 aa  SYI_BDEBA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::801     e-104  35% 1074 aa  SYI_HALMA RecName: Full=Isoleucyl-tRNA synthetase;       
   12::779     e-104  33% 1030 aa  SYI2_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 2;       
    7::830     e-103  33% 1091 aa  SYI_TREPS RecName: Full=Isoleucyl-tRNA synthetase;       
    7::830     e-103  33% 1091 aa  SYI_TREPA RecName: Full=Isoleucyl-tRNA synthetase;       
   22::794     e-103  32% 1039 aa  SYI_CLOPE RecName: Full=Isoleucyl-tRNA synthetase;       
    5::843     e-102  32% 1022 aa  SYI2_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 2;       
   20::762     e-101  33% 1033 aa  SYI2_BACAN RecName: Full=Isoleucyl-tRNA synthetase 2;       
   20::762     e-101  33% 1033 aa  SYI2_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 2;       
    1::807     e-101  32%  981 aa  SYI_PYRAE RecName: Full=Isoleucyl-tRNA synthetase;       
   20::762     e-101  34% 1033 aa  SYI2_BACHK RecName: Full=Isoleucyl-tRNA synthetase 2;       
   20::762     e-101  34% 1033 aa  SYI2_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 2;       
   13::733     e-100  35%  877 aa  SYV_METTH RecName: Full=Valyl-tRNA synthetase;       
   20::762     e-100  33% 1033 aa  SYI_BACAH RecName: Full=Isoleucyl-tRNA synthetase;       
    7::815     e-100  34% 1100 aa  SYI_TREDE RecName: Full=Isoleucyl-tRNA synthetase;       
   13::784     e-100  32% 1034 aa  SYI_CLOK5 RecName: Full=Isoleucyl-tRNA synthetase;       
   20::762     e-100  33% 1033 aa  SYI2_BACCR RecName: Full=Isoleucyl-tRNA synthetase 2;       
    9::789     1e-98  33% 1043 aa  SYI_THET2 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::825     1e-98  33% 1084 aa  SYI_CHLTE RecName: Full=Isoleucyl-tRNA synthetase;       
    9::789     4e-98  33% 1043 aa  SYI_THET8 RecName: Full=Isoleucyl-tRNA synthetase;       
    2::686     1e-97  34%  855 aa  SYV_METTP RecName: Full=Valyl-tRNA synthetase;       
   10::783     5e-96  34% 1262 aa  SYIC_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
    6::867     2e-95  32% 1036 aa  SYI_CHLMU RecName: Full=Isoleucyl-tRNA synthetase;       
    1::744     1e-94  31%  869 aa  SYV_METBF RecName: Full=Valyl-tRNA synthetase;       
    1::744     1e-94  32%  869 aa  SYV_METMA RecName: Full=Valyl-tRNA synthetase;       
   10::796     1e-93  33% 1262 aa  SYIC_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
    3::705     4e-93  34%  865 aa  SYV_THEMA RecName: Full=Valyl-tRNA synthetase;       
   15::762     4e-93  32% 1026 aa  SYI_THEAC RecName: Full=Isoleucyl-tRNA synthetase;       
   12::780     8e-93  32% 1141 aa  SYIC_CAEEL RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   26::779     1e-92  30% 1024 aa  SYI_PICTO RecName: Full=Isoleucyl-tRNA synthetase;       
   47::700     7e-92  34%  878 aa  SYV_METJA RecName: Full=Valyl-tRNA synthetase;       
   23::762     3e-91  33% 1028 aa  SYI_THEVO RecName: Full=Isoleucyl-tRNA synthetase;       
    1::744     6e-91  31%  869 aa  SYV_METAC RecName: Full=Valyl-tRNA synthetase;       
   11::689     1e-90  33%  863 aa  SYV_ARCFU RecName: Full=Valyl-tRNA synthetase;       
   17::872     2e-90  31% 1060 aa  SYI_THEFY RecName: Full=Isoleucyl-tRNA synthetase;       
    6::867     6e-90  31% 1036 aa  SYI_CHLTB RecName: Full=Isoleucyl-tRNA synthetase;       
    6::867     6e-90  31% 1036 aa  SYI_CHLT2 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::867     1e-89  31% 1036 aa  SYI_CHLTR RecName: Full=Isoleucyl-tRNA synthetase;       
    6::867     1e-89  31% 1036 aa  SYI_CHLTA RecName: Full=Isoleucyl-tRNA synthetase;       
    6::793     2e-89  31% 1081 aa  SYI_TETTH RecName: Full=Isoleucyl-tRNA synthetase;       
   13::710     2e-87  32%  878 aa  SYV_CARHZ RecName: Full=Valyl-tRNA synthetase;       
   10::784     2e-87  32% 1042 aa  SYI_NOCFA RecName: Full=Isoleucyl-tRNA synthetase;       
    9::860     4e-87  31% 1072 aa  SYIC_YEAST RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   14::759     7e-87  30% 1024 aa  SYI2_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
    8::901     9e-87  30% 1014 aa  SYI_DEHSC RecName: Full=Isoleucyl-tRNA synthetase;       
   12::884     2e-85  30% 1047 aa  SYI_STRCO RecName: Full=Isoleucyl-tRNA synthetase;       
   10::860     2e-85  31% 1052 aa  SYI_CORDI RecName: Full=Isoleucyl-tRNA synthetase;       
    8::804     2e-85  33% 1014 aa  SYI_DEHE1 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::862     3e-85  30% 1038 aa  SYI_PARUW RecName: Full=Isoleucyl-tRNA synthetase;       
    9::784     1e-84  29% 1092 aa  SYI_RICCN RecName: Full=Isoleucyl-tRNA synthetase;       
   19::858     2e-84  31% 1054 aa  SYI_COREF RecName: Full=Isoleucyl-tRNA synthetase;       
   15::793     2e-84  30%  881 aa  SYV_CLOAB RecName: Full=Valyl-tRNA synthetase;       
    7::876     2e-84  32% 1067 aa  SYIC_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
    9::784     3e-84  29% 1092 aa  SYI_RICPU RecName: Full=Isoleucyl-tRNA synthetase;       
    9::795     5e-84  29% 1094 aa  SYI_RICFE RecName: Full=Isoleucyl-tRNA synthetase;       
   17::705     7e-84  31%  887 aa  SYV_DESPS RecName: Full=Valyl-tRNA synthetase;       
   17::838     7e-84  30% 1101 aa  SYI_ANAMM RecName: Full=Isoleucyl-tRNA synthetase;       
   11::785     9e-84  31%  880 aa  SYV_CLOPE RecName: Full=Valyl-tRNA synthetase;       
   20::784     9e-84  29% 1092 aa  SYI_RICAE RecName: Full=Isoleucyl-tRNA synthetase;       
    1::859     2e-83  32% 1110 aa  SYI_CYTH3 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::835     3e-83  29% 1118 aa  SYI_EHRRG RecName: Full=Isoleucyl-tRNA synthetase;       
    9::872     3e-83  29% 1043 aa  SYI_CHLAB RecName: Full=Isoleucyl-tRNA synthetase;       
    2::695     4e-83  33%  874 aa  SYV_PETMO RecName: Full=Valyl-tRNA synthetase;       
   14::744     4e-83  32%  914 aa  SYV_METKA RecName: Full=Valyl-tRNA synthetase;       
   31::835     8e-83  29% 1117 aa  SYI_EHRRW RecName: Full=Isoleucyl-tRNA synthetase;       
   25::909     1e-82  31% 1092 aa  SYI_CORJK RecName: Full=Isoleucyl-tRNA synthetase;       
    3::711     4e-82  30%  879 aa  SYV_THETN RecName: Full=Valyl-tRNA synthetase;       
    9::872     1e-81  30% 1043 aa  SYI_CHLCV RecName: Full=Isoleucyl-tRNA synthetase;       
    8::781     2e-81  31%  867 aa  SYV_FERNB RecName: Full=Valyl-tRNA synthetase;       
   21::881     2e-81  31% 1137 aa  SYI_PORGI RecName: Full=Isoleucyl-tRNA synthetase;       
    9::800     2e-81  29% 1086 aa  SYI_RICTY RecName: Full=Isoleucyl-tRNA synthetase;       
    9::846     3e-81  29% 1086 aa  SYI_RICPR RecName: Full=Isoleucyl-tRNA synthetase;       
   15::730     4e-81  30%  861 aa  SYV_THELT RecName: Full=Valyl-tRNA synthetase;       
   15::792     4e-81  30%  880 aa  SYV_CLOTE RecName: Full=Valyl-tRNA synthetase;       
   10::783     5e-81  30%  891 aa  SYV_PYRFU RecName: Full=Valyl-tRNA synthetase;       
   12::884     5e-81  28% 1047 aa  SYI_STRAW RecName: Full=Isoleucyl-tRNA synthetase;       
   26::717     9e-81  31%  882 aa  SYV_LISIN RecName: Full=Valyl-tRNA synthetase;       
    9::825     1e-80  30% 1108 aa  SYI_RICB8 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::825     2e-80  30% 1108 aa  SYI_RICBR RecName: Full=Isoleucyl-tRNA synthetase;       
   13::870     4e-80  29% 1043 aa  SYI_CHLPN RecName: Full=Isoleucyl-tRNA synthetase;       
    9::782     5e-80  29% 1079 aa  SYI_RICCK RecName: Full=Isoleucyl-tRNA synthetase;       
   10::740     6e-80  31%  891 aa  SYV_PYRHO RecName: Full=Valyl-tRNA synthetase;       
    1::779     6e-80  31% 1064 aa  SYIC_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   26::856     1e-79  29% 1120 aa  SYI_EHRCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   18::769     7e-79  30%  880 aa  SYV_BACHD RecName: Full=Valyl-tRNA synthetase;       
   27::718     9e-79  31%  883 aa  SYV_LISMF RecName: Full=Valyl-tRNA synthetase;       
   31::836     1e-78  30% 1053 aa  SYI_MYCPA RecName: Full=Isoleucyl-tRNA synthetase;       
   10::725     1e-78  31%  891 aa  SYV_PYRAB RecName: Full=Valyl-tRNA synthetase;       
   27::718     1e-78  31%  883 aa  SYV_LISMO RecName: Full=Valyl-tRNA synthetase;       
   10::780     1e-77  31%  888 aa  SYV_PYRKO RecName: Full=Valyl-tRNA synthetase;       
   21::908     2e-77  32% 1162 aa  SYI_BACTN RecName: Full=Isoleucyl-tRNA synthetase;       
   12::824     4e-77  29% 1056 aa  SYI_TROWT RecName: Full=Isoleucyl-tRNA synthetase;       
   12::824     4e-77  29% 1056 aa  SYI_TROW8 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::791     1e-76  28% 1042 aa  SYI_BORBZ RecName: Full=Isoleucyl-tRNA synthetase;       
    8::791     1e-76  28% 1042 aa  SYI_BORBU RecName: Full=Isoleucyl-tRNA synthetase;       
    8::848     2e-76  29% 1044 aa  SYI_BORT9 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::792     2e-76  30% 1044 aa  SYI_BORHD RecName: Full=Isoleucyl-tRNA synthetase;       
    8::791     2e-76  29% 1042 aa  SYI_BORGA RecName: Full=Isoleucyl-tRNA synthetase;       
    6::802     3e-76  30%  899 aa  SYV_PELCD RecName: Full=Valyl-tRNA synthetase;       
   14::731     4e-76  31%  881 aa  SYV_HALSA RecName: Full=Valyl-tRNA synthetase;       
   14::731     4e-76  31%  881 aa  SYV_HALS3 RecName: Full=Valyl-tRNA synthetase;       
   10::708     7e-76  30%  886 aa  SYV_METMP RecName: Full=Valyl-tRNA synthetase;       
    8::791     7e-76  28% 1042 aa  SYI_BORAP RecName: Full=Isoleucyl-tRNA synthetase;       
   19::858     9e-76  29% 1054 aa  SYI_CORGL RecName: Full=Isoleucyl-tRNA synthetase;       
   12::733     3e-75  30%  872 aa  SYV_NATPD RecName: Full=Valyl-tRNA synthetase;       
    8::771     2e-74  29% 1044 aa  SYI_BORDL RecName: Full=Isoleucyl-tRNA synthetase;       
   10::744     1e-73  31%  911 aa  SYV_SYMTH RecName: Full=Valyl-tRNA synthetase;       
    8::771     1e-73  29% 1044 aa  SYI_BORRA RecName: Full=Isoleucyl-tRNA synthetase;       
   14::904     2e-73  30% 1078 aa  SYI_DEIRA RecName: Full=Isoleucyl-tRNA synthetase;       
    3::725     4e-73  30%  879 aa  SYV_LACJO RecName: Full=Valyl-tRNA synthetase;       
   12::704     4e-73  29%  887 aa  SYV_FUSNN RecName: Full=Valyl-tRNA synthetase;       
    3::713     7e-73  29%  883 aa  SYV_STRMU RecName: Full=Valyl-tRNA synthetase;       
   17::700     7e-73  30%  882 aa  SYV_LACSS RecName: Full=Valyl-tRNA synthetase;       
   16::712     1e-72  30%  880 aa  SYV_BACSK RecName: Full=Valyl-tRNA synthetase;       
   23::699     2e-72  30%  884 aa  SYV_DESVH RecName: Full=Valyl-tRNA synthetase;       
   15::806     3e-72  29% 1041 aa  SYI_MYCTU RecName: Full=Isoleucyl-tRNA synthetase;       
   15::806     3e-72  29% 1041 aa  SYI_MYCBO RecName: Full=Isoleucyl-tRNA synthetase;       
   23::861     4e-72  30% 1114 aa  SYI_PROAC RecName: Full=Isoleucyl-tRNA synthetase;       
    9::799     8e-72  27% 1103 aa  SYI_RICAH RecName: Full=Isoleucyl-tRNA synthetase;       
   21::865     8e-72  30% 1141 aa  SYI_BACFR RecName: Full=Isoleucyl-tRNA synthetase;       
   27::755     1e-71  29%  880 aa  SYV_DEHE1 RecName: Full=Valyl-tRNA synthetase;       
   21::865     1e-71  30% 1141 aa  SYI_BACFN RecName: Full=Isoleucyl-tRNA synthetase;       
    7::842     1e-71  30% 1059 aa  SYI_MYCLE RecName: Full=Isoleucyl-tRNA synthetase;       
   25::713     2e-71  29%  881 aa  SYV_BACC1 RecName: Full=Valyl-tRNA synthetase;       
   13::708     2e-71  29%  875 aa  SYV_ANOFW RecName: Full=Valyl-tRNA synthetase;       
   26::896     2e-71  26% 1111 aa  SYI_WOLPM RecName: Full=Isoleucyl-tRNA synthetase;       
    2::697     7e-71  29%  879 aa  SYV_LACAC RecName: Full=Valyl-tRNA synthetase;       
   25::713     7e-71  29%  881 aa  SYV_BACCZ RecName: Full=Valyl-tRNA synthetase;       
   18::714     9e-71  30%  880 aa  SYV_BACLD RecName: Full=Valyl-tRNA synthetase;       
   25::713     1e-70  29%  881 aa  SYV_BACCR RecName: Full=Valyl-tRNA synthetase;       
    4::698     2e-70  30%  883 aa  SYV_STRT2 RecName: Full=Valyl-tRNA synthetase;       
    4::698     2e-70  30%  883 aa  SYV_STRT1 RecName: Full=Valyl-tRNA synthetase;       
    5::707     2e-70  29%  889 aa  SYV_LACPL RecName: Full=Valyl-tRNA synthetase;       
   18::713     2e-70  29%  880 aa  SYV_GEOKA RecName: Full=Valyl-tRNA synthetase;       
   15::699     3e-70  30%  880 aa  SYV_ENTFA RecName: Full=Valyl-tRNA synthetase;       
   25::713     3e-70  29%  881 aa  SYV_BACHK RecName: Full=Valyl-tRNA synthetase;       
   25::713     3e-70  29%  881 aa  SYV_BACAN RecName: Full=Valyl-tRNA synthetase;       
   48::851     1e-69  29% 1119 aa  SYI_LEIXX RecName: Full=Isoleucyl-tRNA synthetase;       
    1::789     2e-69  29%  791 aa  SYV_THEAC RecName: Full=Valyl-tRNA synthetase;       
   18::713     2e-69  29%  880 aa  SYV_BACST RecName: Full=Valyl-tRNA synthetase;       
   10::702     4e-69  30%  880 aa  SYV_LACLA RecName: Full=Valyl-tRNA synthetase;       
    2::702     5e-69  29%  882 aa  SYV_STRPM RecName: Full=Valyl-tRNA synthetase;       
    2::702     6e-69  29%  882 aa  SYV_STRP1 RecName: Full=Valyl-tRNA synthetase;       
   19::931     8e-69  30% 1103 aa  SYI_BIFLO RecName: Full=Isoleucyl-tRNA synthetase;       
   15::728     2e-68  30%  909 aa  SYV_TREDE RecName: Full=Valyl-tRNA synthetase;       
    4::713     2e-68  29%  883 aa  SYV_STRPN RecName: Full=Valyl-tRNA synthetase;       
   18::712     2e-68  29%  880 aa  SYV_BACSU RecName: Full=Valyl-tRNA synthetase;       
    2::712     7e-68  29%  882 aa  SYV_STRP3 RecName: Full=Valyl-tRNA synthetase;       
    4::713     9e-68  29%  883 aa  SYV_STRR6 RecName: Full=Valyl-tRNA synthetase;       
   27::755     9e-68  29%  880 aa  SYV_DEHSC RecName: Full=Valyl-tRNA synthetase;       
    1::378     9e-68  41%  413 aa  SYIM_CIOIN RecName: Full=Probable isoleucyl-tRNA synthetase,
    2::712     1e-67  29%  882 aa  SYV_STRP8 RecName: Full=Valyl-tRNA synthetase;       
    2::712     2e-67  28%  882 aa  SYV_STRP6 RecName: Full=Valyl-tRNA synthetase;       
   12::780     2e-67  29%  901 aa  SYV_HALMA RecName: Full=Valyl-tRNA synthetase;       
    8::712     4e-67  28%  876 aa  SYV_STACT RecName: Full=Valyl-tRNA synthetase;       
    4::712     1e-66  29%  883 aa  SYV_STRA5 RecName: Full=Valyl-tRNA synthetase;       
   15::699     2e-66  29%  882 aa  SYV_LEPIN RecName: Full=Valyl-tRNA synthetase;       
   15::699     2e-66  29%  882 aa  SYV_LEPIC RecName: Full=Valyl-tRNA synthetase;       
    4::712     2e-66  28%  884 aa  SYV_STRA1 RecName: Full=Valyl-tRNA synthetase;       
   18::766     8e-66  30%  887 aa  SYV_GEOSL RecName: Full=Valyl-tRNA synthetase;       
    8::696     4e-65  28%  876 aa  SYV_STAHJ RecName: Full=Valyl-tRNA synthetase;       
    1::711     2e-64  28%  790 aa  SYV_THEVO RecName: Full=Valyl-tRNA synthetase;       
    8::735     2e-64  28%  876 aa  SYV_STAS1 RecName: Full=Valyl-tRNA synthetase;       
   13::707     2e-64  28%  894 aa  SYV_BDEBA RecName: Full=Valyl-tRNA synthetase;       
   32::694     4e-64  30%  874 aa  SYV_STRAW RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAW RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAT RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAS RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAN RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAE RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAAC RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAA9 RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAA8 RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAA3 RecName: Full=Valyl-tRNA synthetase;       
   11::712     4e-64  27%  876 aa  SYV_STAA2 RecName: Full=Valyl-tRNA synthetase;       
   11::712     5e-64  27%  876 aa  SYV_STAAM RecName: Full=Valyl-tRNA synthetase;       
   11::712     5e-64  27%  876 aa  SYV_STAA1 RecName: Full=Valyl-tRNA synthetase;       
   11::712     6e-64  27%  876 aa  SYV_STAAB RecName: Full=Valyl-tRNA synthetase;       
    1::723     1e-63  29%  874 aa  SYV_STRCO RecName: Full=Valyl-tRNA synthetase;       
   37::908     1e-63  29% 1035 aa  SYV_RHOBA RecName: Full=Valyl-tRNA synthetase;       
   23::827     1e-63  29%  901 aa  SYV_CHLTE RecName: Full=Valyl-tRNA synthetase;       
   58::1027    2e-63  30% 1213 aa  SYI_RHOBA RecName: Full=Isoleucyl-tRNA synthetase;       
   11::712     4e-63  27%  876 aa  SYV_STAAR RecName: Full=Valyl-tRNA synthetase;       
   48::776     7e-63  30%  831 aa  SYV_SULAC RecName: Full=Valyl-tRNA synthetase;       
   11::696     9e-63  27%  876 aa  SYV_STAES RecName: Full=Valyl-tRNA synthetase;       
   11::696     9e-63  27%  876 aa  SYV_STAEQ RecName: Full=Valyl-tRNA synthetase;       
   19::702     9e-63  28%  883 aa  SYV_LACCA RecName: Full=Valyl-tRNA synthetase;       
    8::762     1e-62  28%  855 aa  SYV_SOLUE RecName: Full=Valyl-tRNA synthetase;       
   14::809     1e-62  30%  950 aa  SYV_PSEAE RecName: Full=Valyl-tRNA synthetase;       
   14::731     3e-62  28%  910 aa  SYV_SYNY3 RecName: Full=Valyl-tRNA synthetase;       
   15::799     3e-62  27%  873 aa  SYV_PARD8 RecName: Full=Valyl-tRNA synthetase;       
   27::834     4e-62  28%  929 aa  SYV_PROMM RecName: Full=Valyl-tRNA synthetase;       
    2::657     1e-61  30%  862 aa  SYV_THET2 RecName: Full=Valyl-tRNA synthetase;       
    2::657     8e-61  30%  862 aa  SYV_THETH RecName: Full=Valyl-tRNA synthetase;       
    2::657     8e-61  30%  862 aa  SYV_THET8 RecName: Full=Valyl-tRNA synthetase;       
   21::813     3e-60  28%  914 aa  SYV_SYNPX RecName: Full=Valyl-tRNA synthetase;       
    4::712     3e-60  28%  884 aa  SYV_STRA3 RecName: Full=Valyl-tRNA synthetase;       
    4::805     4e-60  27%  809 aa  SYV_SULTO RecName: Full=Valyl-tRNA synthetase;       
    7::706     4e-60  27%  812 aa  SYV_EHRRG RecName: Full=Valyl-tRNA synthetase;       
   34::794     5e-60  29%  933 aa  SYV_PROMA RecName: Full=Valyl-tRNA synthetase;       
   13::804     9e-60  28%  897 aa  SYV_GLOVI RecName: Full=Valyl-tRNA synthetase;       
  262::1107    9e-60  27% 1217 aa  SYVC_TAKRU RecName: Full=Valyl-tRNA synthetase;       
    1::548     1e-59  31%  628 aa  SYI_ANTLO RecName: Full=Isoleucyl-tRNA synthetase;       
    2::698     2e-59  28%  876 aa  SYV_PORG3 RecName: Full=Valyl-tRNA synthetase;       
    8::719     2e-59  27%  883 aa  SYV_OCEIH RecName: Full=Valyl-tRNA synthetase;       
    5::704     3e-59  27%  810 aa  SYV_EHRRW RecName: Full=Valyl-tRNA synthetase;       
   11::835     1e-58  28%  912 aa  SYV_THIDA RecName: Full=Valyl-tRNA synthetase;       
    2::698     1e-58  28%  876 aa  SYV_PORGI RecName: Full=Valyl-tRNA synthetase;       
   17::843     2e-58  27% 1014 aa  SYV_ANASP RecName: Full=Valyl-tRNA synthetase;       
  153::920     4e-58  29% 1093 aa  SYV_NEUCR RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   25::723     5e-58  28%  909 aa  SYV_SYNP6 RecName: Full=Valyl-tRNA synthetase;       
   56::735     7e-58  31%  893 aa  SYV_NOCFA RecName: Full=Valyl-tRNA synthetase;       
   35::730     1e-57  30%  874 aa  SYV_HELPY RecName: Full=Valyl-tRNA synthetase;       
   15::722     1e-57  29%  913 aa  SYV_THEEB RecName: Full=Valyl-tRNA synthetase;       
   21::834     1e-57  29%  939 aa  SYV_CHRVO RecName: Full=Valyl-tRNA synthetase;       
   30::900     3e-57  27%  984 aa  SYV_PSYA2 RecName: Full=Valyl-tRNA synthetase;       
   45::704     6e-57  30%  842 aa  SYV_SULSO RecName: Full=Valyl-tRNA synthetase;       
   15::820     6e-57  27%  876 aa  SYV_BACFR RecName: Full=Valyl-tRNA synthetase;       
   15::820     6e-57  27%  876 aa  SYV_BACFN RecName: Full=Valyl-tRNA synthetase;       
    8::778     7e-57  27%  871 aa  SYV_NITSB RecName: Full=Valyl-tRNA synthetase;       
    6::226     1e-56  29% 1134 aa  SYI_WOLTR RecName: Full=Isoleucyl-tRNA synthetase;       
    9::836     5e-56  31%  945 aa  SYV_NEIMA RecName: Full=Valyl-tRNA synthetase;       
    9::836     6e-56  31%  945 aa  SYV_NEIG1 RecName: Full=Valyl-tRNA synthetase;       
   33::728     6e-56  29%  872 aa  SYV_HELPJ RecName: Full=Valyl-tRNA synthetase;       
    8::735     1e-55  28%  931 aa  SYV_ALCBS RecName: Full=Valyl-tRNA synthetase;       
   13::692     1e-55  28%  874 aa  SYV_UREPA RecName: Full=Valyl-tRNA synthetase;       
    6::836     1e-55  30%  945 aa  SYV_NEIMB RecName: Full=Valyl-tRNA synthetase;       
   33::766     2e-55  28%  933 aa  SYV_PROMT RecName: Full=Valyl-tRNA synthetase;       
   19::714     7e-55  28%  823 aa  SYV_AERPE RecName: Full=Valyl-tRNA synthetase;       
    3::716     9e-55  28%  814 aa  SYV_RICPR RecName: Full=Valyl-tRNA synthetase;       
   19::850     9e-55  29%  937 aa  SYV_LARHH RecName: Full=Valyl-tRNA synthetase;       
   15::700     9e-55  27%  875 aa  SYV_BACV8 RecName: Full=Valyl-tRNA synthetase;       
   60::741     1e-54  28%  903 aa  SYV_COREF RecName: Full=Valyl-tRNA synthetase;       
   49::714     2e-54  30%  899 aa  SYV_HELHP RecName: Full=Valyl-tRNA synthetase;       
   60::751     2e-54  29%  903 aa  SYV_CORGL RecName: Full=Valyl-tRNA synthetase;       
    7::756     2e-54  30%  919 aa  SYV_CORDI RecName: Full=Valyl-tRNA synthetase;       
   36::766     3e-54  29%  932 aa  SYV_CORJK RecName: Full=Valyl-tRNA synthetase;       
   15::700     3e-54  26%  879 aa  SYV_BACTN RecName: Full=Valyl-tRNA synthetase;       
   15::693     3e-54  27%  872 aa  SYV_MYCMS RecName: Full=Valyl-tRNA synthetase;       
    4::854     3e-54  29%  954 aa  SYV_HAEIN RecName: Full=Valyl-tRNA synthetase;       
    4::743     3e-54  27%  876 aa  SYV_GRAFK RecName: Full=Valyl-tRNA synthetase;       
    3::716     4e-54  28%  814 aa  SYV_RICTY RecName: Full=Valyl-tRNA synthetase;       
    4::699     4e-54  27%  873 aa  SYV_MESFL RecName: Full=Valyl-tRNA synthetase;       
   43::807     2e-53  30%  917 aa  SYV_NITEC RecName: Full=Valyl-tRNA synthetase;       
   16::747     2e-53  28%  940 aa  SYV_CHLFF RecName: Full=Valyl-tRNA synthetase;       
    4::854     3e-53  29%  954 aa  SYV_HAEIG RecName: Full=Valyl-tRNA synthetase;       
    7::756     1e-52  27%  921 aa  SYV_LEGPH RecName: Full=Valyl-tRNA synthetase;       
    7::756     1e-52  27%  921 aa  SYV_LEGPA RecName: Full=Valyl-tRNA synthetase;       
   11::835     2e-52  30% 1020 aa  SYV_SILPO RecName: Full=Valyl-tRNA synthetase;       
    4::854     2e-52  28%  954 aa  SYV_HAEIE RecName: Full=Valyl-tRNA synthetase;       
    4::854     2e-52  29%  954 aa  SYV_HAEI8 RecName: Full=Valyl-tRNA synthetase;       
    5::740     2e-52  27%  940 aa  SYV_CHLPN RecName: Full=Valyl-tRNA synthetase;       
   23::848     5e-52  28%  973 aa  SYV_COLP3 RecName: Full=Valyl-tRNA synthetase;       
   16::832     5e-52  27%  940 aa  SYV_CHLCV RecName: Full=Valyl-tRNA synthetase;       
   27::716     7e-52  27%  812 aa  SYV_RICB8 RecName: Full=Valyl-tRNA synthetase;       
   16::832     7e-52  27%  940 aa  SYV_CHLAB RecName: Full=Valyl-tRNA synthetase;       
   23::740     9e-52  28%  939 aa  SYV_CHLTA RecName: Full=Valyl-tRNA synthetase;       
   47::852     1e-51  30%  954 aa  SYV_HAES2 RecName: Full=Valyl-tRNA synthetase;       
    7::756     2e-51  27%  921 aa  SYV_LEGPL RecName: Full=Valyl-tRNA synthetase;       
   10::765     2e-51  27%  855 aa  SYV_WOLTR RecName: Full=Valyl-tRNA synthetase;       
   27::716     2e-51  27%  812 aa  SYV_RICBR RecName: Full=Valyl-tRNA synthetase;       
   23::740     2e-51  28%  939 aa  SYV_CHLTR RecName: Full=Valyl-tRNA synthetase;       
   23::740     2e-51  27%  939 aa  SYV_CHLT2 RecName: Full=Valyl-tRNA synthetase;       
   23::740     3e-51  27%  939 aa  SYV_CHLTB RecName: Full=Valyl-tRNA synthetase;       
    1::729     5e-51  27%  918 aa  SYV_PROMP RecName: Full=Valyl-tRNA synthetase;       
   24::872     5e-51  29%  960 aa  SYV_BORPE RecName: Full=Valyl-tRNA synthetase;       
   24::872     6e-51  29%  960 aa  SYV_BORBR RecName: Full=Valyl-tRNA synthetase;       
   27::717     6e-51  28%  823 aa  SYV_ANAMM RecName: Full=Valyl-tRNA synthetase;       
   10::756     8e-51  29%  864 aa  SYV_WOLPM RecName: Full=Valyl-tRNA synthetase;       
   19::785     1e-50  27%  943 aa  SYV_DECAR RecName: Full=Valyl-tRNA synthetase;       
   96::858     1e-50  26% 1050 aa  SYV_CAEEL RecName: Full=Valyl-tRNA synthetase;       
   28::645     2e-50  28%  870 aa  SYV_CAMJR RecName: Full=Valyl-tRNA synthetase;       
    6::752     2e-50  26%  920 aa  SYV_COXBU RecName: Full=Valyl-tRNA synthetase;       
   24::872     2e-50  29%  960 aa  SYV_BORPA RecName: Full=Valyl-tRNA synthetase;       
   19::736     3e-50  28%  888 aa  SYV_GLUOX RecName: Full=Valyl-tRNA synthetase;       
   29::737     4e-50  29%  894 aa  SYV_WOLSU RecName: Full=Valyl-tRNA synthetase;       
   15::694     4e-50  26%  802 aa  SYV_EHRCJ RecName: Full=Valyl-tRNA synthetase;       
    9::729     5e-50  27%  854 aa  SYV_ORITB RecName: Full=Valyl-tRNA synthetase;       
   23::740     5e-50  27%  939 aa  SYV_CHLMU RecName: Full=Valyl-tRNA synthetase;       
    2::766     5e-50  29%  954 aa  SYV_ACTP7 RecName: Full=Valyl-tRNA synthetase;       
   12::781     9e-50  28%  947 aa  SYV_RHIME RecName: Full=Valyl-tRNA synthetase;       
    4::823     1e-49  29%  954 aa  SYV_MANSM RecName: Full=Valyl-tRNA synthetase;       
   39::716     1e-49  27%  812 aa  SYV_RICCN RecName: Full=Valyl-tRNA synthetase;       
    8::741     1e-49  28%  952 aa  SYV_NITWN RecName: Full=Valyl-tRNA synthetase;       
    8::743     1e-49  27%  906 aa  SYV_CAUCR RecName: Full=Valyl-tRNA synthetase;       
    2::766     1e-49  29%  954 aa  SYV_ACTPJ RecName: Full=Valyl-tRNA synthetase;       
    2::766     1e-49  29%  954 aa  SYV_ACTP2 RecName: Full=Valyl-tRNA synthetase;       
   18::783     2e-49  30%  948 aa  SYV_PSEU2 RecName: Full=Valyl-tRNA synthetase;       
   11::696     2e-49  26%  882 aa  SYV_ONYPE RecName: Full=Valyl-tRNA synthetase;       
   18::732     2e-49  28%  921 aa  SYV_METCA RecName: Full=Valyl-tRNA synthetase;       
   33::881     2e-49  29%  971 aa  SYV_ACIAD RecName: Full=Valyl-tRNA synthetase;       
   39::716     3e-49  27%  812 aa  SYV_RICAE RecName: Full=Valyl-tRNA synthetase;       
   18::783     4e-49  30%  948 aa  SYV_PSE14 RecName: Full=Valyl-tRNA synthetase;       
   24::855     4e-49  28%  954 aa  SYV_PASMU RecName: Full=Valyl-tRNA synthetase;       
   12::782     4e-49  28%  947 aa  SYV_AGRT5 RecName: Full=Valyl-tRNA synthetase;       
   19::852     7e-49  27%  969 aa  SYV_HERAR RecName: Full=Valyl-tRNA synthetase;       
   12::742     7e-49  26%  958 aa  SYV_BRAJA RecName: Full=Valyl-tRNA synthetase;       
    4::716     9e-49  27%  813 aa  SYV_RICCK RecName: Full=Valyl-tRNA synthetase;       
   44::745     9e-49  28%  949 aa  SYV_PARUW RecName: Full=Valyl-tRNA synthetase;       
   11::801     9e-49  28%  918 aa  SYV_NITEU RecName: Full=Valyl-tRNA synthetase;       
   12::834     9e-49  27%  907 aa  SYV_BARHE RecName: Full=Valyl-tRNA synthetase;       
  161::923     1e-48  28% 1104 aa  SYV_YEAST RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   39::716     1e-48  27%  812 aa  SYV_RICPU RecName: Full=Valyl-tRNA synthetase;       
   18::783     2e-48  29%  948 aa  SYV_PSESM RecName: Full=Valyl-tRNA synthetase;       
   12::695     2e-48  26%  875 aa  SYV_PELUB RecName: Full=Valyl-tRNA synthetase;       
    4::859     2e-48  29%  961 aa  SYV_HAEDU RecName: Full=Valyl-tRNA synthetase;       
   24::881     3e-48  27%  881 aa  SYV_THEFY RecName: Full=Valyl-tRNA synthetase;       
   38::712     3e-48  28%  799 aa  SYV_PYRAE RecName: Full=Valyl-tRNA synthetase;       
   11::745     3e-48  26%  877 aa  SYV_AMOA5 RecName: Full=Valyl-tRNA synthetase;       
   16::759     4e-48  27%  896 aa  SYV_GRABC RecName: Full=Valyl-tRNA synthetase;       
  312::1095    4e-48  26% 1263 aa  SYVC_MOUSE RecName: Full=Valyl-tRNA synthetase;       
  337::1096    4e-48  26% 1264 aa  SYVC_HUMAN RecName: Full=Valyl-tRNA synthetase;       
   39::716     1e-47  27%  812 aa  SYV_RICRS RecName: Full=Valyl-tRNA synthetase;       
   39::716     1e-47  27%  812 aa  SYV_RICRO RecName: Full=Valyl-tRNA synthetase;       
   47::746     1e-47  29%  926 aa  SYV_NITMU RecName: Full=Valyl-tRNA synthetase;       
    7::722     1e-47  29%  882 aa  SYV_MYCPA RecName: Full=Valyl-tRNA synthetase;       
  136::867     1e-47  29% 1060 aa  SYVM_MOUSE RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   13::719     2e-47  26%  884 aa  SYV_ZYMMO RecName: Full=Valyl-tRNA synthetase;       
   18::783     3e-47  29%  948 aa  SYV_PSEF5 RecName: Full=Valyl-tRNA synthetase;       
   46::857     3e-47  31%  862 aa  SYV_LEIXX RecName: Full=Valyl-tRNA synthetase;       
   19::779     5e-47  27%  965 aa  SYV_JANMA RecName: Full=Valyl-tRNA synthetase;       
  142::886     5e-47  28% 1072 aa  SYVC_DICDI RecName: Full=Probable valyl-tRNA synthetase,
   18::789     7e-47  27%  955 aa  SYV_RALEJ RecName: Full=Valyl-tRNA synthetase;       
   10::799     7e-47  26%  919 aa  SYV_FRATT RecName: Full=Valyl-tRNA synthetase;       
   50::692     1e-46  24%  869 aa  SYV_MYCPE RecName: Full=Valyl-tRNA synthetase;       
  313::1096    2e-46  25% 1264 aa  SYVC_RAT RecName: Full=Valyl-tRNA synthetase;       
   39::763     3e-46  26%  859 aa  SYV_RICFE RecName: Full=Valyl-tRNA synthetase;       
   39::716     3e-46  27%  812 aa  SYV_RICAH RecName: Full=Valyl-tRNA synthetase;       
   10::780     6e-46  27%  944 aa  SYV_XANAC RecName: Full=Valyl-tRNA synthetase;       
   33::782     6e-46  28%  942 aa  SYV_STRM5 RecName: Full=Valyl-tRNA synthetase;       
   12::817     7e-46  26%  907 aa  SYV_BARQU RecName: Full=Valyl-tRNA synthetase;       
   42::736     2e-45  29%  876 aa  SYV_MYCTU RecName: Full=Valyl-tRNA synthetase;       
   42::736     2e-45  29%  876 aa  SYV_MYCBO RecName: Full=Valyl-tRNA synthetase;       
   33::856     3e-45  28%  942 aa  SYV_STRMK RecName: Full=Valyl-tRNA synthetase;       
   18::865     4e-45  27%  951 aa  SYV_PSEHT RecName: Full=Valyl-tRNA synthetase;       
    5::642     4e-45  28%  751 aa  SYV_NANEQ RecName: Full=Valyl-tRNA synthetase;       
   18::801     5e-45  26%  968 aa  SYV_RALSO RecName: Full=Valyl-tRNA synthetase;       
  136::887     5e-45  29% 1065 aa  SYVM_RAT RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
   19::707     6e-45  29%  913 aa  SYV_DEIRA RecName: Full=Valyl-tRNA synthetase;       
   45::739     8e-45  25%  837 aa  SYV_MYCGE RecName: Full=Valyl-tRNA synthetase;       
   18::793     1e-44  28%  948 aa  SYV_PSEPK RecName: Full=Valyl-tRNA synthetase;       
   11::762     1e-44  27%  949 aa  SYV_IDILO RecName: Full=Valyl-tRNA synthetase;       
   20::777     2e-44  29%  965 aa  SYV_PHOLL RecName: Full=Valyl-tRNA synthetase;       
   60::230     3e-44  29%  956 aa  SYV_TREPA RecName: Full=Valyl-tRNA synthetase;       
   11::645     3e-44  27%  839 aa  SYV_MYCMO RecName: Full=Valyl-tRNA synthetase;       
   23::777     5e-44  26%  965 aa  SYV_YERPS RecName: Full=Valyl-tRNA synthetase;       
   23::777     5e-44  26%  965 aa  SYV_YERPE RecName: Full=Valyl-tRNA synthetase;       
   18::764     7e-44  27%  953 aa  SYV_VIBCH RecName: Full=Valyl-tRNA synthetase;       
   19::741     1e-43  25%  957 aa  SYV_RHOPA RecName: Full=Valyl-tRNA synthetase;       
   11::817     2e-43  26%  910 aa  SYV_BRUSU RecName: Full=Valyl-tRNA synthetase;       
  151::930     2e-43  27% 1108 aa  SYV_ARATH RecName: Full=Valyl-tRNA synthetase;       
  136::935     2e-43  27% 1063 aa  SYVM_HUMAN RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   22::776     3e-43  27%  955 aa  SYV_BURPS RecName: Full=Valyl-tRNA synthetase;       
   22::776     6e-43  27%  955 aa  SYV_BURMA RecName: Full=Valyl-tRNA synthetase;       
   13::864     6e-43  27%  948 aa  SYV_AZOSE RecName: Full=Valyl-tRNA synthetase;       
   18::857     1e-42  26%  957 aa  SYV_VIBF1 RecName: Full=Valyl-tRNA synthetase;       
   12::761     1e-42  26%  927 aa  SYV_RHILO RecName: Full=Valyl-tRNA synthetase;       
   28::746     1e-42  28%  886 aa  SYV_MYCLE RecName: Full=Valyl-tRNA synthetase;       
   11::817     1e-42  26%  910 aa  SYV_BRUME RecName: Full=Valyl-tRNA synthetase;       
   10::757     2e-42  28%  944 aa  SYV_XANCP RecName: Full=Valyl-tRNA synthetase;       
   10::757     2e-42  28%  944 aa  SYV_XANCB RecName: Full=Valyl-tRNA synthetase;       
   10::757     2e-42  28%  944 aa  SYV_XANC8 RecName: Full=Valyl-tRNA synthetase;       
   12::732     2e-42  27%  811 aa  SYV_SPHEL RecName: Full=Valyl-tRNA synthetase;       
   18::763     2e-42  27%  951 aa  SYV_VIBVY RecName: Full=Valyl-tRNA synthetase;       
   18::763     2e-42  27%  951 aa  SYV_VIBVU RecName: Full=Valyl-tRNA synthetase;       
   13::912     2e-42  27%  998 aa  SYV_AZOSB RecName: Full=Valyl-tRNA synthetase;       
   43::706     4e-42  26%  861 aa  SYV_MYCGA RecName: Full=Valyl-tRNA synthetase;       
    7::1003    4e-42  30% 1165 aa  SYV_AQUAE RecName: Full=Valyl-tRNA synthetase;       
   10::816     5e-42  28%  980 aa  SYV_XANC5 RecName: Full=Valyl-tRNA synthetase;       
   10::193     7e-42  29%  768 aa  SYV_PICTO RecName: Full=Valyl-tRNA synthetase;       
   18::768     9e-42  27%  958 aa  SYV_SHEON RecName: Full=Valyl-tRNA synthetase;       
   16::689     9e-42  25%  832 aa  SYV_MYCS5 RecName: Full=Valyl-tRNA synthetase;       
   18::763     1e-41  28%  952 aa  SYV_VIBPA RecName: Full=Valyl-tRNA synthetase;       
   33::701     2e-41  25%  838 aa  SYV_MYCPN RecName: Full=Valyl-tRNA synthetase;       
  136::936     2e-41  27% 1062 aa  SYVM_PIG RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
   13::734     3e-41  25%  896 aa  SYV_SPHWW RecName: Full=Valyl-tRNA synthetase;       
   18::762     3e-41  27%  951 aa  SYV_ERWCT RecName: Full=Valyl-tRNA synthetase;       
   18::763     4e-41  28%  951 aa  SYV_SHISS RecName: Full=Valyl-tRNA synthetase;       
   18::763     4e-41  28%  951 aa  SYV_SHIFL RecName: Full=Valyl-tRNA synthetase;       
   18::763     4e-41  28%  951 aa  SYV_SHIBS RecName: Full=Valyl-tRNA synthetase;       
   17::854     4e-41  25%  953 aa  SYV_PHOPR RecName: Full=Valyl-tRNA synthetase;       
   18::763     4e-41  28%  951 aa  SYV_ECOL6 RecName: Full=Valyl-tRNA synthetase;       
   18::763     4e-41  28%  951 aa  SYV_ECO57 RecName: Full=Valyl-tRNA synthetase;       
   18::763     6e-41  28%  951 aa  SYV_ECOLI RecName: Full=Valyl-tRNA synthetase;       
   36::818     9e-41  27%  870 aa  SYV_PROAC RecName: Full=Valyl-tRNA synthetase;       
   39::740     9e-41  27%  929 aa  SYV_NITOC RecName: Full=Valyl-tRNA synthetase;       
   21::660     9e-41  26%  875 aa  SYV_BORGA RecName: Full=Valyl-tRNA synthetase;       
   18::763     1e-40  28%  951 aa  SYV_SALTY RecName: Full=Valyl-tRNA synthetase;       
   18::763     1e-40  28%  951 aa  SYV_SALTI RecName: Full=Valyl-tRNA synthetase;       
   18::763     2e-40  28%  951 aa  SYV_SALPA RecName: Full=Valyl-tRNA synthetase;       
   18::763     2e-40  27%  951 aa  SYV_SHIDS RecName: Full=Valyl-tRNA synthetase;       
   18::763     2e-40  28%  951 aa  SYV_SALCH RecName: Full=Valyl-tRNA synthetase;       
    9::634     3e-40  25%  827 aa  SYV_MYCPU RecName: Full=Valyl-tRNA synthetase;       
    5::763     4e-40  27%  955 aa  SYV_BUCAI RecName: Full=Valyl-tRNA synthetase;       
   42::804     8e-40  28%  860 aa  SYV_SALTO RecName: Full=Valyl-tRNA synthetase;       
   11::665     8e-40  26%  822 aa  SYV_MYCHJ RecName: Full=Valyl-tRNA synthetase;       
   11::665     8e-40  26%  822 aa  SYV_MYCH7 RecName: Full=Valyl-tRNA synthetase;       
   10::816     1e-39  28%  980 aa  SYV_XANOR RecName: Full=Valyl-tRNA synthetase;       
   10::816     1e-39  28%  980 aa  SYV_XANOP RecName: Full=Valyl-tRNA synthetase;       
   10::816     2e-39  28%  980 aa  SYV_XANOM RecName: Full=Valyl-tRNA synthetase;       
   11::665     2e-39  26%  822 aa  SYV_MYCH2 RecName: Full=Valyl-tRNA synthetase;       
    4::825     2e-39  27%  827 aa  SYL_PELTS RecName: Full=Leucyl-tRNA synthetase;       
   18::752     4e-39  30%  824 aa  SYL_GEOSL RecName: Full=Leucyl-tRNA synthetase;       
   16::770     4e-39  31%  834 aa  SYL_DESVM RecName: Full=Leucyl-tRNA synthetase;       
   10::753     5e-39  28%  824 aa  SYL_ALKMQ RecName: Full=Leucyl-tRNA synthetase;       
   15::660     9e-39  25%  875 aa  SYV_BORBU RecName: Full=Valyl-tRNA synthetase;       
   60::854     9e-39  25% 1064 aa  SYVM_DICDI RecName: Full=Probable valyl-tRNA synthetase,
   18::787     2e-38  32%  824 aa  SYL_GEOMG RecName: Full=Leucyl-tRNA synthetase;       
   18::808     4e-38  27%  862 aa  SYV_SALAI RecName: Full=Valyl-tRNA synthetase;       
   66::757     7e-38  24%  950 aa  SYVM_SCHPO RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
  136::867     1e-37  27% 1064 aa  SYVM_MACMU RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    4::755     2e-37  30%  829 aa  SYL_MOOTA RecName: Full=Leucyl-tRNA synthetase;       
   11::791     2e-37  29%  821 aa  SYL_CARHZ RecName: Full=Leucyl-tRNA synthetase;       
   15::607     2e-37  34%  829 aa  SYL_DESVV RecName: Full=Leucyl-tRNA synthetase;       
   15::607     3e-37  34%  829 aa  SYL_DESVH RecName: Full=Leucyl-tRNA synthetase;       
   14::806     4e-37  28%  994 aa  SYV_XYLFT RecName: Full=Valyl-tRNA synthetase;       
   14::806     4e-37  28%  994 aa  SYV_XYLF2 RecName: Full=Valyl-tRNA synthetase;       
    1::743     8e-37  28%  829 aa  SYL_DESDG RecName: Full=Leucyl-tRNA synthetase;       
   14::834     1e-36  28%  994 aa  SYV_XYLFA RecName: Full=Valyl-tRNA synthetase;       
   28::230     4e-36  29%  870 aa  SYV_CAMJE RecName: Full=Valyl-tRNA synthetase;       
   14::831     9e-36  27%  991 aa  SYV_XYLFM RecName: Full=Valyl-tRNA synthetase;       
   24::758     2e-35  28%  825 aa  SYL_CLOTH RecName: Full=Leucyl-tRNA synthetase;       
   13::612     1e-34  27%  931 aa  SYV_SPHAL RecName: Full=Valyl-tRNA synthetase;       
   15::648     3e-34  31%  827 aa  SYL_DESPS RecName: Full=Leucyl-tRNA synthetase;       
    8::803     5e-34  28%  987 aa  SYV_RHOS4 RecName: Full=Valyl-tRNA synthetase;       
   15::689     9e-34  29%  812 aa  SYL_CLOAB RecName: Full=Leucyl-tRNA synthetase;       
    1::652     1e-33  29%  823 aa  SYL_THEM4 RecName: Full=Leucyl-tRNA synthetase;       
   10::754     1e-33  26%  826 aa  SYL_NATTJ RecName: Full=Leucyl-tRNA synthetase;       
    8::803     1e-33  28%  987 aa  SYV_RHOSK RecName: Full=Valyl-tRNA synthetase;       
    5::788     1e-33  28%  861 aa  SYL_SYMTH RecName: Full=Leucyl-tRNA synthetase;       
   15::741     1e-33  27%  812 aa  SYL_CLONN RecName: Full=Leucyl-tRNA synthetase;       
    8::803     4e-33  28%  987 aa  SYV_RHOS1 RecName: Full=Valyl-tRNA synthetase;       
    9::761     7e-33  28%  827 aa  SYL_DESHY RecName: Full=Leucyl-tRNA synthetase;       
    9::761     7e-33  28%  827 aa  SYL_DESHD RecName: Full=Leucyl-tRNA synthetase;       
   37::631     7e-33  30%  843 aa  SYL_ARTS2 RecName: Full=Leucyl-tRNA synthetase;       
   11::752     2e-32  29%  824 aa  SYL_GEOSM RecName: Full=Leucyl-tRNA synthetase;       
   13::648     4e-32  31%  824 aa  SYL_GEOBB RecName: Full=Leucyl-tRNA synthetase;       
   11::777     4e-32  27%  863 aa  SYL_DESAA RecName: Full=Leucyl-tRNA synthetase;       
   13::764     5e-32  26%  835 aa  SYL_LAWIP RecName: Full=Leucyl-tRNA synthetase;       
   11::762     6e-32  26%  960 aa  SYV_BUCAP RecName: Full=Valyl-tRNA synthetase;       
   11::752     6e-32  31%  823 aa  SYL_PELPD RecName: Full=Leucyl-tRNA synthetase;       
    4::777     1e-31  29%  863 aa  SYL_DESAH RecName: Full=Leucyl-tRNA synthetase;       
   18::748     2e-31  28%  819 aa  SYL_THETN RecName: Full=Leucyl-tRNA synthetase;       
    6::826     2e-31  26%  828 aa  SYL_PETMO RecName: Full=Leucyl-tRNA synthetase;       
    2::638     2e-31  30%  813 aa  SYL_DEHE1 RecName: Full=Leucyl-tRNA synthetase;       
  110::344     4e-31  28%  980 aa  SYV_SCHPO RecName: Full=Valyl-tRNA synthetase;       
   26::839     5e-31  29%  877 aa  SYL_THICR RecName: Full=Leucyl-tRNA synthetase;       
   11::779     5e-31  29%  851 aa  SYL_PELCD RecName: Full=Leucyl-tRNA synthetase;       
    1::746     9e-31  28%  815 aa  SYL_THELT RecName: Full=Leucyl-tRNA synthetase;       
   19::662     9e-31  30%  862 aa  SYL_RENSM RecName: Full=Leucyl-tRNA synthetase;       
    6::758     9e-31  27%  830 aa  SYL_HALOH RecName: Full=Leucyl-tRNA synthetase;       
   41::738     2e-30  28%  824 aa  SYL_THEP1 RecName: Full=Leucyl-tRNA synthetase;       
   11::753     2e-30  28%  824 aa  SYL_SYNWW RecName: Full=Leucyl-tRNA synthetase;       
   46::789     1e-29  25%  957 aa  SYV_BLOPB RecName: Full=Valyl-tRNA synthetase;       
   41::738     1e-29  28%  824 aa  SYL_THEMA RecName: Full=Leucyl-tRNA synthetase;       
   38::774     1e-29  28%  842 aa  SYL_ARTAT RecName: Full=Leucyl-tRNA synthetase;       
    8::794     1e-29  26%  819 aa  SYL_FERNB RecName: Full=Leucyl-tRNA synthetase;       
    6::818     5e-29  28%  943 aa  SYL_METKA RecName: Full=Leucyl-tRNA synthetase;       
   15::745     1e-28  28%  816 aa  SYL_CLOPS RecName: Full=Leucyl-tRNA synthetase;       
    5::745     1e-28  28%  817 aa  SYL_RUBXD RecName: Full=Leucyl-tRNA synthetase;       
   18::724     2e-28  29%  810 aa  SYL_SOLUE RecName: Full=Leucyl-tRNA synthetase;       
   15::745     2e-28  28%  816 aa  SYL_CLOP1 RecName: Full=Leucyl-tRNA synthetase;       
   18::787     2e-28  28%  857 aa  SYL_SYNPX RecName: Full=Leucyl-tRNA synthetase;       
   15::745     2e-28  28%  816 aa  SYL_CLOPE RecName: Full=Leucyl-tRNA synthetase;       
    4::844     2e-28  28%  851 aa  SYL_CLAM3 RecName: Full=Leucyl-tRNA synthetase;       
    1::645     2e-28  29%  817 aa  SYL_CALS8 RecName: Full=Leucyl-tRNA synthetase;       
   42::747     3e-28  31%  817 aa  SYL_HALHL RecName: Full=Leucyl-tRNA synthetase;       
   42::760     4e-28  27%  846 aa  SYL_HELMI RecName: Full=Leucyl-tRNA synthetase;       
   23::777     7e-28  25%  966 aa  SYV_BLOFL RecName: Full=Valyl-tRNA synthetase;       
    4::469     7e-28  31%  852 aa  SYL_CLAMS RecName: Full=Leucyl-tRNA synthetase;       
   46::252     9e-28  30%  856 aa  SYV_TROWT RecName: Full=Valyl-tRNA synthetase;       
    5::816     9e-28  28%  876 aa  SYL_RHIME RecName: Full=Leucyl-tRNA synthetase;       
    1::667     9e-28  29%  853 aa  SYL_BRAHW RecName: Full=Leucyl-tRNA synthetase;       
   20::618     1e-27  32%  830 aa  SYL_THEFY RecName: Full=Leucyl-tRNA synthetase;       
   22::664     2e-27  31%  816 aa  SYL_XANCP RecName: Full=Leucyl-tRNA synthetase;       
   22::664     2e-27  31%  885 aa  SYL_XANCB RecName: Full=Leucyl-tRNA synthetase;       
   22::664     2e-27  31%  879 aa  SYL_XANC8 RecName: Full=Leucyl-tRNA synthetase;       
    2::739     2e-27  29%  819 aa  SYL_WOLSU RecName: Full=Leucyl-tRNA synthetase;       
    1::650     2e-27  30%  846 aa  SYL_ZYMMO RecName: Full=Leucyl-tRNA synthetase;       
   46::252     3e-27  29%  856 aa  SYV_TROW8 RecName: Full=Valyl-tRNA synthetase;       
    4::781     5e-27  29%  847 aa  SYL_GLOVI RecName: Full=Leucyl-tRNA synthetase;       
    5::796     6e-27  28%  882 aa  SYL_RHOPB RecName: Full=Leucyl-tRNA synthetase;       
   51::715     6e-27  30%  919 aa  SYL_PSYCK RecName: Full=Leucyl-tRNA synthetase;       
   48::712     6e-27  29%  921 aa  SYL_PSYA2 RecName: Full=Leucyl-tRNA synthetase;       
    8::775     6e-27  29%  844 aa  SYL_PARDP RecName: Full=Leucyl-tRNA synthetase;       
   36::819     6e-27  26%  944 aa  SYL2_SULTO RecName: Full=Leucyl-tRNA synthetase 2;       
   11::877     6e-27  24%  944 aa  SYL2_SULSO RecName: Full=Leucyl-tRNA synthetase 2;       
   40::732     1e-26  29%  805 aa  SYL_LACS1 RecName: Full=Leucyl-tRNA synthetase;       
   19::797     1e-26  25%  950 aa  SYL2_METS5 RecName: Full=Leucyl-tRNA synthetase 2;       
    5::631     2e-26  27%  813 aa  SYL_FRATM RecName: Full=Leucyl-tRNA synthetase;       
    5::606     2e-26  28%  802 aa  SYL_ALKOO RecName: Full=Leucyl-tRNA synthetase;       
    4::811     2e-26  28%  882 aa  SYL_SYNJB RecName: Full=Leucyl-tRNA synthetase;       
    5::631     2e-26  27%  813 aa  SYL_FRATO RecName: Full=Leucyl-tRNA synthetase;       
    5::631     2e-26  27%  813 aa  SYL_FRATH RecName: Full=Leucyl-tRNA synthetase;       
    5::631     2e-26  27%  813 aa  SYL_FRATF RecName: Full=Leucyl-tRNA synthetase;       
   16::690     2e-26  28%  874 aa  SYL_ACIBY RecName: Full=Leucyl-tRNA synthetase;       
   16::690     2e-26  28%  874 aa  SYL_ACIBC RecName: Full=Leucyl-tRNA synthetase;       
   16::690     2e-26  28%  874 aa  SYL_ACIB5 RecName: Full=Leucyl-tRNA synthetase;       
   16::690     2e-26  28%  874 aa  SYL_ACIB3 RecName: Full=Leucyl-tRNA synthetase;       
   17::776     2e-26  24%  945 aa  SYL1_SULTO RecName: Full=Leucyl-tRNA synthetase 1;       
   15::794     2e-26  24%  942 aa  SYL1_SULAC RecName: Full=Leucyl-tRNA synthetase 1;       
   37::489     3e-26  29%  489 aa  SYV_TRIVA RecName: Full=Valyl-tRNA synthetase;       
    7::603     3e-26  28%  817 aa  SYL_THISH RecName: Full=Leucyl-tRNA synthetase;       
    9::628     3e-26  28%  819 aa  SYL_SACD2 RecName: Full=Leucyl-tRNA synthetase;       
   42::814     3e-26  27%  819 aa  SYL_NITOC RecName: Full=Leucyl-tRNA synthetase;       
   27::858     3e-26  27%  866 aa  SYL_LEIXX RecName: Full=Leucyl-tRNA synthetase;       
   16::690     3e-26  28%  874 aa  SYL_ACIBS RecName: Full=Leucyl-tRNA synthetase;       
   10::787     3e-26  24%  942 aa  SYL2_SULAC RecName: Full=Leucyl-tRNA synthetase 2;       
    6::783     4e-26  25%  962 aa  SYL_METBU RecName: Full=Leucyl-tRNA synthetase;       
   18::628     4e-26  29%  815 aa  SYL_MARMS RecName: Full=Leucyl-tRNA synthetase;       
   11::753     4e-26  29%  819 aa  SYL_DEIGD RecName: Full=Leucyl-tRNA synthetase;       
    5::805     4e-26  28%  874 aa  SYL_AZOC5 RecName: Full=Leucyl-tRNA synthetase;       
   11::791     5e-26  28%  862 aa  SYL_VIBHB RecName: Full=Leucyl-tRNA synthetase;       
    5::631     5e-26  28%  813 aa  SYL_FRAP2 RecName: Full=Leucyl-tRNA synthetase;       
    5::789     5e-26  30%  874 aa  SYL_BRASB RecName: Full=Leucyl-tRNA synthetase;       
    6::524     5e-26  31%  634 aa  SYLA_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit alpha;     
   22::664     7e-26  30%  880 aa  SYL_XANOR RecName: Full=Leucyl-tRNA synthetase;       
    5::631     9e-26  28%  813 aa  SYL_FRATW RecName: Full=Leucyl-tRNA synthetase;       
    5::631     9e-26  28%  813 aa  SYL_FRATT RecName: Full=Leucyl-tRNA synthetase;       
    5::631     9e-26  28%  813 aa  SYL_FRAT1 RecName: Full=Leucyl-tRNA synthetase;       
    6::730     1e-25  26%  816 aa  SYL_RUTMC RecName: Full=Leucyl-tRNA synthetase;       
    5::875     1e-25  26%  876 aa  SYL_AGRT5 RecName: Full=Leucyl-tRNA synthetase;       
   22::664     2e-25  30%  880 aa  SYL_XANOP RecName: Full=Leucyl-tRNA synthetase;       
    4::786     2e-25  26%  857 aa  SYL_VIBVU RecName: Full=Leucyl-tRNA synthetase;       
    5::815     2e-25  28%  875 aa  SYL_RHILO RecName: Full=Leucyl-tRNA synthetase;       
   24::459     2e-25  30%  872 aa  SYL_PROM4 RecName: Full=Leucyl-tRNA synthetase;       
    5::813     2e-25  27%  883 aa  SYL_NITWN RecName: Full=Leucyl-tRNA synthetase;       
   46::664     2e-25  31%  880 aa  SYL_XANOM RecName: Full=Leucyl-tRNA synthetase;       
    4::786     4e-25  27%  857 aa  SYL_VIBVY RecName: Full=Leucyl-tRNA synthetase;       
    4::786     4e-25  27%  857 aa  SYL_VIBPA RecName: Full=Leucyl-tRNA synthetase;       
   16::879     4e-25  29%  890 aa  SYL_POLSQ RecName: Full=Leucyl-tRNA synthetase;       
    4::834     4e-25  25%  937 aa  SYL_METTH RecName: Full=Leucyl-tRNA synthetase;       
    5::804     4e-25  27%  806 aa  SYL_CLOD6 RecName: Full=Leucyl-tRNA synthetase;       
   42::808     4e-25  29%  873 aa  SYL_AZOSE RecName: Full=Leucyl-tRNA synthetase;       
   22::664     6e-25  29%  880 aa  SYL_XANAC RecName: Full=Leucyl-tRNA synthetase;       
   12::859     6e-25  24%  967 aa  SYL_THEON RecName: Full=Leucyl-tRNA synthetase;       
   38::819     6e-25  30%  884 aa  SYL_SYNS9 RecName: Full=Leucyl-tRNA synthetase;       
    8::781     7e-25  28%  848 aa  SYL_ROSDO RecName: Full=Leucyl-tRNA synthetase;       
   48::623     9e-25  29%  830 aa  SYL_HELHP RecName: Full=Leucyl-tRNA synthetase;       
   58::623     9e-25  30%  832 aa  SYL_ACIC1 RecName: Full=Leucyl-tRNA synthetase;       
    9::703     1e-24  29%  858 aa  SYL_TREDE RecName: Full=Leucyl-tRNA synthetase;       
    5::790     1e-24  27%  876 aa  SYL_SINMW RecName: Full=Leucyl-tRNA synthetase;       
    5::631     1e-24  27%  813 aa  SYL_FRATN RecName: Full=Leucyl-tRNA synthetase;       
    5::790     1e-24  28%  876 aa  SYL_AGRVS RecName: Full=Leucyl-tRNA synthetase;       
    5::821     2e-24  24%  967 aa  SYL_PYRFU RecName: Full=Leucyl-tRNA synthetase;       
   20::676     2e-24  30%  885 aa  SYL_PSYWF RecName: Full=Leucyl-tRNA synthetase;       
   23::797     2e-24  22%  955 aa  SYL_METM5 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-24  29%  805 aa  SYL_GEOTN RecName: Full=Leucyl-tRNA synthetase;       
   22::664     2e-24  29%  880 aa  SYL_XANC5 RecName: Full=Leucyl-tRNA synthetase;       
   13::642     2e-24  30%  853 aa  SYL_CYAA5 RecName: Full=Leucyl-tRNA synthetase;       
   18::802     3e-24  29%  868 aa  SYL_PSEPG RecName: Full=Leucyl-tRNA synthetase;       
   42::802     3e-24  30%  868 aa  SYL_PSEE4 RecName: Full=Leucyl-tRNA synthetase;       
    5::808     3e-24  27%  878 aa  SYL_NITHX RecName: Full=Leucyl-tRNA synthetase;       
   18::782     4e-24  28%  868 aa  SYL_PSEPW RecName: Full=Leucyl-tRNA synthetase;       
    4::801     4e-24  28%  870 aa  SYL_PARL1 RecName: Full=Leucyl-tRNA synthetase;       
   40::719     4e-24  28%  809 aa  SYL_CAMLR RecName: Full=Leucyl-tRNA synthetase;       
    7::602     4e-24  29%  806 aa  SYL_BACHD RecName: Full=Leucyl-tRNA synthetase;       
    2::606     5e-24  30%  809 aa  SYL_CAMJD RecName: Full=Leucyl-tRNA synthetase;       
    5::684     5e-24  31%  874 aa  SYL_BRASO RecName: Full=Leucyl-tRNA synthetase;       
   18::802     6e-24  29%  868 aa  SYL_PSEPK RecName: Full=Leucyl-tRNA synthetase;       
   18::802     6e-24  29%  868 aa  SYL_PSEP1 RecName: Full=Leucyl-tRNA synthetase;       
    9::771     6e-24  29%  838 aa  SYL1_RHIL3 RecName: Full=Leucyl-tRNA synthetase 1;       
    2::742     8e-24  28%  814 aa  SYL_HERA2 RecName: Full=Leucyl-tRNA synthetase;       
    9::733     8e-24  28%  805 aa  SYL_BREBN RecName: Full=Leucyl-tRNA synthetase;       
    5::807     1e-23  24%  967 aa  SYL_PYRKO RecName: Full=Leucyl-tRNA synthetase;       
   26::657     1e-23  30%  878 aa  SYL_PROM3 RecName: Full=Leucyl-tRNA synthetase;       
    5::809     1e-23  29%  879 aa  SYL_OLICO RecName: Full=Leucyl-tRNA synthetase;       
   16::672     1e-23  27%  816 aa  SYL_CLOB8 RecName: Full=Leucyl-tRNA synthetase;       
   41::843     1e-23  29%  847 aa  SYL_RHOSK RecName: Full=Leucyl-tRNA synthetase;       
   19::864     1e-23  22%  955 aa  SYL_METMP RecName: Full=Leucyl-tRNA synthetase;       
    9::795     2e-23  31%  863 aa  SYL_SALRD RecName: Full=Leucyl-tRNA synthetase;       
    5::816     2e-23  27%  876 aa  SYL_RHISN RecName: Full=Leucyl-tRNA synthetase;       
    1::601     2e-23  30%  803 aa  SYL_LISMF RecName: Full=Leucyl-tRNA synthetase;       
    1::601     2e-23  30%  803 aa  SYL_LISMC RecName: Full=Leucyl-tRNA synthetase;       
   44::616     2e-23  29%  821 aa  SYL_CAMC5 RecName: Full=Leucyl-tRNA synthetase;       
   18::899     2e-23  26%  945 aa  SYL_PYRAR RecName: Full=Leucyl-tRNA synthetase;       
    1::601     3e-23  30%  803 aa  SYL_LISMO RecName: Full=Leucyl-tRNA synthetase;       
    1::601     3e-23  30%  803 aa  SYL_LISMH RecName: Full=Leucyl-tRNA synthetase;       
    8::616     3e-23  29%  821 aa  SYL_CAMC1 RecName: Full=Leucyl-tRNA synthetase;       
   12::766     4e-23  28%  852 aa  SYL_SYNP2 RecName: Full=Leucyl-tRNA synthetase;       
   11::641     5e-23  29%  929 aa  SYL_TRIEI RecName: Full=Leucyl-tRNA synthetase;       
   18::796     5e-23  29%  868 aa  SYL_PSESM RecName: Full=Leucyl-tRNA synthetase;       
    5::809     5e-23  26%  871 aa  SYL_MESSB RecName: Full=Leucyl-tRNA synthetase;       
    9::740     5e-23  27%  827 aa  SYL_DESRM RecName: Full=Leucyl-tRNA synthetase;       
   11::655     5e-23  29%  804 aa  SYL_BACP2 RecName: Full=Leucyl-tRNA synthetase;       
    6::637     7e-23  27%  865 aa  SYL_WOLTR RecName: Full=Leucyl-tRNA synthetase;       
    5::807     7e-23  22%  967 aa  SYL_PYRAB RecName: Full=Leucyl-tRNA synthetase;       
   23::797     7e-23  22%  955 aa  SYL_METM7 RecName: Full=Leucyl-tRNA synthetase;       
   16::725     7e-23  28%  806 aa  SYL_LACRJ RecName: Full=Leucyl-tRNA synthetase;       
   16::725     7e-23  28%  806 aa  SYL_LACRD RecName: Full=Leucyl-tRNA synthetase;       
   13::644     7e-23  29%  856 aa  SYL_CYAP8 RecName: Full=Leucyl-tRNA synthetase;       
    9::439     9e-23  29%  826 aa  SYL_DESAP RecName: Full=Leucyl-tRNA synthetase;       
   11::790     9e-23  27%  858 aa  SYL_CYAP4 RecName: Full=Leucyl-tRNA synthetase;       
   16::613     9e-23  28%  821 aa  SYL_ARCB4 RecName: Full=Leucyl-tRNA synthetase;       
   25::794     1e-22  29%  867 aa  SYL_SYNS3 RecName: Full=Leucyl-tRNA synthetase;       
   12::750     1e-22  27%  835 aa  SYL_RICAE RecName: Full=Leucyl-tRNA synthetase;       
    6::651     1e-22  29%  862 aa  SYL_RHORT RecName: Full=Leucyl-tRNA synthetase;       
    1::601     1e-22  29%  803 aa  SYL_LISW6 RecName: Full=Leucyl-tRNA synthetase;       
    1::601     1e-22  29%  803 aa  SYL_LISIN RecName: Full=Leucyl-tRNA synthetase;       
    3::802     1e-22  28%  861 aa  SYL_CAUCR RecName: Full=Leucyl-tRNA synthetase;       
    3::802     1e-22  28%  861 aa  SYL_CAUCN RecName: Full=Leucyl-tRNA synthetase;       
   18::699     1e-22  28%  815 aa  SYL_ALCBS RecName: Full=Leucyl-tRNA synthetase;       
    5::822     2e-22  23%  967 aa  SYL_PYRHO RecName: Full=Leucyl-tRNA synthetase;       
   19::819     2e-22  27%  877 aa  SYL_OCHA4 RecName: Full=Leucyl-tRNA synthetase;       
   19::819     2e-22  27%  877 aa  SYL_BRUA2 RecName: Full=Leucyl-tRNA synthetase;       
   19::819     2e-22  27%  877 aa  SYL_BRUA1 RecName: Full=Leucyl-tRNA synthetase;       
    8::733     2e-22  29%  804 aa  SYL_LACJO RecName: Full=Leucyl-tRNA synthetase;       
    6::665     3e-22  27%  838 aa  SYL_WOLPM RecName: Full=Leucyl-tRNA synthetase;       
   44::649     3e-22  30%  849 aa  SYL_SPHAL RecName: Full=Leucyl-tRNA synthetase;       
   19::819     3e-22  27%  877 aa  SYL_BRUSU RecName: Full=Leucyl-tRNA synthetase;       
   19::819     3e-22  27%  877 aa  SYL_BRUAB RecName: Full=Leucyl-tRNA synthetase;       
   12::750     3e-22  27%  835 aa  SYL_RICCN RecName: Full=Leucyl-tRNA synthetase;       
   15::737     3e-22  29%  804 aa  SYL_LACAC RecName: Full=Leucyl-tRNA synthetase;       
   18::787     3e-22  30%  824 aa  SYL_GEOUR RecName: Full=Leucyl-tRNA synthetase;       
   10::767     4e-22  28%  804 aa  SYL_LACH4 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     4e-22  29%  804 aa  SYL_ENTFA RecName: Full=Leucyl-tRNA synthetase;       
    6::676     4e-22  29%  864 aa  SYL_CELJU RecName: Full=Leucyl-tRNA synthetase;       
    1::690     4e-22  27%  873 aa  SYL_ACIAD RecName: Full=Leucyl-tRNA synthetase;       
   42::649     6e-22  30%  869 aa  SYL_SYNY3 RecName: Full=Leucyl-tRNA synthetase;       
    7::761     6e-22  30%  829 aa  SYL_SYNFM RecName: Full=Leucyl-tRNA synthetase;       
   17::545     6e-22  28%  857 aa  SYL_SILST RecName: Full=Leucyl-tRNA synthetase;       
   12::750     6e-22  27%  835 aa  SYL_RICPU RecName: Full=Leucyl-tRNA synthetase;       
    9::735     6e-22  26%  807 aa  SYL_LACSS RecName: Full=Leucyl-tRNA synthetase;       
   19::819     6e-22  27%  877 aa  SYL_BRUSI RecName: Full=Leucyl-tRNA synthetase;       
   19::819     6e-22  27%  877 aa  SYL_BRUO2 RecName: Full=Leucyl-tRNA synthetase;       
   19::819     6e-22  27%  877 aa  SYL_BRUME RecName: Full=Leucyl-tRNA synthetase;       
   19::819     6e-22  27%  877 aa  SYL_BRUMB RecName: Full=Leucyl-tRNA synthetase;       
   16::799     8e-22  27%  804 aa  SYL_OCEIH RecName: Full=Leucyl-tRNA synthetase;       
    7::731     8e-22  26%  803 aa  SYL_LACCB RecName: Full=Leucyl-tRNA synthetase;       
    7::731     8e-22  26%  803 aa  SYL_LACC3 RecName: Full=Leucyl-tRNA synthetase;       
    6::646     8e-22  30%  860 aa  SYL_ACTSZ RecName: Full=Leucyl-tRNA synthetase;       
   54::563     8e-22  29%  940 aa  SYLM_DICDI RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    6::856     1e-21  27%  861 aa  SYL_MARAV RecName: Full=Leucyl-tRNA synthetase;       
    5::875     1e-21  26%  876 aa  SYL_RHIEC RecName: Full=Leucyl-tRNA synthetase;       
    6::786     2e-21  32%  858 aa  SYL_VIBSL RecName: Full=Leucyl-tRNA synthetase;       
   14::649     2e-21  28%  864 aa  SYL_SYNR3 RecName: Full=Leucyl-tRNA synthetase;       
    9::797     2e-21  28%  863 aa  SYL_SHESH RecName: Full=Leucyl-tRNA synthetase;       
    9::797     2e-21  29%  863 aa  SYL_SHELP RecName: Full=Leucyl-tRNA synthetase;       
   18::787     2e-21  25%  945 aa  SYL_PYRIL RecName: Full=Leucyl-tRNA synthetase;       
   10::796     2e-21  28%  863 aa  SYL_JANSC RecName: Full=Leucyl-tRNA synthetase;       
    3::652     2e-21  29%  861 aa  SYL_CAUSK RecName: Full=Leucyl-tRNA synthetase;       
   42::597     2e-21  28%  796 aa  SYL_BDEBA RecName: Full=Leucyl-tRNA synthetase;       
    1::768     2e-21  29%  805 aa  SYL_ANOFW RecName: Full=Leucyl-tRNA synthetase;       
   18::751     2e-21  25%  945 aa  SYL_THENV RecName: Full=Leucyl-tRNA synthetase;       
   26::792     2e-21  27%  878 aa  SYL_PROMM RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-21  29%  802 aa  SYL_BACWK RecName: Full=Leucyl-tRNA synthetase;       
   18::638     3e-21  25%  815 aa  SYL_VESOH RecName: Full=Leucyl-tRNA synthetase;       
    4::617     4e-21  29%  822 aa  SYL_SULDN RecName: Full=Leucyl-tRNA synthetase;       
    9::733     4e-21  27%  804 aa  SYL_MYCCT RecName: Full=Leucyl-tRNA synthetase;       
    2::638     4e-21  30%  813 aa  SYL_DEHSC RecName: Full=Leucyl-tRNA synthetase;       
    2::638     4e-21  30%  813 aa  SYL_DEHSB RecName: Full=Leucyl-tRNA synthetase;       
    4::640     4e-21  29%  855 aa  SYL_ACAM1 RecName: Full=Leucyl-tRNA synthetase;       
    5::227     5e-21  29%  911 aa  SYV_BIFLO RecName: Full=Valyl-tRNA synthetase;       
   60::864     5e-21  27%  875 aa  SYL_SYNSC RecName: Full=Leucyl-tRNA synthetase;       
   10::793     5e-21  25%  950 aa  SYL_METTP RecName: Full=Leucyl-tRNA synthetase;       
    5::227     6e-21  29%  911 aa  SYV_BIFLI RecName: Full=Valyl-tRNA synthetase;       
    9::645     6e-21  28%  859 aa  SYL_SHEPA RecName: Full=Leucyl-tRNA synthetase;       
   12::750     6e-21  27%  835 aa  SYL_RICRS RecName: Full=Leucyl-tRNA synthetase;       
   12::750     6e-21  27%  835 aa  SYL_RICRO RecName: Full=Leucyl-tRNA synthetase;       
   17::731     6e-21  25%  945 aa  SYL_PYRAE RecName: Full=Leucyl-tRNA synthetase;       
   40::735     6e-21  26%  803 aa  SYL_LEUCK RecName: Full=Leucyl-tRNA synthetase;       
    3::652     8e-21  28%  852 aa  SYL_SILPO RecName: Full=Leucyl-tRNA synthetase;       
    4::645     8e-21  34%  858 aa  SYL_PHOPR RecName: Full=Leucyl-tRNA synthetase;       
    9::638     8e-21  29%  815 aa  SYL_NITSB RecName: Full=Leucyl-tRNA synthetase;       
    8::407     8e-21  29%  859 aa  SYL_FUSNN RecName: Full=Leucyl-tRNA synthetase;       
   50::773     8e-21  29%  864 aa  SYL_ACICJ RecName: Full=Leucyl-tRNA synthetase;       
    6::645     1e-20  32%  858 aa  SYL_VIBFM RecName: Full=Leucyl-tRNA synthetase;       
   18::406     1e-20  31%  859 aa  SYL_SHESR RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-20  29%  805 aa  SYL_CHLT3 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-20  30%  802 aa  SYL_BACCN RecName: Full=Leucyl-tRNA synthetase;       
    5::227     1e-20  29%  911 aa  SYV_BIFLD RecName: Full=Valyl-tRNA synthetase;       
    1::733     1e-20  27%  805 aa  SYL_PEDPA RecName: Full=Leucyl-tRNA synthetase;       
   11::752     1e-20  30%  824 aa  SYL_GEOSF RecName: Full=Leucyl-tRNA synthetase;       
   20::472     1e-20  32%  869 aa  SYL_DINSH RecName: Full=Leucyl-tRNA synthetase;       
    6::645     2e-20  32%  858 aa  SYL_VIBF1 RecName: Full=Leucyl-tRNA synthetase;       
   18::406     2e-20  31%  859 aa  SYL_SHESA RecName: Full=Leucyl-tRNA synthetase;       
   21::746     2e-20  25%  831 aa  SYL_RICBR RecName: Full=Leucyl-tRNA synthetase;       
    2::450     2e-20  29%  848 aa  SYL_NOVAD RecName: Full=Leucyl-tRNA synthetase;       
    9::839     2e-20  28%  869 aa  SYL_NITEU RecName: Full=Leucyl-tRNA synthetase;       
    5::807     2e-20  27%  876 aa  SYL_METSB RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-20  29%  802 aa  SYL_BACCQ RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-20  29%  802 aa  SYL_BACC7 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-20  29%  802 aa  SYL_BACC1 RecName: Full=Leucyl-tRNA synthetase;       
   18::796     2e-20  29%  868 aa  SYL_PSEU2 RecName: Full=Leucyl-tRNA synthetase;       
   42::804     2e-20  28%  870 aa  SYL_PSEMY RecName: Full=Leucyl-tRNA synthetase;       
    9::659     2e-20  28%  873 aa  SYL_PSEAE RecName: Full=Leucyl-tRNA synthetase;       
    9::659     2e-20  28%  873 aa  SYL_PSEAB RecName: Full=Leucyl-tRNA synthetase;       
    9::659     2e-20  28%  873 aa  SYL_PSEA8 RecName: Full=Leucyl-tRNA synthetase;       
    7::600     2e-20  30%  804 aa  SYL_BACSK RecName: Full=Leucyl-tRNA synthetase;       
    9::793     3e-20  27%  859 aa  SYL_SHEWM RecName: Full=Leucyl-tRNA synthetase;       
   41::843     3e-20  27%  847 aa  SYL_RHOS4 RecName: Full=Leucyl-tRNA synthetase;       
    9::724     3e-20  26%  805 aa  SYL_LACF3 RecName: Full=Leucyl-tRNA synthetase;       
   13::673     3e-20  29%  886 aa  SYL_BART1 RecName: Full=Leucyl-tRNA synthetase;       
    5::662     3e-20  28%  875 aa  SYL_BARBK RecName: Full=Leucyl-tRNA synthetase;       
    5::404     4e-20  29%  833 aa  SYL_STRPN RecName: Full=Leucyl-tRNA synthetase;       
    5::404     4e-20  29%  833 aa  SYL_STRP4 RecName: Full=Leucyl-tRNA synthetase;       
   30::653     4e-20  28%  870 aa  SYL_PROMA RecName: Full=Leucyl-tRNA synthetase;       
    2::682     4e-20  26%  838 aa  SYL_ORITB RecName: Full=Leucyl-tRNA synthetase;       
   42::651     4e-20  31%  866 aa  SYL_NITMU RecName: Full=Leucyl-tRNA synthetase;       
   16::750     4e-20  26%  819 aa  SYL_CHLTR RecName: Full=Leucyl-tRNA synthetase;       
    5::404     5e-20  29%  833 aa  SYL_STRPI RecName: Full=Leucyl-tRNA synthetase;       
    1::602     5e-20  29%  802 aa  SYL_BACCR RecName: Full=Leucyl-tRNA synthetase;       
    1::602     5e-20  29%  802 aa  SYL_BACC4 RecName: Full=Leucyl-tRNA synthetase;       
    6::645     5e-20  33%  858 aa  SYL_ALISL RecName: Full=Leucyl-tRNA synthetase;       
    9::774     7e-20  31%  862 aa  SYL_SYNAS RecName: Full=Leucyl-tRNA synthetase;       
    9::645     7e-20  27%  859 aa  SYL_SHEHH RecName: Full=Leucyl-tRNA synthetase;       
    9::852     7e-20  28%  868 aa  SYL_PSEU5 RecName: Full=Leucyl-tRNA synthetase;       
    7::602     7e-20  32%  805 aa  SYL_GEOKA RecName: Full=Leucyl-tRNA synthetase;       
   11::750     7e-20  26%  819 aa  SYL_CHLTA RecName: Full=Leucyl-tRNA synthetase;       
   12::750     9e-20  28%  835 aa  SYL_RICM5 RecName: Full=Leucyl-tRNA synthetase;       
    4::519     9e-20  27%  871 aa  SYL_NOSP7 RecName: Full=Leucyl-tRNA synthetase;       
   10::606     9e-20  28%  808 aa  SYL_LEUMM RecName: Full=Leucyl-tRNA synthetase;       
   14::343     1e-19  28%  969 aa  SYL_STAMF RecName: Full=Leucyl-tRNA synthetase;       
    9::651     1e-19  28%  868 aa  SYL_NITEC RecName: Full=Leucyl-tRNA synthetase;       
    6::646     1e-19  29%  860 aa  SYL_MANSM RecName: Full=Leucyl-tRNA synthetase;       
   43::680     1e-19  30%  885 aa  SYL_HALSA RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACHK RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACCZ RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACC3 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACC0 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACAN RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACAH RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACAC RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-19  28%  802 aa  SYL_BACAA RecName: Full=Leucyl-tRNA synthetase;       
    5::404     2e-19  29%  833 aa  SYL_STRZT RecName: Full=Leucyl-tRNA synthetase;       
   18::406     2e-19  31%  859 aa  SYL_SHESM RecName: Full=Leucyl-tRNA synthetase;       
   18::797     2e-19  29%  863 aa  SYL_SHEFN RecName: Full=Leucyl-tRNA synthetase;       
   14::813     2e-19  25%  946 aa  SYL_PYRCJ RecName: Full=Leucyl-tRNA synthetase;       
    1::618     2e-19  28%  801 aa  SYL_EXIS2 RecName: Full=Leucyl-tRNA synthetase;       
   34::743     2e-19  26%  830 aa  SYL_EHRRW RecName: Full=Leucyl-tRNA synthetase;       
    5::404     2e-19  29%  833 aa  SYL_STRTD RecName: Full=Leucyl-tRNA synthetase;       
    5::404     2e-19  29%  833 aa  SYL_STRT2 RecName: Full=Leucyl-tRNA synthetase;       
    5::404     2e-19  29%  833 aa  SYL_STRT1 RecName: Full=Leucyl-tRNA synthetase;       
   18::406     2e-19  31%  859 aa  SYL_SHEON RecName: Full=Leucyl-tRNA synthetase;       
   18::802     2e-19  29%  868 aa  SYL_PSEF5 RecName: Full=Leucyl-tRNA synthetase;       
    3::605     2e-19  29%  807 aa  SYL_MYCPU RecName: Full=Leucyl-tRNA synthetase;       
   12::870     2e-19  25%  934 aa  SYL1_SULSO RecName: Full=Leucyl-tRNA synthetase 1;       
   12::788     3e-19  28%  857 aa  SYL_THEEB RecName: Full=Leucyl-tRNA synthetase;       
   41::843     3e-19  27%  847 aa  SYL_RHOS1 RecName: Full=Leucyl-tRNA synthetase;       
   18::543     3e-19  30%  868 aa  SYL_PSEFS RecName: Full=Leucyl-tRNA synthetase;       
   23::655     3e-19  30%  864 aa  SYL_PROM5 RecName: Full=Leucyl-tRNA synthetase;       
   39::648     3e-19  30%  801 aa  SYL_MESFL RecName: Full=Leucyl-tRNA synthetase;       
   11::823     3e-19  27%  861 aa  SYL_HAEIG RecName: Full=Leucyl-tRNA synthetase;       
    1::602     3e-19  28%  802 aa  SYL_BACC2 RecName: Full=Leucyl-tRNA synthetase;       
    4::519     3e-19  27%  872 aa  SYL_ANASP RecName: Full=Leucyl-tRNA synthetase;       
   41::777     5e-19  24%  881 aa  SYV_WIGBR RecName: Full=Valyl-tRNA synthetase;       
    5::404     5e-19  29%  833 aa  SYL_STRZJ RecName: Full=Leucyl-tRNA synthetase;       
    5::404     5e-19  29%  833 aa  SYL_STRPJ RecName: Full=Leucyl-tRNA synthetase;       
    9::659     5e-19  28%  873 aa  SYL_PSEA7 RecName: Full=Leucyl-tRNA synthetase;       
   11::823     5e-19  27%  861 aa  SYL_HAEI8 RecName: Full=Leucyl-tRNA synthetase;       
   34::743     5e-19  26%  830 aa  SYL_EHRRG RecName: Full=Leucyl-tRNA synthetase;       
   19::819     5e-19  26%  877 aa  SYL_BRUC2 RecName: Full=Leucyl-tRNA synthetase;       
    5::404     6e-19  29%  833 aa  SYL_STRR6 RecName: Full=Leucyl-tRNA synthetase;       
    5::404     6e-19  29%  833 aa  SYL_STRP2 RecName: Full=Leucyl-tRNA synthetase;       
   18::472     6e-19  29%  859 aa  SYL_SHESW RecName: Full=Leucyl-tRNA synthetase;       
   18::796     6e-19  28%  868 aa  SYL_PSE14 RecName: Full=Leucyl-tRNA synthetase;       
    1::445     6e-19  28%  845 aa  SYL_PARUW RecName: Full=Leucyl-tRNA synthetase;       
    3::795     6e-19  28%  865 aa  SYL_MARMM RecName: Full=Leucyl-tRNA synthetase;       
   16::737     6e-19  25%  809 aa  SYL_LACBA RecName: Full=Leucyl-tRNA synthetase;       
   18::795     6e-19  24%  869 aa  SYL_HAMD5 RecName: Full=Leucyl-tRNA synthetase;       
    6::731     6e-19  25%  802 aa  SYL_FINM2 RecName: Full=Leucyl-tRNA synthetase;       
    1::733     8e-19  28%  805 aa  SYL_GEOSW RecName: Full=Leucyl-tRNA synthetase;       
   42::710     8e-19  29%  870 aa  SYL_DECAR RecName: Full=Leucyl-tRNA synthetase;       
   18::793     1e-18  29%  859 aa  SYL_SHEB8 RecName: Full=Leucyl-tRNA synthetase;       
    5::454     1e-18  28%  874 aa  SYL_BRAJA RecName: Full=Leucyl-tRNA synthetase;       
   42::519     1e-18  27%  872 aa  SYL_ANAVT RecName: Full=Leucyl-tRNA synthetase;       
   21::663     1e-18  30%  879 aa  SYL_XYLFA RecName: Full=Leucyl-tRNA synthetase;       
   14::388     1e-18  27%  806 aa  SYL_TROW8 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-18  29%  804 aa  SYL_STAHJ RecName: Full=Leucyl-tRNA synthetase;       
   18::472     1e-18  29%  859 aa  SYL_SHEPC RecName: Full=Leucyl-tRNA synthetase;       
   18::472     1e-18  29%  859 aa  SYL_SHEB9 RecName: Full=Leucyl-tRNA synthetase;       
   10::733     1e-18  29%  804 aa  SYL_LACGA RecName: Full=Leucyl-tRNA synthetase;       
   17::792     1e-18  25%  858 aa  SYL_IDILO RecName: Full=Leucyl-tRNA synthetase;       
   12::770     1e-18  25%  938 aa  SYL1_METS5 RecName: Full=Leucyl-tRNA synthetase 1;       
    5::404     2e-18  29%  833 aa  SYL_STRZP RecName: Full=Leucyl-tRNA synthetase;       
    5::404     2e-18  29%  833 aa  SYL_STRP7 RecName: Full=Leucyl-tRNA synthetase;       
   22::460     2e-18  27%  880 aa  SYL_STRMK RecName: Full=Leucyl-tRNA synthetase;       
   18::472     2e-18  29%  859 aa  SYL_SHEB5 RecName: Full=Leucyl-tRNA synthetase;       
   18::472     2e-18  29%  859 aa  SYL_SHEB2 RecName: Full=Leucyl-tRNA synthetase;       
    9::646     2e-18  26%  860 aa  SYL_CITK8 RecName: Full=Leucyl-tRNA synthetase;       
   18::612     2e-18  25%  860 aa  SYL_SERP5 RecName: Full=Leucyl-tRNA synthetase;       
   11::602     2e-18  30%  804 aa  SYL_BACLD RecName: Full=Leucyl-tRNA synthetase;       
   36::659     3e-18  28%  854 aa  SYL_SORC5 RecName: Full=Leucyl-tRNA synthetase;       
    6::798     3e-18  25%  860 aa  SYL_HAES1 RecName: Full=Leucyl-tRNA synthetase;       
   10::407     4e-18  28%  804 aa  SYL_LACDA RecName: Full=Leucyl-tRNA synthetase;       
   15::813     4e-18  27%  823 aa  SYL_DEIRA RecName: Full=Leucyl-tRNA synthetase;       
   14::388     5e-18  27%  806 aa  SYL_TROWT RecName: Full=Leucyl-tRNA synthetase;       
    5::404     5e-18  28%  833 aa  SYL_STRPS RecName: Full=Leucyl-tRNA synthetase;       
   18::441     5e-18  29%  863 aa  SYL_SHEDO RecName: Full=Leucyl-tRNA synthetase;       
   42::751     5e-18  27%  817 aa  SYL_METFK RecName: Full=Leucyl-tRNA synthetase;       
   10::407     5e-18  28%  804 aa  SYL_LACDB RecName: Full=Leucyl-tRNA synthetase;       
    6::798     5e-18  26%  860 aa  SYL_HAES2 RecName: Full=Leucyl-tRNA synthetase;       
   19::652     5e-18  27%  867 aa  SYL_ALTMD RecName: Full=Leucyl-tRNA synthetase;       
   11::792     7e-18  32%  858 aa  SYL_VIBCH RecName: Full=Leucyl-tRNA synthetase;       
   11::792     7e-18  32%  858 aa  SYL_VIBC3 RecName: Full=Leucyl-tRNA synthetase;       
   21::761     7e-18  29%  910 aa  SYL_THEAC RecName: Full=Leucyl-tRNA synthetase;       
    5::451     7e-18  30%  833 aa  SYL_STRGC RecName: Full=Leucyl-tRNA synthetase;       
    1::602     7e-18  30%  804 aa  SYL_STAES RecName: Full=Leucyl-tRNA synthetase;       
    1::602     7e-18  30%  804 aa  SYL_STAEQ RecName: Full=Leucyl-tRNA synthetase;       
   11::392     7e-18  28%  819 aa  SYL_CHLTB RecName: Full=Leucyl-tRNA synthetase;       
   11::392     7e-18  28%  819 aa  SYL_CHLT2 RecName: Full=Leucyl-tRNA synthetase;       
    6::646     9e-18  29%  860 aa  SYL_PASMU RecName: Full=Leucyl-tRNA synthetase;       
   16::738     9e-18  28%  810 aa  SYL_OENOB RecName: Full=Leucyl-tRNA synthetase;       
    1::655     9e-18  31%  805 aa  SYL_LYSSC RecName: Full=Leucyl-tRNA synthetase;       
   18::646     9e-18  28%  860 aa  SYL_ERWCT RecName: Full=Leucyl-tRNA synthetase;       
   42::646     1e-17  33%  860 aa  SYL_SODGM RecName: Full=Leucyl-tRNA synthetase;       
   18::827     1e-17  26%  892 aa  SYL_RHOFD RecName: Full=Leucyl-tRNA synthetase;       
    1::407     1e-17  27%  806 aa  SYL_CHLPB RecName: Full=Leucyl-tRNA synthetase;       
   11::664     1e-17  29%  867 aa  SYL_LEPBP RecName: Full=Leucyl-tRNA synthetase;       
   11::664     1e-17  29%  867 aa  SYL_LEPBA RecName: Full=Leucyl-tRNA synthetase;       
    9::485     1e-17  28%  860 aa  SYL_ECOUT RecName: Full=Leucyl-tRNA synthetase;       
    9::485     1e-17  28%  860 aa  SYL_ECOK1 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     1e-17  28%  860 aa  SYL_ECO45 RecName: Full=Leucyl-tRNA synthetase;       
    5::437     2e-17  30%  835 aa  SYL_ELUMP RecName: Full=Leucyl-tRNA synthetase;       
   15::429     2e-17  28%  813 aa  SYL_CLOBH RecName: Full=Leucyl-tRNA synthetase;       
   15::429     2e-17  28%  813 aa  SYL_CLOB1 RecName: Full=Leucyl-tRNA synthetase;       
   21::663     3e-17  29%  879 aa  SYL_XYLFT RecName: Full=Leucyl-tRNA synthetase;       
   21::663     3e-17  29%  879 aa  SYL_XYLF2 RecName: Full=Leucyl-tRNA synthetase;       
    5::451     3e-17  30%  833 aa  SYL_STRSV RecName: Full=Leucyl-tRNA synthetase;       
   18::391     3e-17  27%  860 aa  SYL_PROMH RecName: Full=Leucyl-tRNA synthetase;       
    1::600     3e-17  27%  802 aa  SYL_MACCJ RecName: Full=Leucyl-tRNA synthetase;       
   39::475     3e-17  31%  855 aa  SYL_KINRD RecName: Full=Leucyl-tRNA synthetase;       
   18::795     3e-17  29%  861 aa  SYL_HAHCH RecName: Full=Leucyl-tRNA synthetase;       
  410::724     3e-17  26%  811 aa  SYL_CLOK5 RecName: Full=Leucyl-tRNA synthetase;       
    7::766     4e-17  26%  956 aa  SYV_BUCBP RecName: Full=Valyl-tRNA synthetase;       
    9::733     4e-17  28%  804 aa  SYL_MYCMS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     6e-17  28%  860 aa  SYL_SHISS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     6e-17  28%  860 aa  SYL_SHIDS RecName: Full=Leucyl-tRNA synthetase;       
    2::845     6e-17  29%  855 aa  SYL_HYPNA RecName: Full=Leucyl-tRNA synthetase;       
    9::485     6e-17  27%  860 aa  SYL_ECO5E RecName: Full=Leucyl-tRNA synthetase;       
    9::485     6e-17  27%  860 aa  SYL_ECO57 RecName: Full=Leucyl-tRNA synthetase;       
   17::412     7e-17  26%  833 aa  SYL_STRMU RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_SHIFL RecName: Full=Leucyl-tRNA synthetase;       
   42::666     7e-17  29%  888 aa  SYL_POLNA RecName: Full=Leucyl-tRNA synthetase;       
    3::738     7e-17  26%  867 aa  SYL_PHEZH RecName: Full=Leucyl-tRNA synthetase;       
   69::828     7e-17  31%  848 aa  SYL_NOCSJ RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ESCF3 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOSE RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOLI RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOLC RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOL6 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOL5 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOHS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECOBW RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECO8A RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECO81 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECO7I RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECO55 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     7e-17  28%  860 aa  SYL_ECO27 RecName: Full=Leucyl-tRNA synthetase;       
   10::451     1e-16  30%  833 aa  SYL_STRP3 RecName: Full=Leucyl-tRNA synthetase;       
    2::406     1e-16  30%  859 aa  SYL_SHEAM RecName: Full=Leucyl-tRNA synthetase;       
    9::485     1e-16  28%  860 aa  SYL_SALAR RecName: Full=Leucyl-tRNA synthetase;       
    5::410     1e-16  29%  833 aa  SYL_STRS2 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-16  25%  807 aa  SYL_PELPB RecName: Full=Leucyl-tRNA synthetase;       
    1::402     1e-16  31%  829 aa  SYL_LACLA RecName: Full=Leucyl-tRNA synthetase;       
    9::407     1e-16  28%  860 aa  SYL_ECO24 RecName: Full=Leucyl-tRNA synthetase;       
   10::451     2e-16  27%  833 aa  SYL_STREM RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-16  28%  860 aa  SYL_SHIF8 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-16  25%  806 aa  SYL_PROA2 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-16  26%  805 aa  SYL_PELLD RecName: Full=Leucyl-tRNA synthetase;       
   15::429     2e-16  27%  813 aa  SYL_CLOBL RecName: Full=Leucyl-tRNA synthetase;       
    6::793     2e-16  30%  859 aa  SYL_AERHH RecName: Full=Leucyl-tRNA synthetase;       
    5::410     2e-16  29%  833 aa  SYL_STRSY RecName: Full=Leucyl-tRNA synthetase;       
   10::451     2e-16  30%  833 aa  SYL_STRS7 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-16  27%  860 aa  SYL_SHIBS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-16  27%  860 aa  SYL_SHIB3 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-16  26%  805 aa  SYL_PROVI RecName: Full=Leucyl-tRNA synthetase;       
    9::837     2e-16  24%  942 aa  SYL_METJA RecName: Full=Leucyl-tRNA synthetase;       
    9::794     2e-16  29%  860 aa  SYL_ENTS8 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-16  27%  860 aa  SYL_ECOSM RecName: Full=Leucyl-tRNA synthetase;       
  412::649     2e-16  29%  812 aa  SYL_CLOTE RecName: Full=Leucyl-tRNA synthetase;       
   25::392     2e-16  28%  819 aa  SYL_CHLMU RecName: Full=Leucyl-tRNA synthetase;       
    8::809     2e-16  27%  959 aa  SYL_AERPE RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPY RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPS RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPP RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPN RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPG RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPE RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPB RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERPA RecName: Full=Leucyl-tRNA synthetase;       
   18::590     3e-16  26%  860 aa  SYL_YERP3 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     3e-16  28%  860 aa  SYL_SALPK RecName: Full=Leucyl-tRNA synthetase;       
    9::485     3e-16  28%  860 aa  SYL_SALPA RecName: Full=Leucyl-tRNA synthetase;       
    9::485     3e-16  28%  860 aa  SYL_SALG2 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     3e-16  28%  860 aa  SYL_SALEP RecName: Full=Leucyl-tRNA synthetase;       
   11::407     3e-16  28%  860 aa  SYL_PHOLL RecName: Full=Leucyl-tRNA synthetase;       
   13::502     3e-16  28%  854 aa  SYL_CYAP7 RecName: Full=Leucyl-tRNA synthetase;       
   10::609     3e-16  30%  813 aa  SYL_CAMHC RecName: Full=Leucyl-tRNA synthetase;       
    6::171     4e-16  27%  823 aa  SYL_LEGPH RecName: Full=Leucyl-tRNA synthetase;       
    6::171     4e-16  27%  823 aa  SYL_LEGPC RecName: Full=Leucyl-tRNA synthetase;       
    1::402     4e-16  30%  829 aa  SYL_LACLM RecName: Full=Leucyl-tRNA synthetase;       
   18::590     5e-16  26%  860 aa  SYL_YERE8 RecName: Full=Leucyl-tRNA synthetase;       
    5::686     5e-16  30%  876 aa  SYL_RHOPT RecName: Full=Leucyl-tRNA synthetase;       
    9::485     5e-16  27%  860 aa  SYL_ECOLU RecName: Full=Leucyl-tRNA synthetase;       
    8::606     6e-16  28%  806 aa  SYL_UREPA RecName: Full=Leucyl-tRNA synthetase;       
    8::606     6e-16  28%  806 aa  SYL_UREP2 RecName: Full=Leucyl-tRNA synthetase;       
   10::451     6e-16  30%  833 aa  SYL_STRE4 RecName: Full=Leucyl-tRNA synthetase;       
    1::604     6e-16  29%  806 aa  SYL_STAAS RecName: Full=Leucyl-tRNA synthetase;       
    5::686     6e-16  30%  876 aa  SYL_RHOPA RecName: Full=Leucyl-tRNA synthetase;       
   24::794     6e-16  25%  952 aa  SYL_METVS RecName: Full=Leucyl-tRNA synthetase;       
    6::171     6e-16  27%  823 aa  SYL_LEGPL RecName: Full=Leucyl-tRNA synthetase;       
    5::603     8e-16  29%  805 aa  SYL_STAAT RecName: Full=Leucyl-tRNA synthetase;       
    5::603     8e-16  29%  805 aa  SYL_STAAE RecName: Full=Leucyl-tRNA synthetase;       
    5::603     8e-16  29%  805 aa  SYL_STAAC RecName: Full=Leucyl-tRNA synthetase;       
    5::603     8e-16  29%  805 aa  SYL_STAA8 RecName: Full=Leucyl-tRNA synthetase;       
    5::603     8e-16  29%  805 aa  SYL_STAA3 RecName: Full=Leucyl-tRNA synthetase;       
   48::794     8e-16  26%  881 aa  SYL_HERAR RecName: Full=Leucyl-tRNA synthetase;       
   11::823     8e-16  25%  861 aa  SYL_HAEIN RecName: Full=Leucyl-tRNA synthetase;       
   31::846     8e-16  32%  885 aa  SYL_BORPE RecName: Full=Leucyl-tRNA synthetase;       
   31::846     8e-16  32%  885 aa  SYL_BORPA RecName: Full=Leucyl-tRNA synthetase;       
   31::846     8e-16  32%  885 aa  SYL_BORBR RecName: Full=Leucyl-tRNA synthetase;       
    7::400     8e-16  28%  804 aa  SYL_BACSU RecName: Full=Leucyl-tRNA synthetase;       
   42::684     8e-16  33%  873 aa  SYL_AZOSB RecName: Full=Leucyl-tRNA synthetase;       
    8::622     1e-15  28%  806 aa  SYL_UREU1 RecName: Full=Leucyl-tRNA synthetase;       
    5::454     1e-15  32%  888 aa  SYL_RHOP5 RecName: Full=Leucyl-tRNA synthetase;       
   16::452     1e-15  32%  856 aa  SYL_PROM2 RecName: Full=Leucyl-tRNA synthetase;       
    5::605     1e-15  29%  807 aa  SYL_STAAW RecName: Full=Leucyl-tRNA synthetase;       
   25::181     1e-15  27%  862 aa  SYL_PROMT RecName: Full=Leucyl-tRNA synthetase;       
    6::171     1e-15  27%  823 aa  SYL_LEGPA RecName: Full=Leucyl-tRNA synthetase;       
    8::825     1e-15  24%  932 aa  SYL_ARCFU RecName: Full=Leucyl-tRNA synthetase;       
    4::416     2e-15  30%  873 aa  SYL_SYNJA RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-15  29%  804 aa  SYL_STAAR RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-15  29%  804 aa  SYL_STAAN RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-15  29%  804 aa  SYL_STAAM RecName: Full=Leucyl-tRNA synthetase;       
    1::602     2e-15  29%  804 aa  SYL_STAA1 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALTY RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALSV RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALPC RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALPB RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALNS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALHS RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALDC RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALCH RecName: Full=Leucyl-tRNA synthetase;       
    9::485     2e-15  28%  860 aa  SYL_SALA4 RecName: Full=Leucyl-tRNA synthetase;       
   16::457     2e-15  33%  856 aa  SYL_PROMS RecName: Full=Leucyl-tRNA synthetase;       
    1::402     2e-15  29%  829 aa  SYL_LACLS RecName: Full=Leucyl-tRNA synthetase;       
    6::842     2e-15  27%  910 aa  SYL_ACISJ RecName: Full=Leucyl-tRNA synthetase;       
   58::797     3e-15  30%  865 aa  SYL_SYNP6 RecName: Full=Leucyl-tRNA synthetase;       
    9::485     3e-15  28%  860 aa  SYL_SALTI RecName: Full=Leucyl-tRNA synthetase;       
    5::684     3e-15  32%  878 aa  SYL_RHOPS RecName: Full=Leucyl-tRNA synthetase;       
    5::603     4e-15  29%  805 aa  SYL_STAA9 RecName: Full=Leucyl-tRNA synthetase;       
    5::603     4e-15  29%  805 aa  SYL_STAA2 RecName: Full=Leucyl-tRNA synthetase;       
   28::649     4e-15  31%  858 aa  SYL_PROMP RecName: Full=Leucyl-tRNA synthetase;       
   16::457     4e-15  33%  856 aa  SYL_PROM9 RecName: Full=Leucyl-tRNA synthetase;       
    2::170     4e-15  31%  809 aa  SYL_CAMJE RecName: Full=Leucyl-tRNA synthetase;       
    5::410     4e-15  28%  842 aa  SYL_BORT9 RecName: Full=Leucyl-tRNA synthetase;       
   21::663     5e-15  31%  879 aa  SYL_XYLFM RecName: Full=Leucyl-tRNA synthetase;       
   42::677     5e-15  28%  857 aa  SYL_THIDA RecName: Full=Leucyl-tRNA synthetase;       
   58::797     5e-15  31%  865 aa  SYL_SYNE7 RecName: Full=Leucyl-tRNA synthetase;       
    9::869     5e-15  28%  873 aa  SYL_RHOS5 RecName: Full=Leucyl-tRNA synthetase;       
   16::457     5e-15  33%  856 aa  SYL_PROM0 RecName: Full=Leucyl-tRNA synthetase;       
    9::827     5e-15  27%  966 aa  SYL_METBF RecName: Full=Leucyl-tRNA synthetase;       
   11::654     5e-15  33%  862 aa  SYL_MAGSA RecName: Full=Leucyl-tRNA synthetase;       
    2::170     5e-15  31%  809 aa  SYL_CAMJ8 RecName: Full=Leucyl-tRNA synthetase;       
    5::684     7e-15  31%  874 aa  SYL_RHOP2 RecName: Full=Leucyl-tRNA synthetase;       
    2::170     7e-15  31%  809 aa  SYL_CAMJJ RecName: Full=Leucyl-tRNA synthetase;       
    9::170     7e-15  32%  811 aa  SYL_CAMFF RecName: Full=Leucyl-tRNA synthetase;       
   15::179     9e-15  31%  904 aa  SYL_ROSCS RecName: Full=Leucyl-tRNA synthetase;       
    9::460     1e-14  29%  878 aa  SYL_TREPS RecName: Full=Leucyl-tRNA synthetase;       
    9::460     1e-14  29%  878 aa  SYL_TREPA RecName: Full=Leucyl-tRNA synthetase;       
    7::602     1e-14  29%  804 aa  SYL_STAS1 RecName: Full=Leucyl-tRNA synthetase;       
    1::602     1e-14  29%  804 aa  SYL_STAAB RecName: Full=Leucyl-tRNA synthetase;       
   15::810     1e-14  22%  969 aa  SYL_META3 RecName: Full=Leucyl-tRNA synthetase;       
    2::170     1e-14  31%  809 aa  SYL_CAMJR RecName: Full=Leucyl-tRNA synthetase;       
    1::667     1e-14  33%  880 aa  SYL_BARQU RecName: Full=Leucyl-tRNA synthetase;       
   15::179     2e-14  30%  904 aa  SYL_ROSS1 RecName: Full=Leucyl-tRNA synthetase;       
    5::403     2e-14  26%  833 aa  SYL_STRU0 RecName: Full=Leucyl-tRNA synthetase;       
    6::842     2e-14  29%  910 aa  SYL_DIAST RecName: Full=Leucyl-tRNA synthetase;       
   11::423     2e-14  27%  820 aa  SYL_CHLPN RecName: Full=Leucyl-tRNA synthetase;       
   31::472     2e-14  31%  885 aa  SYL_BORPD RecName: Full=Leucyl-tRNA synthetase;       
   18::360     3e-14  31%  835 aa  SYL_SPHWW RecName: Full=Leucyl-tRNA synthetase;       
   43::789     3e-14  29%  859 aa  SYL_MAGSM RecName: Full=Leucyl-tRNA synthetase;       
   48::794     3e-14  25%  881 aa  SYL_JANMA RecName: Full=Leucyl-tRNA synthetase;       
    5::875     4e-14  28%  876 aa  SYL_RHILW RecName: Full=Leucyl-tRNA synthetase;       
    6::409     4e-14  27%  862 aa  SYL_PSEHT RecName: Full=Leucyl-tRNA synthetase;       
   11::823     4e-14  27%  861 aa  SYL_HAEIE RecName: Full=Leucyl-tRNA synthetase;       
   18::798     6e-14  27%  864 aa  SYL_ALHEH RecName: Full=Leucyl-tRNA synthetase;       
    6::793     8e-14  26%  859 aa  SYL_PSYIN RecName: Full=Leucyl-tRNA synthetase;       
    1::667     8e-14  31%  880 aa  SYL_BARHE RecName: Full=Leucyl-tRNA synthetase;       
   20::665     1e-13  29%  838 aa  SYL_WOLWR RecName: Full=Leucyl-tRNA synthetase;       
   27::761     1e-13  27%  910 aa  SYL_THEVO RecName: Full=Leucyl-tRNA synthetase;       
   22::165     1e-13  26%  828 aa  SYL_RICPR RecName: Full=Leucyl-tRNA synthetase;       
   36::719     1e-13  25%  831 aa  SYL_NEOSM RecName: Full=Leucyl-tRNA synthetase;       
   18::612     1e-13  26%  860 aa  SYL_EDWI9 RecName: Full=Leucyl-tRNA synthetase;       
   11::848     1e-13  29%  861 aa  SYL_ACTPJ RecName: Full=Leucyl-tRNA synthetase;       
   11::848     1e-13  29%  861 aa  SYL_ACTP2 RecName: Full=Leucyl-tRNA synthetase;       
    5::875     1e-13  28%  876 aa  SYL2_RHIL3 RecName: Full=Leucyl-tRNA synthetase 2;       
   13::147     1e-13  32%  618 aa  SYM_THET8 RecName: Full=Methionyl-tRNA synthetase;       
    5::875     1e-13  28%  876 aa  SYL_RHIE6 RecName: Full=Leucyl-tRNA synthetase;       
   34::743     1e-13  27%  829 aa  SYL_EHRCR RecName: Full=Leucyl-tRNA synthetase;       
  407::743     1e-13  29%  829 aa  SYL_EHRCJ RecName: Full=Leucyl-tRNA synthetase;       
   31::849     1e-13  29%  885 aa  SYL_BORA1 RecName: Full=Leucyl-tRNA synthetase;       
    9::442     1e-13  26%  870 aa  SYL_AZOVD RecName: Full=Leucyl-tRNA synthetase;       
   16::177     2e-13  28%  890 aa  SYL_POLNS RecName: Full=Leucyl-tRNA synthetase;       
    7::165     2e-13  28%  835 aa  SYL_RICFE RecName: Full=Leucyl-tRNA synthetase;       
   18::850     2e-13  29%  861 aa  SYL_HAEDU RecName: Full=Leucyl-tRNA synthetase;       
    5::171     3e-13  30%  833 aa  SYL_STRA5 RecName: Full=Leucyl-tRNA synthetase;       
    5::171     3e-13  30%  833 aa  SYL_STRA3 RecName: Full=Leucyl-tRNA synthetase;       
    5::171     3e-13  30%  833 aa  SYL_STRA1 RecName: Full=Leucyl-tRNA synthetase;       
   25::792     3e-13  27%  862 aa  SYL_PROM1 RecName: Full=Leucyl-tRNA synthetase;       
    9::178     3e-13  33%  805 aa  SYL_MYCGA RecName: Full=Leucyl-tRNA synthetase;       
   42::691     3e-13  27%  872 aa  SYL_CHRVO RecName: Full=Leucyl-tRNA synthetase;       
   18::790     3e-13  27%  856 aa  SYL_CHRSD RecName: Full=Leucyl-tRNA synthetase;       
    9::784     4e-13  25%  961 aa  SYL_METAC RecName: Full=Leucyl-tRNA synthetase;       
    9::171     4e-13  26%  894 aa  SYL_ENT38 RecName: Full=Leucyl-tRNA synthetase;       
    1::171     4e-13  28%  807 aa  SYL_CHLP8 RecName: Full=Leucyl-tRNA synthetase;       
   36::628     5e-13  32%  819 aa  SYL_WOLPP RecName: Full=Leucyl-tRNA synthetase;       
    9::171     5e-13  26%  860 aa  SYL_KLEP7 RecName: Full=Leucyl-tRNA synthetase;       
    9::473     5e-13  29%  860 aa  SYL_KLEP3 RecName: Full=Leucyl-tRNA synthetase;       
    6::792     5e-13  28%  858 aa  SYL_AERS4 RecName: Full=Leucyl-tRNA synthetase;       
   56::665     5e-13  30%  902 aa  SYLM_MOUSE RecName: Full=Probable leucyl-tRNA synthetase,
   42::789     6e-13  28%  876 aa  SYL_VARPS RecName: Full=Leucyl-tRNA synthetase;       
   57::666     6e-13  31%  903 aa  SYLM_PONAB RecName: Full=Probable leucyl-tRNA synthetase,
    7::804     8e-13  27%  870 aa  SYL_PSEA6 RecName: Full=Leucyl-tRNA synthetase;       
   18::883     8e-13  27%  887 aa  SYL_METCA RecName: Full=Leucyl-tRNA synthetase;       
    9::167     8e-13  26%  806 aa  SYL_HELPJ RecName: Full=Leucyl-tRNA synthetase;       
    1::406     8e-13  28%  805 aa  SYL_CHLL2 RecName: Full=Leucyl-tRNA synthetase;       
   11::798     8e-13  28%  834 aa  SYL_ACTP7 RecName: Full=Leucyl-tRNA synthetase;       
   57::666     8e-13  31%  903 aa  SYLM_HUMAN RecName: Full=Probable leucyl-tRNA synthetase,
   10::171     1e-12  29%  833 aa  SYL_STRPM RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRPG RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRPF RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRPD RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRPC RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRPB RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRP8 RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRP6 RecName: Full=Leucyl-tRNA synthetase;       
    1::171     1e-12  28%  807 aa  SYL_CHLTE RecName: Full=Leucyl-tRNA synthetase;       
   11::602     1e-12  31%  804 aa  SYL_BACA2 RecName: Full=Leucyl-tRNA synthetase;       
   10::171     1e-12  29%  833 aa  SYL_STRP1 RecName: Full=Leucyl-tRNA synthetase;       
    3::643     1e-12  34%  865 aa  SYL_RHOCS RecName: Full=Leucyl-tRNA synthetase;       
   18::171     1e-12  28%  820 aa  SYL_COXBU RecName: Full=Leucyl-tRNA synthetase;       
   18::171     1e-12  28%  820 aa  SYL_COXBR RecName: Full=Leucyl-tRNA synthetase;       
   18::171     1e-12  28%  820 aa  SYL_COXB2 RecName: Full=Leucyl-tRNA synthetase;       
   18::171     1e-12  28%  820 aa  SYL_COXB1 RecName: Full=Leucyl-tRNA synthetase;       
   10::171     2e-12  29%  833 aa  SYL_STRPZ RecName: Full=Leucyl-tRNA synthetase;       
   11::806     2e-12  29%  876 aa  SYL_NEIG2 RecName: Full=Leucyl-tRNA synthetase;       
   13::655     2e-12  31%  865 aa  SYL_GLUOX RecName: Full=Leucyl-tRNA synthetase;       
   18::171     2e-12  28%  820 aa  SYL_COXBN RecName: Full=Leucyl-tRNA synthetase;       
   11::806     2e-12  29%  876 aa  SYL_NEIG1 RecName: Full=Leucyl-tRNA synthetase;       
   56::670     2e-12  32%  894 aa  SYLM_YEAST RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
   56::670     2e-12  32%  894 aa  SYLM_SACDO RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
   18::646     3e-12  33%  860 aa  SYL_PECCP RecName: Full=Leucyl-tRNA synthetase;       
   11::394     3e-12  28%  820 aa  SYL_CHLFF RecName: Full=Leucyl-tRNA synthetase;       
   42::407     3e-12  31%  861 aa  SYL_BAUCH RecName: Full=Leucyl-tRNA synthetase;       
   22::664     4e-12  36%  880 aa  SYL_STRM5 RecName: Full=Leucyl-tRNA synthetase;       
   17::688     4e-12  29%  866 aa  SYL_LARHH RecName: Full=Leucyl-tRNA synthetase;       
    9::167     4e-12  27%  806 aa  SYL_HELPH RecName: Full=Leucyl-tRNA synthetase;       
   11::394     4e-12  28%  820 aa  SYL_CHLCV RecName: Full=Leucyl-tRNA synthetase;       
   16::394     4e-12  26%  820 aa  SYL_CHLAB RecName: Full=Leucyl-tRNA synthetase;       
   11::434     4e-12  32%  861 aa  SYL_BUCAP RecName: Full=Leucyl-tRNA synthetase;       
   42::676     5e-12  30%  907 aa  SYL_VEREI RecName: Full=Leucyl-tRNA synthetase;       
   48::514     5e-12  28%  877 aa  SYL_RALPJ RecName: Full=Leucyl-tRNA synthetase;       
    9::167     5e-12  27%  806 aa  SYL_HELAH RecName: Full=Leucyl-tRNA synthetase;       
   12::749     7e-12  28%  834 aa  SYL_RICCK RecName: Full=Leucyl-tRNA synthetase;       
   11::806     7e-12  29%  876 aa  SYL_NEIMF RecName: Full=Leucyl-tRNA synthetase;       
   11::806     7e-12  29%  876 aa  SYL_NEIMB RecName: Full=Leucyl-tRNA synthetase;       
   11::839     7e-12  29%  910 aa  SYL_NEIMA RecName: Full=Leucyl-tRNA synthetase;       
   11::805     7e-12  29%  876 aa  SYL_NEIM0 RecName: Full=Leucyl-tRNA synthetase;       
   18::171     7e-12  25%  860 aa  SYL_ERWT9 RecName: Full=Leucyl-tRNA synthetase;       
   57::186     9e-12  29%  875 aa  SYL_GRABC RecName: Full=Leucyl-tRNA synthetase;       
   18::645     9e-12  31%  863 aa  SYL_COLP3 RecName: Full=Leucyl-tRNA synthetase;       
    9::279     1e-11  27%  378 aa  SYV_HAEPA RecName: Full=Valyl-tRNA synthetase;       
    9::784     1e-11  26%  966 aa  SYL_METMA RecName: Full=Leucyl-tRNA synthetase;       
    1::171     1e-11  28%  816 aa  SYL_CHLPD RecName: Full=Leucyl-tRNA synthetase;       
    5::412     1e-11  27%  842 aa  SYL_BORHD RecName: Full=Leucyl-tRNA synthetase;       
   18::171     1e-11  27%  867 aa  SYL_BLOFL RecName: Full=Leucyl-tRNA synthetase;       
   11::137     2e-11  29%  629 aa  SYM_THEMA RecName: Full=Methionyl-tRNA synthetase;       
   49::680     2e-11  28%  897 aa  SYL_METPP RecName: Full=Leucyl-tRNA synthetase;       
    9::167     2e-11  27%  806 aa  SYL_HELPY RecName: Full=Leucyl-tRNA synthetase;       
   11::171     2e-11  25%  861 aa  SYL_BUCBP RecName: Full=Leucyl-tRNA synthetase;       
   48::514     2e-11  28%  873 aa  SYL_RALME RecName: Full=Leucyl-tRNA synthetase;       
   18::872     2e-11  27%  872 aa  SYL_BLOPB RecName: Full=Leucyl-tRNA synthetase;       
    9::802     3e-11  27%  868 aa  SYL_PSEPF RecName: Full=Leucyl-tRNA synthetase;       
   42::907     3e-11  29%  911 aa  SYL_DELAS RecName: Full=Leucyl-tRNA synthetase;       
    8::421     3e-11  31%  847 aa  SYL_BUCCC RecName: Full=Leucyl-tRNA synthetase;       
   12::607     3e-11  28%  803 aa  SYL_ACHLI RecName: Full=Leucyl-tRNA synthetase;       
  219::323     3e-11  37%  470 aa  SYC_RUBXD RecName: Full=Cysteinyl-tRNA synthetase;       
   16::460     5e-11  28%  864 aa  SYL_LEPBL RecName: Full=Leucyl-tRNA synthetase;       
   16::460     5e-11  28%  864 aa  SYL_LEPBJ RecName: Full=Leucyl-tRNA synthetase;       
   42::171     5e-11  31%  864 aa  SYL_BURCJ RecName: Full=Leucyl-tRNA synthetase;       
    4::434     5e-11  32%  859 aa  SYL_BUCAI RecName: Full=Leucyl-tRNA synthetase;       
   17::412     5e-11  28%  842 aa  SYL_BORRA RecName: Full=Leucyl-tRNA synthetase;       
   17::412     5e-11  28%  842 aa  SYL_BORDL RecName: Full=Leucyl-tRNA synthetase;       
   12::485     6e-11  32%  512 aa  SYM_MYCPN RecName: Full=Methionyl-tRNA synthetase;       
   26::791     6e-11  29%  878 aa  SYL_SYNPW RecName: Full=Leucyl-tRNA synthetase;       
    1::143     6e-11  30%  925 aa  SYL_PORGI RecName: Full=Leucyl-tRNA synthetase;       
    1::143     6e-11  30%  925 aa  SYL_PORG3 RecName: Full=Leucyl-tRNA synthetase;       
   46::554     6e-11  27%  886 aa  SYL_POLSJ RecName: Full=Leucyl-tRNA synthetase;       
   42::171     8e-11  28%  863 aa  SYL_BURXL RecName: Full=Leucyl-tRNA synthetase;       
  222::426     8e-11  25%  465 aa  SYC_BACCN RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     1e-10  28%  466 aa  SYC_STAAR RecName: Full=Cysteinyl-tRNA synthetase;       
   22::165     1e-10  27%  828 aa  SYL_RICTY RecName: Full=Leucyl-tRNA synthetase;       
   42::825     1e-10  31%  864 aa  SYL_BURVG RecName: Full=Leucyl-tRNA synthetase;       
   42::650     1e-10  30%  864 aa  SYL_BURS3 RecName: Full=Leucyl-tRNA synthetase;       
   42::171     1e-10  28%  864 aa  SYL_BURP8 RecName: Full=Leucyl-tRNA synthetase;       
   42::650     1e-10  30%  864 aa  SYL_BURCM RecName: Full=Leucyl-tRNA synthetase;       
   42::821     1e-10  29%  864 aa  SYL_BURCH RecName: Full=Leucyl-tRNA synthetase;       
   42::821     1e-10  29%  864 aa  SYL_BURCC RecName: Full=Leucyl-tRNA synthetase;       
   42::821     1e-10  29%  864 aa  SYL_BURCA RecName: Full=Leucyl-tRNA synthetase;       
   42::821     1e-10  28%  864 aa  SYL_BURA4 RecName: Full=Leucyl-tRNA synthetase;       
   18::646     2e-10  32%  864 aa  SYL_WIGBR RecName: Full=Leucyl-tRNA synthetase;       
   42::781     2e-10  29%  867 aa  SYL_DICNV RecName: Full=Leucyl-tRNA synthetase;       
   40::169     2e-10  30%  829 aa  SYL_ANAMM RecName: Full=Leucyl-tRNA synthetase;       
   53::197     2e-10  29%  874 aa  SYLM_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
   42::821     2e-10  31%  864 aa  SYL_BURPS RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURP6 RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURP1 RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURP0 RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURMS RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURMA RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURM9 RecName: Full=Leucyl-tRNA synthetase;       
   42::821     2e-10  31%  864 aa  SYL_BURM7 RecName: Full=Leucyl-tRNA synthetase;       
    9::671     2e-10  30%  897 aa  SYL_ACIAC RecName: Full=Leucyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAW RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAT RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAS RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAN RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAM RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAE RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAC RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAAB RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAA9 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAA8 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAA3 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAA2 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::418     2e-10  27%  466 aa  SYC_STAA1 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::390     3e-10  26%  466 aa  SYC_CLOPS RecName: Full=Cysteinyl-tRNA synthetase;       
  221::390     3e-10  26%  466 aa  SYC_CLOPE RecName: Full=Cysteinyl-tRNA synthetase;       
  221::390     3e-10  26%  466 aa  SYC_CLOP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   12::868     4e-10  27%  870 aa  SYL_RICAH RecName: Full=Leucyl-tRNA synthetase;       
   40::736     4e-10  27%  808 aa  SYL_LACPL RecName: Full=Leucyl-tRNA synthetase;       
   42::821     4e-10  31%  864 aa  SYL_BURTA RecName: Full=Leucyl-tRNA synthetase;       
  223::887     5e-10  32%  954 aa  SYL_SALTO RecName: Full=Leucyl-tRNA synthetase;       
   66::528     5e-10  28%  952 aa  SYL_CORGL RecName: Full=Leucyl-tRNA synthetase;       
   60::526     5e-10  29%  957 aa  SYL_COREF RecName: Full=Leucyl-tRNA synthetase;       
    1::719     5e-10  25%  805 aa  SYL_CHLCH RecName: Full=Leucyl-tRNA synthetase;       
   42::650     5e-10  29%  864 aa  SYL_BURM1 RecName: Full=Leucyl-tRNA synthetase;       
  216::396     5e-10  28%  467 aa  SYC_ARCFU RecName: Full=Cysteinyl-tRNA synthetase;       
  174::882     7e-10  22% 1058 aa  SYLC_DICDI RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  220::439     7e-10  29%  465 aa  SYC_CLOTE RecName: Full=Cysteinyl-tRNA synthetase;       
   48::464     9e-10  31%  877 aa  SYL_RALSO RecName: Full=Leucyl-tRNA synthetase;       
    2::216     9e-10  25%  977 aa  SYL_NANEQ RecName: Full=Leucyl-tRNA synthetase;       
   17::174     9e-10  28%  840 aa  SYL_BORAP RecName: Full=Leucyl-tRNA synthetase;       
  222::385     9e-10  26%  466 aa  SYC_BACP2 RecName: Full=Cysteinyl-tRNA synthetase;       
   15::148     1e-09  34%  497 aa  SYM_AQUAE RecName: Full=Methionyl-tRNA synthetase;       
   48::560     1e-09  27%  887 aa  SYL_LEPCP RecName: Full=Leucyl-tRNA synthetase;       
   56::493     1e-09  32%  955 aa  SYL_SACEN RecName: Full=Leucyl-tRNA synthetase;       
    1::172     1e-09  30%  987 aa  SYL_BIFLD RecName: Full=Leucyl-tRNA synthetase;       
  222::365     2e-09  27%  467 aa  SYC_BACLD RecName: Full=Cysteinyl-tRNA synthetase;       
   66::528     3e-09  28%  952 aa  SYL_CORGB RecName: Full=Leucyl-tRNA synthetase;       
    1::172     3e-09  30%  987 aa  SYL_BIFLO RecName: Full=Leucyl-tRNA synthetase;       
   12::120     3e-09  36%  592 aa  SYM_ROSCS RecName: Full=Methionyl-tRNA synthetase;       
   17::174     3e-09  29%  840 aa  SYL_BORGA RecName: Full=Leucyl-tRNA synthetase;       
  194::350     3e-09  29%  488 aa  SYC_HYDS0 RecName: Full=Cysteinyl-tRNA synthetase;       
  211::396     3e-09  31%  486 aa  SYC_DESRM RecName: Full=Cysteinyl-tRNA synthetase;       
    5::141     4e-09  31%  662 aa  SYM_METB6 RecName: Full=Methionyl-tRNA synthetase;       
  221::404     4e-09  26%  466 aa  SYC_STAS1 RecName: Full=Cysteinyl-tRNA synthetase;       
  221::404     4e-09  26%  466 aa  SYC_STACT RecName: Full=Cysteinyl-tRNA synthetase;       
    7::146     6e-09  32%  710 aa  SYM_METBF RecName: Full=Methionyl-tRNA synthetase;       
   16::661     6e-09  29%  863 aa  SYL_LEPIN RecName: Full=Leucyl-tRNA synthetase;       
   16::661     6e-09  29%  863 aa  SYL_LEPIC RecName: Full=Leucyl-tRNA synthetase;       
    1::143     7e-09  29%  944 aa  SYL_BACTN RecName: Full=Leucyl-tRNA synthetase;       
  190::404     7e-09  25%  466 aa  SYC_STAHJ RecName: Full=Cysteinyl-tRNA synthetase;       
  226::390     7e-09  28%  471 aa  SYC_METBF RecName: Full=Cysteinyl-tRNA synthetase;       
  220::335     7e-09  31%  465 aa  SYC_CLOBJ RecName: Full=Cysteinyl-tRNA synthetase;       
    4::143     1e-08  29%  669 aa  SYM_METTP RecName: Full=Methionyl-tRNA synthetase;       
   10::138     1e-08  28%  540 aa  SYM_HALOH RecName: Full=Methionyl-tRNA synthetase;       
   14::141     1e-08  27%  641 aa  SYM_CLOTE RecName: Full=Methionyl-tRNA synthetase;       
  220::335     1e-08  31%  465 aa  SYC_CLOBM RecName: Full=Cysteinyl-tRNA synthetase;       
  220::335     1e-08  31%  465 aa  SYC_CLOBL RecName: Full=Cysteinyl-tRNA synthetase;       
  220::335     1e-08  31%  465 aa  SYC_CLOBK RecName: Full=Cysteinyl-tRNA synthetase;       
  220::335     1e-08  31%  465 aa  SYC_CLOBH RecName: Full=Cysteinyl-tRNA synthetase;       
  220::335     1e-08  31%  465 aa  SYC_CLOB1 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACHK RecName: Full=Cysteinyl-tRNA synthetase;       
  222::364     1e-08  28%  466 aa  SYC_BACHD RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACCZ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACC3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACC0 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACAN RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACAH RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACAC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::394     1e-08  24%  465 aa  SYC_BACAA RecName: Full=Cysteinyl-tRNA synthetase;       
   48::514     1e-08  28%  873 aa  SYL_RALEJ RecName: Full=Leucyl-tRNA synthetase;       
    1::143     1e-08  27%  944 aa  SYL_BACV8 RecName: Full=Leucyl-tRNA synthetase;       
  220::334     1e-08  31%  465 aa  SYC_CLOB6 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     1e-08  23%  465 aa  SYC_BACC1 RecName: Full=Cysteinyl-tRNA synthetase;       
    2::151     2e-08  30%  683 aa  SYM_UNCMA RecName: Full=Methionyl-tRNA synthetase;       
   12::97      2e-08  26% 1022 aa  SYL_IGNH4 RecName: Full=Leucyl-tRNA synthetase;       
   17::174     2e-08  29%  840 aa  SYL_BORBZ RecName: Full=Leucyl-tRNA synthetase;       
   17::174     2e-08  29%  840 aa  SYL_BORBU RecName: Full=Leucyl-tRNA synthetase;       
  221::404     2e-08  26%  466 aa  SYC_STAES RecName: Full=Cysteinyl-tRNA synthetase;       
  221::404     2e-08  26%  466 aa  SYC_STAEQ RecName: Full=Cysteinyl-tRNA synthetase;       
  232::363     2e-08  34%  464 aa  SYC_IGNH4 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::365     2e-08  25%  466 aa  SYC_BACSU RecName: Full=Cysteinyl-tRNA synthetase;       
    8::169     2e-08  28%  793 aa  SYL_MYCPN RecName: Full=Leucyl-tRNA synthetase;       
  220::319     2e-08  31%  466 aa  SYC_THEPX RecName: Full=Cysteinyl-tRNA synthetase;       
  220::319     2e-08  31%  466 aa  SYC_THEP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  264::327     2e-08  44%  487 aa  SYC_PERMH RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     2e-08  23%  465 aa  SYC_BACCR RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     2e-08  23%  465 aa  SYC_BACC4 RecName: Full=Cysteinyl-tRNA synthetase;       
  247::326     2e-08  42%  495 aa  SYC_AQUAE RecName: Full=Cysteinyl-tRNA synthetase;       
    1::145     3e-08  30%  684 aa  SYM_METBU RecName: Full=Methionyl-tRNA synthetase;       
    3::83      3e-08  32%  516 aa  SYM_AGRT5 RecName: Full=Methionyl-tRNA synthetase;       
  247::321     3e-08  40%  487 aa  SYC_SULSY RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-08  34%  460 aa  SYC_PSEAE RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-08  34%  460 aa  SYC_PSEAB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-08  34%  460 aa  SYC_PSEA8 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-08  34%  460 aa  SYC_PSEA7 RecName: Full=Cysteinyl-tRNA synthetase;       
  258::409     3e-08  32%  470 aa  SYC_LACJO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     3e-08  23%  465 aa  SYC_BACC2 RecName: Full=Cysteinyl-tRNA synthetase;       
   10::138     4e-08  34%  544 aa  SYM_BACC2 RecName: Full=Methionyl-tRNA synthetase;       
   10::138     4e-08  33%  544 aa  SYM1_BACC1 RecName: Full=Methionyl-tRNA synthetase 1;       
   83::223     4e-08  28%  994 aa  SYLM_NEUCR RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
   41::203     4e-08  30%  289 aa  SYLB_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit beta;      
  220::376     4e-08  27%  467 aa  SYC_THETN RecName: Full=Cysteinyl-tRNA synthetase;       
  227::336     4e-08  30%  472 aa  SYC_SYNP2 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     4e-08  22%  465 aa  SYC_BACWK RecName: Full=Cysteinyl-tRNA synthetase;       
  222::345     4e-08  27%  466 aa  SYC_BACA2 RecName: Full=Cysteinyl-tRNA synthetase;       
   13::81      5e-08  32%  512 aa  SYM_RICFE RecName: Full=Methionyl-tRNA synthetase;       
   10::138     5e-08  33%  544 aa  SYM_BACWK RecName: Full=Methionyl-tRNA synthetase;       
  414::885     5e-08  28%  952 aa  SYL_SALAI RecName: Full=Leucyl-tRNA synthetase;       
    5::430     5e-08  24%  799 aa  SYL_MYCPE RecName: Full=Leucyl-tRNA synthetase;       
  231::534     5e-08  31%  960 aa  SYL_CORDI RecName: Full=Leucyl-tRNA synthetase;       
  191::392     5e-08  26%  471 aa  SYC_LISW6 RecName: Full=Cysteinyl-tRNA synthetase;       
  191::392     5e-08  26%  471 aa  SYC_LISMO RecName: Full=Cysteinyl-tRNA synthetase;       
  191::392     5e-08  26%  471 aa  SYC_LISMH RecName: Full=Cysteinyl-tRNA synthetase;       
  191::392     5e-08  26%  471 aa  SYC_LISMF RecName: Full=Cysteinyl-tRNA synthetase;       
  191::392     5e-08  26%  471 aa  SYC_LISMC RecName: Full=Cysteinyl-tRNA synthetase;       
  220::377     5e-08  30%  465 aa  SYC_CLOK5 RecName: Full=Cysteinyl-tRNA synthetase;       
  220::377     5e-08  30%  465 aa  SYC_CLOK1 RecName: Full=Cysteinyl-tRNA synthetase;       
    3::141     6e-08  32%  664 aa  SYM_METMJ RecName: Full=Methionyl-tRNA synthetase;       
    2::148     6e-08  30%  715 aa  SYM_METMA RecName: Full=Methionyl-tRNA synthetase;       
   12::243     6e-08  29%  553 aa  SYM_DEHSC RecName: Full=Methionyl-tRNA synthetase;       
   12::243     6e-08  29%  553 aa  SYM_DEHSB RecName: Full=Methionyl-tRNA synthetase;       
  223::349     6e-08  34%  515 aa  SYM_BRUSU RecName: Full=Methionyl-tRNA synthetase;       
   14::121     6e-08  31%  515 aa  SYM_BRUME RecName: Full=Methionyl-tRNA synthetase;       
   10::138     6e-08  33%  544 aa  SYM_BACAC RecName: Full=Methionyl-tRNA synthetase;       
   10::138     6e-08  33%  544 aa  SYM_BACAA RecName: Full=Methionyl-tRNA synthetase;       
   10::138     6e-08  33%  544 aa  SYM2_BACAN RecName: Full=Methionyl-tRNA synthetase 2;       
  426::1002    6e-08  32% 1064 aa  SYL_FRASC RecName: Full=Leucyl-tRNA synthetase;       
  216::322     6e-08  31%  457 aa  SYC_NANEQ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     6e-08  35%  455 aa  SYC_METFK RecName: Full=Cysteinyl-tRNA synthetase;       
  191::392     6e-08  25%  471 aa  SYC_LISIN RecName: Full=Cysteinyl-tRNA synthetase;       
   13::142     8e-08  33%  543 aa  SYM_THEVO RecName: Full=Methionyl-tRNA synthetase;       
    2::148     8e-08  30%  712 aa  SYM_METAC RecName: Full=Methionyl-tRNA synthetase;       
   10::138     8e-08  33%  544 aa  SYM_BACC3 RecName: Full=Methionyl-tRNA synthetase;       
   10::138     8e-08  33%  544 aa  SYM_BACC0 RecName: Full=Methionyl-tRNA synthetase;       
   10::138     8e-08  33%  544 aa  SYM1_BACHK RecName: Full=Methionyl-tRNA synthetase 1;       
   10::138     8e-08  33%  544 aa  SYM1_BACAH RecName: Full=Methionyl-tRNA synthetase 1;       
  226::341     8e-08  34%  459 aa  SYC_VARPS RecName: Full=Cysteinyl-tRNA synthetase;       
  215::340     8e-08  32%  474 aa  SYC_THEPD RecName: Full=Cysteinyl-tRNA synthetase;       
  230::327     8e-08  34%  462 aa  SYC_POLSJ RecName: Full=Cysteinyl-tRNA synthetase;       
  224::323     8e-08  34%  470 aa  SYC_FERNB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     8e-08  23%  465 aa  SYC_BACCQ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::385     8e-08  23%  465 aa  SYC_BACC7 RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     8e-08  32%  473 aa  SYC_ACIAD RecName: Full=Cysteinyl-tRNA synthetase;       
   12::120     1e-07  34%  592 aa  SYM_ROSS1 RecName: Full=Methionyl-tRNA synthetase;       
   19::140     1e-07  26%  645 aa  SYM_CLOPE RecName: Full=Methionyl-tRNA synthetase;       
   10::138     1e-07  33%  544 aa  SYM_BACC4 RecName: Full=Methionyl-tRNA synthetase;       
  197::390     1e-07  27%  476 aa  SYC_PYRAR RecName: Full=Cysteinyl-tRNA synthetase;       
   10::357     1e-07  30%  628 aa  SYM_CAMJE RecName: Full=Methionyl-tRNA synthetase;       
  261::347     1e-07  36%  476 aa  SYC_LACH4 RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     1e-07  31%  473 aa  SYC_ACIBY RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     1e-07  31%  473 aa  SYC_ACIBT RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     1e-07  31%  473 aa  SYC_ACIBC RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     1e-07  31%  473 aa  SYC_ACIB5 RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     1e-07  31%  473 aa  SYC_ACIB3 RecName: Full=Cysteinyl-tRNA synthetase;       
   15::120     2e-07  31%  682 aa  SYM_PASMU RecName: Full=Methionyl-tRNA synthetase;       
   12::143     2e-07  31%  668 aa  SYM_METKA RecName: Full=Methionyl-tRNA synthetase;       
   10::138     2e-07  33%  544 aa  SYM2_BACCR RecName: Full=Methionyl-tRNA synthetase 2;       
  226::340     2e-07  28%  473 aa  SYC_METMA RecName: Full=Cysteinyl-tRNA synthetase;       
  256::327     2e-07  36%  448 aa  SYC_LACLA RecName: Full=Cysteinyl-tRNA synthetase;       
  261::330     2e-07  41%  477 aa  SYC_LACAC RecName: Full=Cysteinyl-tRNA synthetase;       
  223::352     2e-07  28%  466 aa  SYC_GEOSW RecName: Full=Cysteinyl-tRNA synthetase;       
  228::331     2e-07  29%  484 aa  SYC_CYAP8 RecName: Full=Cysteinyl-tRNA synthetase;       
   13::471     2e-07  24%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       
   10::88      2e-07  38%  545 aa  SYM_STRPS RecName: Full=Methionyl-tRNA synthetase;       
   10::88      2e-07  38%  545 aa  SYM_STRP7 RecName: Full=Methionyl-tRNA synthetase;       
    2::241     2e-07  30%  664 aa  SYM_METHJ RecName: Full=Methionyl-tRNA synthetase;       
   12::141     2e-07  29%  553 aa  SYM_DEHE1 RecName: Full=Methionyl-tRNA synthetase;       
   10::138     2e-07  31%  544 aa  SYM_BACCQ RecName: Full=Methionyl-tRNA synthetase;       
   34::746     2e-07  28%  945 aa  SYL_RHOSR RecName: Full=Leucyl-tRNA synthetase;       
  226::343     2e-07  31%  474 aa  SYC_PYRAE RecName: Full=Cysteinyl-tRNA synthetase;       
  226::365     2e-07  30%  473 aa  SYC_METAC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::330     2e-07  32%  467 aa  SYC_HAHCH RecName: Full=Cysteinyl-tRNA synthetase;       
  253::377     2e-07  30%  466 aa  SYC_CLONN RecName: Full=Cysteinyl-tRNA synthetase;       
  305::381     2e-07  39%  546 aa  SYC_BIFLO RecName: Full=Cysteinyl-tRNA synthetase;       
  226::323     2e-07  35%  459 aa  SYC_ACIAC RecName: Full=Cysteinyl-tRNA synthetase;       
   19::81      3e-07  32%  508 aa  SYM_RICCN RecName: Full=Methionyl-tRNA synthetase;       
   10::138     3e-07  31%  544 aa  SYM_BACC7 RecName: Full=Methionyl-tRNA synthetase;       
    7::137     3e-07  30%  658 aa  SYM_ARCFU RecName: Full=Methionyl-tRNA synthetase;       
    1::143     3e-07  28%  946 aa  SYL_PARD8 RecName: Full=Leucyl-tRNA synthetase;       
  222::322     3e-07  31%  493 aa  SYC_SYNFM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::320     3e-07  31%  477 aa  SYC_STAMF RecName: Full=Cysteinyl-tRNA synthetase;       
  222::386     3e-07  25%  477 aa  SYC_PYRAB RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     3e-07  36%  467 aa  SYC_NITEC RecName: Full=Cysteinyl-tRNA synthetase;       
  228::331     3e-07  31%  480 aa  SYC_MICAN RecName: Full=Cysteinyl-tRNA synthetase;       
  260::339     3e-07  37%  472 aa  SYC_LACGA RecName: Full=Cysteinyl-tRNA synthetase;       
  223::344     3e-07  27%  467 aa  SYC_GEOTN RecName: Full=Cysteinyl-tRNA synthetase;       
  257::330     3e-07  33%  470 aa  SYC_ENTFA RecName: Full=Cysteinyl-tRNA synthetase;       
  220::377     3e-07  27%  466 aa  SYC_CLOB8 RecName: Full=Cysteinyl-tRNA synthetase;       
  225::325     4e-07  28%  471 aa  SYC_SYMTH RecName: Full=Cysteinyl-tRNA synthetase;       
  245::368     4e-07  28%  505 aa  SYC_PSYWF RecName: Full=Cysteinyl-tRNA synthetase;       
  250::321     4e-07  39%  465 aa  SYC_METS5 RecName: Full=Cysteinyl-tRNA synthetase;       
  256::333     4e-07  36%  448 aa  SYC_LACLS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::321     4e-07  33%  481 aa  SYC_GEOSL RecName: Full=Cysteinyl-tRNA synthetase;       
  222::322     4e-07  34%  485 aa  SYC_GEOMG RecName: Full=Cysteinyl-tRNA synthetase;       
  223::344     4e-07  26%  466 aa  SYC_GEOKA RecName: Full=Cysteinyl-tRNA synthetase;       
  226::328     4e-07  30%  473 aa  SYC_ACIBS RecName: Full=Cysteinyl-tRNA synthetase;       
   16::66      5e-07  29%  700 aa  SYM_JANMA RecName: Full=Methionyl-tRNA synthetase;       
   13::471     5e-07  26%  636 aa  SYM_FUSNN RecName: Full=Methionyl-tRNA synthetase;       
   10::138     5e-07  30%  540 aa  SYM1_ALKOO RecName: Full=Methionyl-tRNA synthetase 1;       
    2::424     5e-07  32%  950 aa  SYL_RHOBA RecName: Full=Leucyl-tRNA synthetase;       
   60::177     5e-07  30%  990 aa  SYL_BIFAA RecName: Full=Leucyl-tRNA synthetase;       
  234::331     5e-07  32%  488 aa  SYC_PSYCK RecName: Full=Cysteinyl-tRNA synthetase;       
  258::386     5e-07  29%  470 aa  SYC_LACPL RecName: Full=Cysteinyl-tRNA synthetase;       
    5::146     7e-07  28%  521 aa  SYM_UREPA RecName: Full=Methionyl-tRNA synthetase;       
   22::355     7e-07  33%  538 aa  SYM_STRCO RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAW RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAS RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAR RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAN RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAM RecName: Full=Methionyl-tRNA synthetase;       
   14::121     7e-07  28%  657 aa  SYM_STAAC RecName: Full=Methionyl-tRNA synthetase;       
   11::238     7e-07  35%  651 aa  SYM_METJA RecName: Full=Methionyl-tRNA synthetase;       
   10::143     7e-07  30%  962 aa  SYL_FLAPJ RecName: Full=Leucyl-tRNA synthetase;       
    1::143     7e-07  27%  918 aa  SYL_AZOPC RecName: Full=Leucyl-tRNA synthetase;       
  197::392     7e-07  27%  473 aa  SYC_PYRIL RecName: Full=Cysteinyl-tRNA synthetase;       
  234::331     7e-07  32%  488 aa  SYC_PSYA2 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::341     7e-07  35%  465 aa  SYC_BURA4 RecName: Full=Cysteinyl-tRNA synthetase;       
    2::85      9e-07  33%  516 aa  SYM_RHIME RecName: Full=Methionyl-tRNA synthetase;       
   13::63      9e-07  47%  688 aa  SYM_RALSO RecName: Full=Methionyl-tRNA synthetase;       
    1::143     9e-07  26%  943 aa  SYL_BACFR RecName: Full=Leucyl-tRNA synthetase;       
    1::143     9e-07  26%  943 aa  SYL_BACFN RecName: Full=Leucyl-tRNA synthetase;       
  223::323     9e-07  33%  469 aa  SYC_THEM4 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::330     9e-07  31%  465 aa  SYC_METCA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     9e-07  34%  494 aa  SYC_GEOUR RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     9e-07  33%  480 aa  SYC_GEOSM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     9e-07  33%  480 aa  SYC_GEOBB RecName: Full=Cysteinyl-tRNA synthetase;       
  234::362     9e-07  26%  464 aa  SYC_CLOAB RecName: Full=Cysteinyl-tRNA synthetase;       
  258::327     9e-07  36%  463 aa  SYC_CAUCR RecName: Full=Cysteinyl-tRNA synthetase;       
  258::327     9e-07  36%  463 aa  SYC_CAUCN RecName: Full=Cysteinyl-tRNA synthetase;       
  221::341     9e-07  28%  466 aa  SYC_BACSK RecName: Full=Cysteinyl-tRNA synthetase;       
  221::322     9e-07  37%  481 aa  SYC_ANASK RecName: Full=Cysteinyl-tRNA synthetase;       
  221::322     9e-07  37%  481 aa  SYC_ANADE RecName: Full=Cysteinyl-tRNA synthetase;       
  221::322     9e-07  37%  481 aa  SYC_ANAD2 RecName: Full=Cysteinyl-tRNA synthetase;       
   12::474     1e-06  32%  512 aa  SYM_MYCGE RecName: Full=Methionyl-tRNA synthetase;       
   12::142     1e-06  27%  656 aa  SYM_HELPJ RecName: Full=Methionyl-tRNA synthetase;       
  314::379     1e-06  42%  577 aa  SYMM_CANAL RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
  320::535     1e-06  31%  966 aa  SYL_STRCO RecName: Full=Leucyl-tRNA synthetase;       
    8::169     1e-06  26%  792 aa  SYL_MYCGE RecName: Full=Leucyl-tRNA synthetase;       
    8::189     1e-06  30%  921 aa  SYL_CYTH3 RecName: Full=Leucyl-tRNA synthetase;       
  221::340     1e-06  31%  473 aa  SYC_PYRCJ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-06  30%  460 aa  SYC_PSEE4 RecName: Full=Cysteinyl-tRNA synthetase;       
  256::333     1e-06  35%  448 aa  SYC_LACLM RecName: Full=Cysteinyl-tRNA synthetase;       
  258::327     1e-06  38%  474 aa  SYC_LACDB RecName: Full=Cysteinyl-tRNA synthetase;       
  258::327     1e-06  38%  474 aa  SYC_LACDA RecName: Full=Cysteinyl-tRNA synthetase;       
  212::346     1e-06  35%  465 aa  SYC_BURVG RecName: Full=Cysteinyl-tRNA synthetase;       
   14::484     2e-06  26%  659 aa  SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase;       
  219::389     2e-06  27%  508 aa  SYM_RICPR RecName: Full=Methionyl-tRNA synthetase;       
   16::66      2e-06  32%  710 aa  SYM_HERAR RecName: Full=Methionyl-tRNA synthetase;       
  193::331     2e-06  27%  478 aa  SYC_SYNP6 RecName: Full=Cysteinyl-tRNA synthetase;       
  193::331     2e-06  27%  478 aa  SYC_SYNE7 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::324     2e-06  33%  462 aa  SYC_RALEJ RecName: Full=Cysteinyl-tRNA synthetase;       
  221::321     2e-06  30%  477 aa  SYC_PYRFU RecName: Full=Cysteinyl-tRNA synthetase;       
  222::318     2e-06  31%  460 aa  SYC_PSESM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::341     2e-06  31%  465 aa  SYC_NITEU RecName: Full=Cysteinyl-tRNA synthetase;       
  280::370     2e-06  34%  492 aa  SYC_HALMA RecName: Full=Cysteinyl-tRNA synthetase;       
  227::383     2e-06  26%  472 aa  SYC_EUBE2 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     2e-06  28%  457 aa  SYC_CHRVO RecName: Full=Cysteinyl-tRNA synthetase;       
  212::341     2e-06  34%  465 aa  SYC_BURCM RecName: Full=Cysteinyl-tRNA synthetase;       
  171::517     2e-06  22%  733 aa  SYM_THEON RecName: Full=Methionyl-tRNA synthetase;       
   13::147     2e-06  26%  507 aa  SYM_RICTY RecName: Full=Methionyl-tRNA synthetase;       
    2::119     2e-06  32%  691 aa  SYM_GRAFK RecName: Full=Methionyl-tRNA synthetase;       
    5::136     2e-06  32%  530 aa  SYM_ANASP RecName: Full=Methionyl-tRNA synthetase;       
  266::326     2e-06  36%  470 aa  SYC_SULSO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::322     2e-06  30%  476 aa  SYC_PYRHO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::337     2e-06  32%  457 aa  SYC_LARHH RecName: Full=Cysteinyl-tRNA synthetase;       
  224::349     2e-06  30%  462 aa  SYC_CAUSK RecName: Full=Cysteinyl-tRNA synthetase;       
  261::318     2e-06  40%  472 aa  SYC_AERPE RecName: Full=Cysteinyl-tRNA synthetase;       
   14::484     3e-06  26%  656 aa  SYM_STAES RecName: Full=Methionyl-tRNA synthetase;       
   14::484     3e-06  26%  656 aa  SYM_STAEQ RecName: Full=Methionyl-tRNA synthetase;       
   19::81      3e-06  27%  509 aa  SYM_RICBR RecName: Full=Methionyl-tRNA synthetase;       
    4::473     3e-06  26%  649 aa  SYM_BACST RecName: Full=Methionyl-tRNA synthetase;       
  226::323     3e-06  32%  460 aa  SYC_VEREI RecName: Full=Cysteinyl-tRNA synthetase;       
  224::337     3e-06  30%  474 aa  SYC_THENV RecName: Full=Cysteinyl-tRNA synthetase;       
  222::322     3e-06  30%  476 aa  SYC_THEGJ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-06  31%  460 aa  SYC_MARMS RecName: Full=Cysteinyl-tRNA synthetase;       
  191::407     3e-06  28%  478 aa  SYC_DESAP RecName: Full=Cysteinyl-tRNA synthetase;       
  226::323     3e-06  31%  461 aa  SYC_DELAS RecName: Full=Cysteinyl-tRNA synthetase;       
  225::339     3e-06  32%  461 aa  SYC_AZOSE RecName: Full=Cysteinyl-tRNA synthetase;       
  215::351     3e-06  27%  467 aa  SYC_ARCB4 RecName: Full=Cysteinyl-tRNA synthetase;       
   13::122     3e-06  32%  529 aa  SYM_THEEB RecName: Full=Methionyl-tRNA synthetase;       
   15::73      3e-06  40%  689 aa  SYM_SHESW RecName: Full=Methionyl-tRNA synthetase;       
   15::73      3e-06  40%  689 aa  SYM_SHEPC RecName: Full=Methionyl-tRNA synthetase;       
  253::486     3e-06  24%  519 aa  SYM_MYCTU RecName: Full=Methionyl-tRNA synthetase;       
  253::486     3e-06  24%  519 aa  SYM_MYCBO RecName: Full=Methionyl-tRNA synthetase;       
   18::95      3e-06  32%  741 aa  SYM_HALWD RecName: Full=Methionyl-tRNA synthetase;       
   12::120     3e-06  36%  600 aa  SYM_CHLSY RecName: Full=Methionyl-tRNA synthetase;       
   12::120     3e-06  37%  600 aa  SYM_CHLAD RecName: Full=Methionyl-tRNA synthetase;       
   12::120     3e-06  36%  600 aa  SYM_CHLAA RecName: Full=Methionyl-tRNA synthetase;       
  315::865     3e-06  34%  950 aa  SYL_NOCFA RecName: Full=Leucyl-tRNA synthetase;       
  795::1009    3e-06  32% 1069 aa  SYL_FRAAA RecName: Full=Leucyl-tRNA synthetase;       
   12::422     3e-06  24% 1186 aa  SYLC_CAEEL RecName: Full=Leucyl-tRNA synthetase;       
  221::313     3e-06  34%  465 aa  SYC_SULNB RecName: Full=Cysteinyl-tRNA synthetase;       
  226::323     3e-06  30%  459 aa  SYC_RHOFD RecName: Full=Cysteinyl-tRNA synthetase;       
  227::342     3e-06  32%  465 aa  SYC_RALSO RecName: Full=Cysteinyl-tRNA synthetase;       
  227::324     3e-06  33%  462 aa  SYC_RALEH RecName: Full=Cysteinyl-tRNA synthetase;       
  223::322     3e-06  33%  461 aa  SYC_PSEMY RecName: Full=Cysteinyl-tRNA synthetase;       
  231::328     3e-06  32%  463 aa  SYC_POLNA RecName: Full=Cysteinyl-tRNA synthetase;       
  234::329     3e-06  29%  484 aa  SYC_PELTS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::399     3e-06  34%  481 aa  SYC_PELCD RecName: Full=Cysteinyl-tRNA synthetase;       
  225::337     3e-06  28%  472 aa  SYC_LACF3 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::324     3e-06  35%  462 aa  SYC_HERAR RecName: Full=Cysteinyl-tRNA synthetase;       
  220::324     3e-06  28%  465 aa  SYC_CALS8 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::341     3e-06  33%  465 aa  SYC_BURM1 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::341     3e-06  33%  465 aa  SYC_BURCJ RecName: Full=Cysteinyl-tRNA synthetase;       
  220::324     3e-06  28%  465 aa  SYC_ANATD RecName: Full=Cysteinyl-tRNA synthetase;       
    3::59      4e-06  37%  683 aa  SYM_SHEFN RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-06  44%  689 aa  SYM_SHEDO RecName: Full=Methionyl-tRNA synthetase;       
   21::129     4e-06  35%  601 aa  SYM_PROAC RecName: Full=Methionyl-tRNA synthetase;       
   14::72      4e-06  41%  694 aa  SYM_METCA RecName: Full=Methionyl-tRNA synthetase;       
   14::121     4e-06  31%  670 aa  SYM_LEGPL RecName: Full=Methionyl-tRNA synthetase;       
   14::121     4e-06  31%  670 aa  SYM_LEGPH RecName: Full=Methionyl-tRNA synthetase;       
   14::121     4e-06  31%  670 aa  SYM_LEGPC RecName: Full=Methionyl-tRNA synthetase;       
    2::487     4e-06  27%  660 aa  SYM_BACHD RecName: Full=Methionyl-tRNA synthetase;       
   57::489     4e-06  30%  949 aa  SYL_CORA7 RecName: Full=Leucyl-tRNA synthetase;       
  222::319     4e-06  33%  454 aa  SYC_THIDA RecName: Full=Cysteinyl-tRNA synthetase;       
  225::402     4e-06  24%  470 aa  SYC_LACS1 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::324     4e-06  33%  462 aa  SYC_CUPTR RecName: Full=Cysteinyl-tRNA synthetase;       
  222::345     4e-06  24%  465 aa  SYC_ANOFW RecName: Full=Cysteinyl-tRNA synthetase;       
  212::341     4e-06  33%  465 aa  SYC2_BURS3 RecName: Full=Cysteinyl-tRNA synthetase 2;       
   15::73      6e-06  38%  676 aa  SYM_SHESR RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  38%  676 aa  SYM_SHESM RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  38%  676 aa  SYM_SHESA RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  38%  676 aa  SYM_SHEON RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  38%  679 aa  SYM_SHEHH RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  38%  675 aa  SYM_SHEAM RecName: Full=Methionyl-tRNA synthetase;       
   15::120     6e-06  33%  673 aa  SYM_OCEIH RecName: Full=Methionyl-tRNA synthetase;       
   15::73      6e-06  40%  545 aa  SYM_HAMD5 RecName: Full=Methionyl-tRNA synthetase;       
  255::334     6e-06  31%  476 aa  SYC_THEON RecName: Full=Cysteinyl-tRNA synthetase;       
  265::320     6e-06  36%  469 aa  SYC_SULAC RecName: Full=Cysteinyl-tRNA synthetase;       
  223::327     6e-06  31%  461 aa  SYC_PSEU5 RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     6e-06  34%  489 aa  SYC_PROMS RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     6e-06  34%  489 aa  SYC_PROM2 RecName: Full=Cysteinyl-tRNA synthetase;       
  224::340     6e-06  34%  489 aa  SYC_PROM0 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     6e-06  31%  464 aa  SYC_NITMU RecName: Full=Cysteinyl-tRNA synthetase;       
  193::319     6e-06  32%  487 aa  SYC_GEOLS RecName: Full=Cysteinyl-tRNA synthetase;       
  220::319     6e-06  27%  468 aa  SYC_CLOTH RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURTA RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURPS RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURP6 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURP1 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURP0 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURMS RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURMA RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURM9 RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-06  35%  465 aa  SYC_BURM7 RecName: Full=Cysteinyl-tRNA synthetase;       
   13::142     8e-06  29%  547 aa  SYM_THEAC RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  688 aa  SYM_SHEWM RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  692 aa  SYM_SHESH RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  679 aa  SYM_SHEPA RecName: Full=Methionyl-tRNA synthetase;       
   15::73      8e-06  38%  673 aa  SYM_SHELP RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  689 aa  SYM_SHEB9 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  689 aa  SYM_SHEB8 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  689 aa  SYM_SHEB5 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      8e-06  44%  689 aa  SYM_SHEB2 RecName: Full=Methionyl-tRNA synthetase;       
  223::595     8e-06  22%  683 aa  SYM_LACPL RecName: Full=Methionyl-tRNA synthetase;       
   10::78      8e-06  32%  717 aa  SYM_HALMA RecName: Full=Methionyl-tRNA synthetase;       
   12::117     8e-06  32%  692 aa  SYM_BORPE RecName: Full=Methionyl-tRNA synthetase;       
   12::117     8e-06  32%  692 aa  SYM_BORPA RecName: Full=Methionyl-tRNA synthetase;       
   12::117     8e-06  32%  692 aa  SYM_BORBR RecName: Full=Methionyl-tRNA synthetase;       
  220::321     8e-06  34%  461 aa  SYC_SHESA RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     8e-06  33%  459 aa  SYC_SHEON RecName: Full=Cysteinyl-tRNA synthetase;       
  252::318     8e-06  39%  464 aa  SYC_RHOOB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     8e-06  29%  460 aa  SYC_PSEU2 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     8e-06  29%  460 aa  SYC_PSE14 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::334     8e-06  28%  493 aa  SYC_PELPD RecName: Full=Cysteinyl-tRNA synthetase;       
  225::328     8e-06  28%  470 aa  SYC_PEDPA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::327     8e-06  30%  481 aa  SYC_HELMI RecName: Full=Cysteinyl-tRNA synthetase;       
  222::337     8e-06  28%  465 aa  SYC_HELAH RecName: Full=Cysteinyl-tRNA synthetase;       
  261::392     8e-06  27%  462 aa  SYC_FINM2 RecName: Full=Cysteinyl-tRNA synthetase;       
  254::323     8e-06  33%  465 aa  SYC_EXISA RecName: Full=Cysteinyl-tRNA synthetase;       
  254::351     8e-06  32%  465 aa  SYC_EXIS2 RecName: Full=Cysteinyl-tRNA synthetase;       
  226::323     8e-06  30%  458 aa  SYC_DIAST RecName: Full=Cysteinyl-tRNA synthetase;       
  257::369     8e-06  24%  470 aa  SYC_CLOBB RecName: Full=Cysteinyl-tRNA synthetase;       
  227::341     8e-06  31%  465 aa  SYC_BURCH RecName: Full=Cysteinyl-tRNA synthetase;       
  227::341     8e-06  31%  465 aa  SYC_BURCC RecName: Full=Cysteinyl-tRNA synthetase;       
  227::341     8e-06  31%  465 aa  SYC_BURCA RecName: Full=Cysteinyl-tRNA synthetase;       
  261::329     8e-06  42%  482 aa  SYC_ANADF RecName: Full=Cysteinyl-tRNA synthetase;       
  226::323     8e-06  30%  458 aa  SYC_ACISJ RecName: Full=Cysteinyl-tRNA synthetase;       
   12::141     1e-05  30%  584 aa  SYM_THERP RecName: Full=Methionyl-tRNA synthetase;       
   18::340     1e-05  33%  681 aa  SYM_DEIRA RecName: Full=Methionyl-tRNA synthetase;       
  253::353     1e-05  37%  539 aa  SYMM_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
   38::179     1e-05  26%  575 aa  SYMM_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
  222::327     1e-05  30%  467 aa  SYC_XYLFT RecName: Full=Cysteinyl-tRNA synthetase;       
  242::323     1e-05  35%  469 aa  SYC_THEAB RecName: Full=Cysteinyl-tRNA synthetase;       
  227::342     1e-05  32%  463 aa  SYC_RALPJ RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-05  30%  460 aa  SYC_PSEPK RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-05  30%  460 aa  SYC_PSEPG RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-05  30%  460 aa  SYC_PSEP1 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     1e-05  32%  494 aa  SYC_GEOSF RecName: Full=Cysteinyl-tRNA synthetase;       
  345::596     1e-05  29%  598 aa  SYR_BIFA0 RecName: Full=Arginyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANOR RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANOP RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANOM RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  696 aa  SYM_XANCP RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANCB RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  696 aa  SYM_XANC8 RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANC5 RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-05  43%  694 aa  SYM_XANAC RecName: Full=Methionyl-tRNA synthetase;       
   14::58      1e-05  47%  680 aa  SYM_THICR RecName: Full=Methionyl-tRNA synthetase;       
   16::485     1e-05  25%  664 aa  SYM_LISMO RecName: Full=Methionyl-tRNA synthetase;       
   17::486     1e-05  25%  665 aa  SYM_LISMF RecName: Full=Methionyl-tRNA synthetase;       
   16::485     1e-05  25%  664 aa  SYM_LISIN RecName: Full=Methionyl-tRNA synthetase;       
   14::121     1e-05  30%  670 aa  SYM_LEGPA RecName: Full=Methionyl-tRNA synthetase;       
   12::145     1e-05  28%  650 aa  SYM_HELPY RecName: Full=Methionyl-tRNA synthetase;       
    3::65      1e-05  26%  660 aa  SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1;       
  309::502     1e-05  29%  957 aa  SYL_STRGG RecName: Full=Leucyl-tRNA synthetase;       
  216::410     1e-05  32%  467 aa  SYC_WOLSU RecName: Full=Cysteinyl-tRNA synthetase;       
  222::377     1e-05  30%  463 aa  SYC_TOLAT RecName: Full=Cysteinyl-tRNA synthetase;       
  255::324     1e-05  39%  460 aa  SYC_THISH RecName: Full=Cysteinyl-tRNA synthetase;       
  257::342     1e-05  34%  447 aa  SYC_STRP8 RecName: Full=Cysteinyl-tRNA synthetase;       
  255::322     1e-05  37%  476 aa  SYC_PYRKO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-05  30%  462 aa  SYC_PSEFS RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     1e-05  33%  489 aa  SYC_PROM9 RecName: Full=Cysteinyl-tRNA synthetase;       
  217::300     1e-05  29%  413 aa  SYC_MYCMO RecName: Full=Cysteinyl-tRNA synthetase;       
  257::317     1e-05  34%  441 aa  SYC_MESFL RecName: Full=Cysteinyl-tRNA synthetase;       
   12::56      2e-05  47%  674 aa  SYM_NITOC RecName: Full=Methionyl-tRNA synthetase;       
   10::89      2e-05  35%  776 aa  SYM_NANEQ RecName: Full=Methionyl-tRNA synthetase;       
   12::56      2e-05  47%  675 aa  SYM_ALHEH RecName: Full=Methionyl-tRNA synthetase;       
  278::374     2e-05  37%  593 aa  SYMM_HUMAN RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    1::154     2e-05  25%  954 aa  SYL_FLAJ1 RecName: Full=Leucyl-tRNA synthetase;       
   10::144     2e-05  27%  923 aa  SYL_AMOA5 RecName: Full=Leucyl-tRNA synthetase;       
   43::78      2e-05  49%   92 aa  SYI_ENTAE RecName: Full=Isoleucyl-tRNA synthetase;       
  224::328     2e-05  31%  461 aa  SYC_VIBF1 RecName: Full=Cysteinyl-tRNA synthetase;       
  256::322     2e-05  34%  466 aa  SYC_THEFY RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     2e-05  31%  459 aa  SYC_SHEDO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     2e-05  30%  460 aa  SYC_PSEPF RecName: Full=Cysteinyl-tRNA synthetase;       
  254::331     2e-05  29%  475 aa  SYC_METVS RecName: Full=Cysteinyl-tRNA synthetase;       
  227::324     2e-05  34%  464 aa  SYC_JANMA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::333     2e-05  28%  465 aa  SYC_HELPH RecName: Full=Cysteinyl-tRNA synthetase;       
  228::336     2e-05  27%  486 aa  SYC_CYAP7 RecName: Full=Cysteinyl-tRNA synthetase;       
  253::318     2e-05  35%  470 aa  SYC_CLOPH RecName: Full=Cysteinyl-tRNA synthetase;       
  224::369     2e-05  22%  470 aa  SYC_CLOBA RecName: Full=Cysteinyl-tRNA synthetase;       
  223::327     2e-05  30%  461 aa  SYC_AZOVD RecName: Full=Cysteinyl-tRNA synthetase;       
  262::336     2e-05  36%  488 aa  SYC_ARTCA RecName: Full=Cysteinyl-tRNA synthetase;       
  272::336     2e-05  38%  484 aa  SYC_ARTAT RecName: Full=Cysteinyl-tRNA synthetase;       
  409::464     2e-05  41%  613 aa  SYC1_STRCO RecName: Full=Cysteinyl-tRNA synthetase 1;       
  341::512     2e-05  26%  700 aa  SYM_PELPB RecName: Full=Methionyl-tRNA synthetase;       
  287::362     2e-05  41%  509 aa  SYM_MYCPU RecName: Full=Methionyl-tRNA synthetase;       
   11::124     2e-05  36%  623 aa  SYM_BIFA0 RecName: Full=Methionyl-tRNA synthetase;       
  278::374     2e-05  34%  593 aa  SYMM_BOVIN RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    3::65      2e-05  25%  660 aa  SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1;       
  397::507     2e-05  36%  962 aa  SYL_STRAW RecName: Full=Leucyl-tRNA synthetase;       
   72::470     2e-05  27%  950 aa  SYL_MYCSS RecName: Full=Leucyl-tRNA synthetase;       
   72::470     2e-05  27%  950 aa  SYL_MYCSK RecName: Full=Leucyl-tRNA synthetase;       
   72::470     2e-05  27%  950 aa  SYL_MYCSJ RecName: Full=Leucyl-tRNA synthetase;       
    3::103     2e-05  22% 1176 aa  SYLC_PONAB RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  267::327     2e-05  33%  471 aa  SYC_SULTO RecName: Full=Cysteinyl-tRNA synthetase;       
  220::321     2e-05  33%  461 aa  SYC_SHESW RecName: Full=Cysteinyl-tRNA synthetase;       
  220::321     2e-05  33%  461 aa  SYC_SHEPC RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     2e-05  33%  459 aa  SYC_SHEB9 RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     2e-05  33%  459 aa  SYC_SHEB8 RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     2e-05  33%  459 aa  SYC_SHEB5 RecName: Full=Cysteinyl-tRNA synthetase;       
  218::319     2e-05  33%  459 aa  SYC_SHEB2 RecName: Full=Cysteinyl-tRNA synthetase;       
  218::326     2e-05  31%  459 aa  SYC_SHEAM RecName: Full=Cysteinyl-tRNA synthetase;       
  252::318     2e-05  37%  464 aa  SYC_RHOSR RecName: Full=Cysteinyl-tRNA synthetase;       
  226::330     2e-05  29%  500 aa  SYC_PROMT RecName: Full=Cysteinyl-tRNA synthetase;       
  270::334     2e-05  37%  487 aa  SYC_ARTS2 RecName: Full=Cysteinyl-tRNA synthetase;       
   14::121     3e-05  26%  658 aa  SYM_STAS1 RecName: Full=Methionyl-tRNA synthetase;       
   14::124     3e-05  35%  577 aa  SYM_RUBXD RecName: Full=Methionyl-tRNA synthetase;       
   14::94      3e-05  37%  702 aa  SYM_PROVI RecName: Full=Methionyl-tRNA synthetase;       
   15::73      3e-05  36%  675 aa  SYM_PHOLL RecName: Full=Methionyl-tRNA synthetase;       
   10::77      3e-05  33%  698 aa  SYM_NATPD RecName: Full=Methionyl-tRNA synthetase;       
    4::141     3e-05  28%  673 aa  SYM_METLZ RecName: Full=Methionyl-tRNA synthetase;       
    2::59      3e-05  36%  677 aa  SYM_IDILO RecName: Full=Methionyl-tRNA synthetase;       
   16::65      3e-05  36%  664 aa  SYM_BACSU RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-05  44%  685 aa  SYM_ACTSZ RecName: Full=Methionyl-tRNA synthetase;       
   71::493     3e-05  29%  953 aa  SYL_MYCS2 RecName: Full=Leucyl-tRNA synthetase;       
  209::600     3e-05  20% 1090 aa  SYLC_YEAST RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  222::326     3e-05  31%  459 aa  SYC_VIBCM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-05  31%  459 aa  SYC_VIBCH RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-05  31%  459 aa  SYC_VIBC3 RecName: Full=Cysteinyl-tRNA synthetase;       
  195::343     3e-05  27%  487 aa  SYC_THEYD RecName: Full=Cysteinyl-tRNA synthetase;       
  271::369     3e-05  28%  525 aa  SYC_SYNJB RecName: Full=Cysteinyl-tRNA synthetase;       
  257::342     3e-05  33%  447 aa  SYC_STRPM RecName: Full=Cysteinyl-tRNA synthetase;       
  257::342     3e-05  33%  447 aa  SYC_STRP6 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::342     3e-05  33%  447 aa  SYC_STRP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::342     3e-05  33%  447 aa  SYC_STRP1 RecName: Full=Cysteinyl-tRNA synthetase;       
  243::317     3e-05  37%  466 aa  SYC_STRGG RecName: Full=Cysteinyl-tRNA synthetase;       
  220::321     3e-05  33%  461 aa  SYC_SHESR RecName: Full=Cysteinyl-tRNA synthetase;       
  220::321     3e-05  33%  461 aa  SYC_SHESM RecName: Full=Cysteinyl-tRNA synthetase;       
  195::334     3e-05  30%  468 aa  SYC_PARL1 RecName: Full=Cysteinyl-tRNA synthetase;       
  255::343     3e-05  27%  466 aa  SYC_LYSSC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::333     3e-05  27%  465 aa  SYC_HELPS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::333     3e-05  27%  465 aa  SYC_HELPJ RecName: Full=Cysteinyl-tRNA synthetase;       
  216::318     3e-05  30%  485 aa  SYC_DESMR RecName: Full=Cysteinyl-tRNA synthetase;       
  245::321     3e-05  38%  457 aa  SYC_DEHSC RecName: Full=Cysteinyl-tRNA synthetase;       
  245::321     3e-05  38%  457 aa  SYC_DEHSB RecName: Full=Cysteinyl-tRNA synthetase;       
  245::321     3e-05  38%  458 aa  SYC_DEHE1 RecName: Full=Cysteinyl-tRNA synthetase;       
  262::333     3e-05  37%  494 aa  SYC_CYAP4 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-05  32%  464 aa  SYC1_PHOPR RecName: Full=Cysteinyl-tRNA synthetase 1;       
  345::539     4e-05  32%  596 aa  SYR_BIFAA RecName: Full=Arginyl-tRNA synthetase;       
    4::129     4e-05  31%  570 aa  SYM_PYRCJ RecName: Full=Methionyl-tRNA synthetase;       
  169::238     4e-05  30%  663 aa  SYM_METMP RecName: Full=Methionyl-tRNA synthetase;       
    3::68      4e-05  33%  678 aa  SYM_MARAV RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-05  44%  686 aa  SYM_MANSM RecName: Full=Methionyl-tRNA synthetase;       
   11::74      4e-05  35%  689 aa  SYM_HALSA RecName: Full=Methionyl-tRNA synthetase;       
   12::56      4e-05  47%  679 aa  SYM_HALHL RecName: Full=Methionyl-tRNA synthetase;       
   27::169     4e-05  37%  722 aa  SYM_BURM1 RecName: Full=Methionyl-tRNA synthetase;       
   15::75      4e-05  38%  547 aa  SYM_BUCAT RecName: Full=Methionyl-tRNA synthetase;       
   15::75      4e-05  38%  547 aa  SYM_BUCAI RecName: Full=Methionyl-tRNA synthetase;       
   15::75      4e-05  38%  547 aa  SYM_BUCA5 RecName: Full=Methionyl-tRNA synthetase;       
   11::124     4e-05  35%  621 aa  SYM_BIFLO RecName: Full=Methionyl-tRNA synthetase;       
   11::124     4e-05  35%  621 aa  SYM_BIFLI RecName: Full=Methionyl-tRNA synthetase;       
   11::124     4e-05  34%  620 aa  SYM_BIFAA RecName: Full=Methionyl-tRNA synthetase;       
   11::143     4e-05  26%  962 aa  SYL_GRAFK RecName: Full=Leucyl-tRNA synthetase;       
  222::326     4e-05  29%  460 aa  SYC_PSEF5 RecName: Full=Cysteinyl-tRNA synthetase;       
  226::330     4e-05  29%  500 aa  SYC_PROM1 RecName: Full=Cysteinyl-tRNA synthetase;       
  255::399     4e-05  28%  468 aa  SYC_OCEIH RecName: Full=Cysteinyl-tRNA synthetase;       
  225::384     4e-05  25%  470 aa  SYC_LACRJ RecName: Full=Cysteinyl-tRNA synthetase;       
  225::384     4e-05  25%  470 aa  SYC_LACRD RecName: Full=Cysteinyl-tRNA synthetase;       
  222::333     4e-05  27%  465 aa  SYC_HELPY RecName: Full=Cysteinyl-tRNA synthetase;       
  280::355     4e-05  37%  524 aa  SYC_FRASC RecName: Full=Cysteinyl-tRNA synthetase;       
  221::327     4e-05  31%  460 aa  SYC_COXBU RecName: Full=Cysteinyl-tRNA synthetase;       
  219::325     4e-05  31%  458 aa  SYC_COXBR RecName: Full=Cysteinyl-tRNA synthetase;       
  219::325     4e-05  31%  458 aa  SYC_COXBN RecName: Full=Cysteinyl-tRNA synthetase;       
  261::320     4e-05  40%  474 aa  SYC_BEUC1 RecName: Full=Cysteinyl-tRNA synthetase;       
   23::73      5e-05  41%  702 aa  SYM_XYLFT RecName: Full=Methionyl-tRNA synthetase;       
   23::73      5e-05  41%  702 aa  SYM_XYLFM RecName: Full=Methionyl-tRNA synthetase;       
   23::73      5e-05  41%  702 aa  SYM_XYLFA RecName: Full=Methionyl-tRNA synthetase;       
   23::73      5e-05  41%  702 aa  SYM_XYLF2 RecName: Full=Methionyl-tRNA synthetase;       
   14::121     5e-05  35%  606 aa  SYM_THEFY RecName: Full=Methionyl-tRNA synthetase;       
  171::517     5e-05  21%  741 aa  SYM_PYRKO RecName: Full=Methionyl-tRNA synthetase;       
    5::141     5e-05  28%  663 aa  SYM_METPE RecName: Full=Methionyl-tRNA synthetase;       
   11::139     5e-05  33%  663 aa  SYM_METM7 RecName: Full=Methionyl-tRNA synthetase;       
   11::139     5e-05  33%  663 aa  SYM_METM5 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      5e-05  44%  683 aa  SYM_HAES2 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      5e-05  44%  683 aa  SYM_HAES1 RecName: Full=Methionyl-tRNA synthetase;       
   15::143     5e-05  30%  689 aa  SYM_CYTH3 RecName: Full=Methionyl-tRNA synthetase;       
   31::75      5e-05  44%  713 aa  SYM_COLP3 RecName: Full=Methionyl-tRNA synthetase;       
   11::79      5e-05  37%  685 aa  SYM_ACIAD RecName: Full=Methionyl-tRNA synthetase;       
    3::399     5e-05  21% 1176 aa  SYLC_HUMAN RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  222::326     5e-05  30%  461 aa  SYC_VIBSL RecName: Full=Cysteinyl-tRNA synthetase;       
  250::348     5e-05  27%  506 aa  SYC_SYNJA RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     5e-05  30%  447 aa  SYC_STRA5 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     5e-05  30%  447 aa  SYC_STRA3 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     5e-05  30%  447 aa  SYC_STRA1 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::333     5e-05  27%  465 aa  SYC_HELP2 RecName: Full=Cysteinyl-tRNA synthetase;       
  219::318     5e-05  28%  485 aa  SYC_DESAD RecName: Full=Cysteinyl-tRNA synthetase;       
   14::64      6e-05  39%  691 aa  SYM_VEREI RecName: Full=Methionyl-tRNA synthetase;       
    7::105     6e-05  36%  593 aa  SYM_SACEN RecName: Full=Methionyl-tRNA synthetase;       
   15::59      6e-05  40%  686 aa  SYM_PSYIN RecName: Full=Methionyl-tRNA synthetase;       
   14::64      6e-05  41%  682 aa  SYM_PSESM RecName: Full=Methionyl-tRNA synthetase;       
   13::57      6e-05  42%  673 aa  SYM_PSEHT RecName: Full=Methionyl-tRNA synthetase;       
   13::112     6e-05  32%  728 aa  SYM_NITMU RecName: Full=Methionyl-tRNA synthetase;       
   12::128     6e-05  29%  703 aa  SYM_MYXXD RecName: Full=Methionyl-tRNA synthetase;       
  249::345     6e-05  31%  537 aa  SYM_MYCLE RecName: Full=Methionyl-tRNA synthetase;       
   26::95      6e-05  38%  692 aa  SYM_METFK RecName: Full=Methionyl-tRNA synthetase;       
   15::141     6e-05  25%  644 aa  SYM_CLOAB RecName: Full=Methionyl-tRNA synthetase;       
    3::64      6e-05  35%  681 aa  SYM_AZOVD RecName: Full=Methionyl-tRNA synthetase;       
   12::62      6e-05  43%  723 aa  SYM_AZOSB RecName: Full=Methionyl-tRNA synthetase;       
   12::56      6e-05  44%  678 aa  SYM_ACIF5 RecName: Full=Methionyl-tRNA synthetase;       
   12::56      6e-05  44%  678 aa  SYM_ACIF2 RecName: Full=Methionyl-tRNA synthetase;       
  222::327     6e-05  30%  467 aa  SYC_XYLFA RecName: Full=Cysteinyl-tRNA synthetase;       
  261::309     6e-05  49%  462 aa  SYC_XANP2 RecName: Full=Cysteinyl-tRNA synthetase;       
  223::320     6e-05  32%  456 aa  SYC_THICR RecName: Full=Cysteinyl-tRNA synthetase;       
  262::317     6e-05  39%  460 aa  SYC_THESQ RecName: Full=Cysteinyl-tRNA synthetase;       
  262::317     6e-05  39%  460 aa  SYC_THEP1 RecName: Full=Cysteinyl-tRNA synthetase;       
  262::322     6e-05  38%  460 aa  SYC_THENN RecName: Full=Cysteinyl-tRNA synthetase;       
  262::317     6e-05  39%  460 aa  SYC_THEMA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     6e-05  32%  457 aa  SYC_SODGM RecName: Full=Cysteinyl-tRNA synthetase;       
  269::326     6e-05  38%  471 aa  SYC_NOCSJ RecName: Full=Cysteinyl-tRNA synthetase;       
  262::378     6e-05  31%  441 aa  SYC_MYCCT RecName: Full=Cysteinyl-tRNA synthetase;       
  194::329     6e-05  27%  461 aa  SYC_HYPNA RecName: Full=Cysteinyl-tRNA synthetase;       
  256::325     6e-05  34%  473 aa  SYC_FUSNN RecName: Full=Cysteinyl-tRNA synthetase;       
  229::331     6e-05  28%  469 aa  SYC_COLP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  223::323     6e-05  27%  468 aa  SYC_CLOD6 RecName: Full=Cysteinyl-tRNA synthetase;       
  220::319     6e-05  32%  465 aa  SYC_CARHZ RecName: Full=Cysteinyl-tRNA synthetase;       
  212::324     6e-05  33%  465 aa  SYC_BURXL RecName: Full=Cysteinyl-tRNA synthetase;       
  230::480     8e-05  23%  532 aa  SYM_SYNY3 RecName: Full=Methionyl-tRNA synthetase;       
   12::62      8e-05  41%  700 aa  SYM_RHOFD RecName: Full=Methionyl-tRNA synthetase;       
    5::239     8e-05  29%  672 aa  SYM_META3 RecName: Full=Methionyl-tRNA synthetase;       
   15::76      8e-05  40%  681 aa  SYM_HAHCH RecName: Full=Methionyl-tRNA synthetase;       
   15::485     8e-05  24%  669 aa  SYM_ENTFA RecName: Full=Methionyl-tRNA synthetase;       
   12::62      8e-05  41%  718 aa  SYM_AZOSE RecName: Full=Methionyl-tRNA synthetase;       
  332::512     8e-05  32%  969 aa  SYL_MYCPA RecName: Full=Leucyl-tRNA synthetase;       
   68::486     8e-05  28%  949 aa  SYL_MYCGI RecName: Full=Leucyl-tRNA synthetase;       
  745::890     8e-05  35%  976 aa  SYL_CORJK RecName: Full=Leucyl-tRNA synthetase;       
  224::329     8e-05  26%  476 aa  SYC_XANOR RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     8e-05  26%  476 aa  SYC_XANOM RecName: Full=Cysteinyl-tRNA synthetase;       
  245::314     8e-05  33%  436 aa  SYC_UREPA RecName: Full=Cysteinyl-tRNA synthetase;       
  262::317     8e-05  36%  464 aa  SYC_SACEN RecName: Full=Cysteinyl-tRNA synthetase;       
  274::362     8e-05  39%  488 aa  SYC_RHOPB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     8e-05  29%  460 aa  SYC_PSEPW RecName: Full=Cysteinyl-tRNA synthetase;       
  224::322     8e-05  31%  492 aa  SYC_PROMP RecName: Full=Cysteinyl-tRNA synthetase;       
  213::312     8e-05  30%  465 aa  SYC_NITSB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::377     8e-05  28%  489 aa  SYC_DESPS RecName: Full=Cysteinyl-tRNA synthetase;       
  252::316     8e-05  37%  467 aa  SYC1_NOCFA RecName: Full=Cysteinyl-tRNA synthetase 1;       
  171::241     1e-04  27%  724 aa  SYM_PYRFU RecName: Full=Methionyl-tRNA synthetase;       
   26::76      1e-04  41%  710 aa  SYM_BURXL RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  41%  720 aa  SYM_BURS3 RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  41%  718 aa  SYM_BURCJ RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  41%  718 aa  SYM_BURCH RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  41%  716 aa  SYM_BURCC RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  41%  718 aa  SYM_BURCA RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-04  41%  691 aa  SYM_BORA1 RecName: Full=Methionyl-tRNA synthetase;       
  224::329     1e-04  26%  476 aa  SYC_XANC5 RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     1e-04  26%  476 aa  SYC_XANAC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-04  30%  460 aa  SYC_VIBVY RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-04  30%  460 aa  SYC_VIBVU RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-04  30%  459 aa  SYC_SHEWM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-04  30%  459 aa  SYC_SHELP RecName: Full=Cysteinyl-tRNA synthetase;       
  271::372     1e-04  40%  473 aa  SYC_NEIMB RecName: Full=Cysteinyl-tRNA synthetase;       
  258::325     1e-04  33%  468 aa  SYC_LACCB RecName: Full=Cysteinyl-tRNA synthetase;       
  258::325     1e-04  33%  468 aa  SYC_LACC3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     1e-04  30%  461 aa  SYC_EDWI9 RecName: Full=Cysteinyl-tRNA synthetase;       
   12::62      1e-04  39%  692 aa  SYM_STRMK RecName: Full=Methionyl-tRNA synthetase;       
   12::62      1e-04  39%  693 aa  SYM_STRM5 RecName: Full=Methionyl-tRNA synthetase;       
  223::348     1e-04  30%  516 aa  SYM_RHILO RecName: Full=Methionyl-tRNA synthetase;       
   13::63      1e-04  39%  706 aa  SYM_NITEU RecName: Full=Methionyl-tRNA synthetase;       
   11::61      1e-04  41%  686 aa  SYM_MAGSM RecName: Full=Methionyl-tRNA synthetase;       
   14::94      1e-04  33%  702 aa  SYM_CHLL2 RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  39%  720 aa  SYM_BURCM RecName: Full=Methionyl-tRNA synthetase;       
   27::77      1e-04  39%  720 aa  SYM_BURA4 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      1e-04  42%  677 aa  SYM_AERHH RecName: Full=Methionyl-tRNA synthetase;       
  423::512     1e-04  35%  969 aa  SYL_MYCA1 RecName: Full=Leucyl-tRNA synthetase;       
  224::329     1e-04  26%  457 aa  SYC_XANCP RecName: Full=Cysteinyl-tRNA synthetase;       
  224::329     1e-04  26%  457 aa  SYC_XANC8 RecName: Full=Cysteinyl-tRNA synthetase;       
  214::339     1e-04  26%  466 aa  SYC_SULDN RecName: Full=Cysteinyl-tRNA synthetase;       
  257::324     1e-04  31%  447 aa  SYC_STRT2 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::324     1e-04  31%  447 aa  SYC_STRT1 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     1e-04  31%  439 aa  SYC_SHIBS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     1e-04  31%  461 aa  SYC_SHIB3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     1e-04  30%  459 aa  SYC_SHEHH RecName: Full=Cysteinyl-tRNA synthetase;       
  224::328     1e-04  29%  492 aa  SYC_PROM5 RecName: Full=Cysteinyl-tRNA synthetase;       
  497::566     1e-04  38%  699 aa  SYC_NEIMA RecName: Full=Cysteinyl-tRNA synthetase;       
  271::340     1e-04  38%  473 aa  SYC_NEIG1 RecName: Full=Cysteinyl-tRNA synthetase;       
  231::325     1e-04  32%  477 aa  SYC_DESHY RecName: Full=Cysteinyl-tRNA synthetase;       
  231::325     1e-04  32%  477 aa  SYC_DESHD RecName: Full=Cysteinyl-tRNA synthetase;       
  224::328     1e-04  29%  462 aa  SYC_ALISL RecName: Full=Cysteinyl-tRNA synthetase;       
  253::335     1e-04  29%  434 aa  SYC_ACHLI RecName: Full=Cysteinyl-tRNA synthetase;       
  262::317     1e-04  38%  466 aa  SYC1_STRAW RecName: Full=Cysteinyl-tRNA synthetase 1;       
   20::78      2e-04  34%  690 aa  SYM_VIBVY RecName: Full=Methionyl-tRNA synthetase;       
   20::78      2e-04  34%  690 aa  SYM_VIBVU RecName: Full=Methionyl-tRNA synthetase;       
   13::63      2e-04  39%  701 aa  SYM_NITEC RecName: Full=Methionyl-tRNA synthetase;       
   14::58      2e-04  42%  684 aa  SYM_HAEDU RecName: Full=Methionyl-tRNA synthetase;       
   15::73      2e-04  34%  677 aa  SYM_ENT38 RecName: Full=Methionyl-tRNA synthetase;       
   27::105     2e-04  38%  721 aa  SYM_BURVG RecName: Full=Methionyl-tRNA synthetase;       
  262::390     2e-04  29%  463 aa  SYC_THELT RecName: Full=Cysteinyl-tRNA synthetase;       
  218::326     2e-04  31%  460 aa  SYC_SHEFN RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     2e-04  30%  463 aa  SYC_PROMH RecName: Full=Cysteinyl-tRNA synthetase;       
  271::327     2e-04  32%  469 aa  SYC_PETMO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     2e-04  28%  456 aa  SYC_LEGPL RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     2e-04  28%  456 aa  SYC_LEGPH RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     2e-04  28%  456 aa  SYC_LEGPC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     2e-04  28%  456 aa  SYC_LEGPA RecName: Full=Cysteinyl-tRNA synthetase;       
  258::327     2e-04  32%  468 aa  SYC_LACSS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     2e-04  29%  465 aa  SYC_HELPG RecName: Full=Cysteinyl-tRNA synthetase;       
  281::341     2e-04  28%  494 aa  SYC_HALSA RecName: Full=Cysteinyl-tRNA synthetase;       
  263::331     2e-04  28%  468 aa  SYC_BREBN RecName: Full=Cysteinyl-tRNA synthetase;       
  261::375     2e-04  32%  462 aa  SYC_AZOC5 RecName: Full=Cysteinyl-tRNA synthetase;       
  253::319     2e-04  31%  464 aa  SYC_ALKMQ RecName: Full=Cysteinyl-tRNA synthetase;       
   15::73      2e-04  34%  679 aa  SYM_SODGM RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHISS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHIFL RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHIF8 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHIDS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHIBS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SHIB3 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALTY RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALTI RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALSV RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALPK RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALPC RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALPB RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALPA RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALNS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALHS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALG2 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALEP RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALDC RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALCH RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALAR RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_SALA4 RecName: Full=Methionyl-tRNA synthetase;       
   13::63      2e-04  41%  690 aa  SYM_RALME RecName: Full=Methionyl-tRNA synthetase;       
   13::63      2e-04  41%  688 aa  SYM_RALEJ RecName: Full=Methionyl-tRNA synthetase;       
   13::63      2e-04  41%  686 aa  SYM_RALEH RecName: Full=Methionyl-tRNA synthetase;       
   14::90      2e-04  37%  681 aa  SYM_PSEF5 RecName: Full=Methionyl-tRNA synthetase;       
   14::93      2e-04  35%  702 aa  SYM_PELLD RecName: Full=Methionyl-tRNA synthetase;       
  307::516     2e-04  23%  698 aa  SYM_PARUW RecName: Full=Methionyl-tRNA synthetase;       
   12::62      2e-04  39%  697 aa  SYM_METPP RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_KLEP7 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_KLEP3 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ESCF3 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ENTS8 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOUT RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOSM RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOSE RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOLU RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOLI RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOLC RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOL6 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOL5 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOK1 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOHS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECODH RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECOBW RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO8A RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO81 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO7I RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO5E RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO57 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO55 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO45 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO27 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_ECO24 RecName: Full=Methionyl-tRNA synthetase;       
   13::63      2e-04  41%  688 aa  SYM_CUPTR RecName: Full=Methionyl-tRNA synthetase;       
   15::59      2e-04  40%  677 aa  SYM_CITK8 RecName: Full=Methionyl-tRNA synthetase;       
   16::66      2e-04  39%  689 aa  SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase;       
   22::120     2e-04  37%  686 aa  SYM_ALCBS RecName: Full=Methionyl-tRNA synthetase;       
  261::359     2e-04  29%  562 aa  SYMM_XENLA RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
  268::331     2e-04  37%  463 aa  SYC_WIGBR RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     2e-04  29%  460 aa  SYC_VIBPA RecName: Full=Cysteinyl-tRNA synthetase;       
  256::327     2e-04  34%  458 aa  SYC_TERTT RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     2e-04  41%  459 aa  SYC_RICAH RecName: Full=Cysteinyl-tRNA synthetase;       
  250::316     2e-04  36%  463 aa  SYC_MYCVP RecName: Full=Cysteinyl-tRNA synthetase;       
  262::327     2e-04  31%  441 aa  SYC_MYCMS RecName: Full=Cysteinyl-tRNA synthetase;       
  269::332     2e-04  34%  477 aa  SYC_LEIXX RecName: Full=Cysteinyl-tRNA synthetase;       
  222::331     2e-04  30%  461 aa  SYC_KLEP7 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::331     2e-04  30%  461 aa  SYC_KLEP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRATW RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRATT RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRATO RecName: Full=Cysteinyl-tRNA synthetase;       
  254::323     2e-04  33%  459 aa  SYC_FRATN RecName: Full=Cysteinyl-tRNA synthetase;       
  254::323     2e-04  33%  459 aa  SYC_FRATM RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRATH RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRATF RecName: Full=Cysteinyl-tRNA synthetase;       
  259::328     2e-04  33%  464 aa  SYC_FRAT1 RecName: Full=Cysteinyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPY RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPP RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPN RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPG RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPE RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPB RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERPA RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERP3 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_YERE8 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  38%  675 aa  SYM_TOLAT RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_SERP5 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  40%  675 aa  SYM_PROMH RecName: Full=Methionyl-tRNA synthetase;       
   13::63      3e-04  39%  689 aa  SYM_POLSJ RecName: Full=Methionyl-tRNA synthetase;       
   12::79      3e-04  36%  685 aa  SYM_NEIMB RecName: Full=Methionyl-tRNA synthetase;       
   11::139     3e-04  28%  663 aa  SYM_METVS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  42%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  42%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  42%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  42%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
   15::59      3e-04  42%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
   15::73      3e-04  33%  676 aa  SYM_ERWCT RecName: Full=Methionyl-tRNA synthetase;       
   13::63      3e-04  39%  688 aa  SYM_DIAST RecName: Full=Methionyl-tRNA synthetase;       
   15::65      3e-04  37%  546 aa  SYM_COXBU RecName: Full=Methionyl-tRNA synthetase;       
   15::65      3e-04  37%  546 aa  SYM_COXBR RecName: Full=Methionyl-tRNA synthetase;       
   15::65      3e-04  37%  546 aa  SYM_COXBN RecName: Full=Methionyl-tRNA synthetase;       
   15::65      3e-04  37%  546 aa  SYM_COXB2 RecName: Full=Methionyl-tRNA synthetase;       
   15::65      3e-04  37%  546 aa  SYM_COXB1 RecName: Full=Methionyl-tRNA synthetase;       
   17::97      3e-04  34%  705 aa  SYM_CHLCH RecName: Full=Methionyl-tRNA synthetase;       
   27::71      3e-04  40%  718 aa  SYM_BURTA RecName: Full=Methionyl-tRNA synthetase;       
   15::143     3e-04  30%  680 aa  SYM_BACV8 RecName: Full=Methionyl-tRNA synthetase;       
   13::63      3e-04  39%  688 aa  SYM_ACISJ RecName: Full=Methionyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPY RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPP RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPN RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPG RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPE RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERPA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     3e-04  29%  461 aa  SYC_YERE8 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     3e-04  29%  459 aa  SYC_SHESH RecName: Full=Cysteinyl-tRNA synthetase;       
  265::331     3e-04  36%  477 aa  SYC_MYCS2 RecName: Full=Cysteinyl-tRNA synthetase;       
  254::320     3e-04  34%  467 aa  SYC_MYCGI RecName: Full=Cysteinyl-tRNA synthetase;       
  229::345     3e-04  29%  490 aa  SYC_MAGSM RecName: Full=Cysteinyl-tRNA synthetase;       
  248::376     3e-04  33%  460 aa  SYC_CAMLR RecName: Full=Cysteinyl-tRNA synthetase;       
  258::317     3e-04  25%  438 aa  SYC_AYWBP RecName: Full=Cysteinyl-tRNA synthetase;       
  253::328     3e-04  29%  464 aa  SYC_ALKOO RecName: Full=Cysteinyl-tRNA synthetase;       
  292::612     4e-04  29%  620 aa  SYR_BIFLO RecName: Full=Arginyl-tRNA synthetase;       
   14::72      4e-04  36%  550 aa  SYM_WIGBR RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  40%  686 aa  SYM_VIBSL RecName: Full=Methionyl-tRNA synthetase;       
   20::64      4e-04  40%  688 aa  SYM_VIBPA RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  40%  686 aa  SYM_VIBHB RecName: Full=Methionyl-tRNA synthetase;       
   15::73      4e-04  34%  686 aa  SYM_VIBFM RecName: Full=Methionyl-tRNA synthetase;       
   15::73      4e-04  34%  686 aa  SYM_VIBF1 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  40%  683 aa  SYM_VIBCH RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  40%  683 aa  SYM_VIBC3 RecName: Full=Methionyl-tRNA synthetase;       
   14::121     4e-04  31%  665 aa  SYM_STRR6 RecName: Full=Methionyl-tRNA synthetase;       
   14::121     4e-04  31%  665 aa  SYM_STRPN RecName: Full=Methionyl-tRNA synthetase;       
    4::275     4e-04  30%  567 aa  SYM_PYRIL RecName: Full=Methionyl-tRNA synthetase;       
   14::64      4e-04  41%  682 aa  SYM_PSEU2 RecName: Full=Methionyl-tRNA synthetase;       
   14::64      4e-04  41%  679 aa  SYM_PSEPG RecName: Full=Methionyl-tRNA synthetase;       
   14::64      4e-04  41%  683 aa  SYM_PSEPF RecName: Full=Methionyl-tRNA synthetase;       
   14::64      4e-04  41%  683 aa  SYM_PSEFS RecName: Full=Methionyl-tRNA synthetase;       
   14::64      4e-04  41%  682 aa  SYM_PSE14 RecName: Full=Methionyl-tRNA synthetase;       
   13::63      4e-04  39%  707 aa  SYM_POLNA RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  38%  676 aa  SYM_PECCP RecName: Full=Methionyl-tRNA synthetase;       
   15::59      4e-04  40%  676 aa  SYM_ERWT9 RecName: Full=Methionyl-tRNA synthetase;       
   15::95      4e-04  35%  703 aa  SYM_CHLTE RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURPS RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURP6 RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURP1 RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURP0 RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURMS RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURMA RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURM9 RecName: Full=Methionyl-tRNA synthetase;       
   27::71      4e-04  40%  725 aa  SYM_BURM7 RecName: Full=Methionyl-tRNA synthetase;       
    3::58      4e-04  34%  687 aa  SYM_BDEBA RecName: Full=Methionyl-tRNA synthetase;       
   12::56      4e-04  42%  682 aa  SYM_ACTPJ RecName: Full=Methionyl-tRNA synthetase;       
   12::56      4e-04  42%  682 aa  SYM_ACTP7 RecName: Full=Methionyl-tRNA synthetase;       
   12::56      4e-04  42%  679 aa  SYM_ACTP2 RecName: Full=Methionyl-tRNA synthetase;       
  271::367     4e-04  29%  586 aa  SYMM_MOUSE RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
  258::327     4e-04  29%  448 aa  SYC_STREM RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICRS RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICRO RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICPU RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICFE RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICCN RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICCK RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     4e-04  41%  459 aa  SYC_RICAE RecName: Full=Cysteinyl-tRNA synthetase;       
  256::329     4e-04  31%  459 aa  SYC_RHORT RecName: Full=Cysteinyl-tRNA synthetase;       
  249::311     4e-04  37%  493 aa  SYC_RENSM RecName: Full=Cysteinyl-tRNA synthetase;       
  226::324     4e-04  32%  499 aa  SYC_PROMA RecName: Full=Cysteinyl-tRNA synthetase;       
  266::332     4e-04  34%  481 aa  SYC_MYCSS RecName: Full=Cysteinyl-tRNA synthetase;       
  266::332     4e-04  34%  481 aa  SYC_MYCSK RecName: Full=Cysteinyl-tRNA synthetase;       
  266::332     4e-04  34%  481 aa  SYC_MYCSJ RecName: Full=Cysteinyl-tRNA synthetase;       
  223::325     4e-04  28%  459 aa  SYC_IDILO RecName: Full=Cysteinyl-tRNA synthetase;       
  222::377     4e-04  29%  459 aa  SYC_HAEIG RecName: Full=Cysteinyl-tRNA synthetase;       
  259::348     4e-04  29%  487 aa  SYC_CHLTE RecName: Full=Cysteinyl-tRNA synthetase;       
  256::313     4e-04  36%  463 aa  SYC_BUCAP RecName: Full=Cysteinyl-tRNA synthetase;       
   12::109     5e-04  35%  690 aa  SYM_THIDA RecName: Full=Methionyl-tRNA synthetase;       
    3::64      5e-04  34%  679 aa  SYM_PSEU5 RecName: Full=Methionyl-tRNA synthetase;       
    3::64      5e-04  32%  678 aa  SYM_PSEMY RecName: Full=Methionyl-tRNA synthetase;       
   14::64      5e-04  41%  679 aa  SYM_PSEE4 RecName: Full=Methionyl-tRNA synthetase;       
   14::64      5e-04  39%  677 aa  SYM_PSEAE RecName: Full=Methionyl-tRNA synthetase;       
   14::64      5e-04  39%  678 aa  SYM_PSEAB RecName: Full=Methionyl-tRNA synthetase;       
   14::64      5e-04  39%  677 aa  SYM_PSEA8 RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  674 aa  SYM_FRATW RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  674 aa  SYM_FRATT RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  673 aa  SYM_FRATN RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  674 aa  SYM_FRATH RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  674 aa  SYM_FRATF RecName: Full=Methionyl-tRNA synthetase;       
   11::63      5e-04  40%  674 aa  SYM_FRAT1 RecName: Full=Methionyl-tRNA synthetase;       
   14::93      5e-04  35%  700 aa  SYM_CHLT3 RecName: Full=Methionyl-tRNA synthetase;       
   12::56      5e-04  40%  545 aa  SYM_BUCBP RecName: Full=Methionyl-tRNA synthetase;       
  153::261     5e-04  30%  797 aa  SYM_ARATH RecName: Full=Probable methionyl-tRNA synthetase;        
   13::63      5e-04  39%  706 aa  SYM_ACIAC RecName: Full=Methionyl-tRNA synthetase;       
  182::401     5e-04  17% 1178 aa  SYLC_MOUSE RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  228::357     5e-04  29%  499 aa  SYC_SYNPW RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     5e-04  29%  447 aa  SYC_STRR6 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     5e-04  29%  447 aa  SYC_STRPN RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_SHISS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_SHIFL RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_SHIF8 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_SHIDS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::326     5e-04  29%  459 aa  SYC_SHEPA RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  29%  461 aa  SYC_SERP5 RecName: Full=Cysteinyl-tRNA synthetase;       
  263::334     5e-04  41%  459 aa  SYC_RICM5 RecName: Full=Cysteinyl-tRNA synthetase;       
  261::332     5e-04  38%  458 aa  SYC_RICBR RecName: Full=Cysteinyl-tRNA synthetase;       
  261::332     5e-04  38%  458 aa  SYC_RICB8 RecName: Full=Cysteinyl-tRNA synthetase;       
  258::317     5e-04  25%  438 aa  SYC_ONYPE RecName: Full=Cysteinyl-tRNA synthetase;       
  254::324     5e-04  37%  463 aa  SYC_MARAV RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ESCF3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOUT RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOSM RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOSE RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOLU RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOLI RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOLC RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOL6 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOK1 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOHS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECODH RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECOBW RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO8A RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO81 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO7I RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO5E RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO57 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO55 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO45 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     5e-04  30%  461 aa  SYC_ECO24 RecName: Full=Cysteinyl-tRNA synthetase;       
  274::334     5e-04  39%  472 aa  SYC_BRASB RecName: Full=Cysteinyl-tRNA synthetase;       
  292::612     7e-04  29%  620 aa  SYR_BIFLI RecName: Full=Arginyl-tRNA synthetase;       
   16::134     7e-04  24%  565 aa  SYM_THEPD RecName: Full=Methionyl-tRNA synthetase;       
   11::117     7e-04  36%  600 aa  SYM_SALAI RecName: Full=Methionyl-tRNA synthetase;       
   12::56      7e-04  42%  679 aa  SYM_RHOBA RecName: Full=Methionyl-tRNA synthetase;       
   13::57      7e-04  42%  700 aa  SYM_PSYCK RecName: Full=Methionyl-tRNA synthetase;       
   13::57      7e-04  42%  700 aa  SYM_PSYA2 RecName: Full=Methionyl-tRNA synthetase;       
   14::64      7e-04  41%  681 aa  SYM_PSEPW RecName: Full=Methionyl-tRNA synthetase;       
   14::64      7e-04  41%  679 aa  SYM_PSEPK RecName: Full=Methionyl-tRNA synthetase;       
   14::64      7e-04  41%  679 aa  SYM_PSEP1 RecName: Full=Methionyl-tRNA synthetase;       
   14::64      7e-04  39%  679 aa  SYM_PSEA7 RecName: Full=Methionyl-tRNA synthetase;       
   15::59      7e-04  38%  680 aa  SYM_PHOPR RecName: Full=Methionyl-tRNA synthetase;       
   12::79      7e-04  36%  685 aa  SYM_NEIMA RecName: Full=Methionyl-tRNA synthetase;       
   12::79      7e-04  36%  685 aa  SYM_NEIM0 RecName: Full=Methionyl-tRNA synthetase;       
   12::70      7e-04  36%  684 aa  SYM_NEIG1 RecName: Full=Methionyl-tRNA synthetase;       
   12::62      7e-04  39%  689 aa  SYM_LEPCP RecName: Full=Methionyl-tRNA synthetase;       
   17::114     7e-04  32%  704 aa  SYM_LEPBL RecName: Full=Methionyl-tRNA synthetase;       
   17::114     7e-04  32%  704 aa  SYM_LEPBJ RecName: Full=Methionyl-tRNA synthetase;       
    3::123     7e-04  28%  662 aa  SYM_LACLA RecName: Full=Methionyl-tRNA synthetase;       
   11::115     7e-04  36%  600 aa  SYM_KINRD RecName: Full=Methionyl-tRNA synthetase;       
   11::63      7e-04  38%  674 aa  SYM_FRATO RecName: Full=Methionyl-tRNA synthetase;       
   13::63      7e-04  41%  673 aa  SYM_DICNV RecName: Full=Methionyl-tRNA synthetase;       
   12::62      7e-04  41%  696 aa  SYM_DECAR RecName: Full=Methionyl-tRNA synthetase;       
   18::62      7e-04  42%  681 aa  SYM_CHRSD RecName: Full=Methionyl-tRNA synthetase;       
   15::59      7e-04  40%  686 aa  SYM_ALISL RecName: Full=Methionyl-tRNA synthetase;       
  158::250     7e-04  30%  572 aa  SYM_AERPE RecName: Full=Methionyl-tRNA synthetase;       
  310::365     7e-04  47%  575 aa  SYMM_YEAST RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
  202::433     7e-04  17% 1111 aa  SYLC_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
  226::337     7e-04  30%  493 aa  SYC_SYNPX RecName: Full=Cysteinyl-tRNA synthetase;       
  257::325     7e-04  29%  447 aa  SYC_STRMU RecName: Full=Cysteinyl-tRNA synthetase;       
  256::327     7e-04  35%  456 aa  SYC_RHOCS RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     7e-04  29%  461 aa  SYC_PECCP RecName: Full=Cysteinyl-tRNA synthetase;       
  256::322     7e-04  34%  473 aa  SYC_MYCLB RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     7e-04  30%  461 aa  SYC_ECO27 RecName: Full=Cysteinyl-tRNA synthetase;       
  257::321     7e-04  31%  456 aa  SYC_DICNV RecName: Full=Cysteinyl-tRNA synthetase;       
  296::391     7e-04  34%  555 aa  SYCM_BOVIN RecName: Full=Cysteinyl-tRNA synthetase, mitochondrial; 
  256::322     7e-04  34%  473 aa  SYC1_MYCLE RecName: Full=Cysteinyl-tRNA synthetase 1;       
  292::612     0.001  29%  620 aa  SYR_BIFLD RecName: Full=Arginyl-tRNA synthetase;       
   14::120     0.001  36%  603 aa  SYM_SALTO RecName: Full=Methionyl-tRNA synthetase;       
   11::55      0.001  40%  697 aa  SYM_PSYWF RecName: Full=Methionyl-tRNA synthetase;       
   12::79      0.001  36%  685 aa  SYM_NEIMF RecName: Full=Methionyl-tRNA synthetase;       
   15::59      0.001  40%  545 aa  SYM_BUCAP RecName: Full=Methionyl-tRNA synthetase;       
  210::324     0.001  31%  459 aa  SYC_PASMU RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     0.001  29%  485 aa  SYC_NITOC RecName: Full=Cysteinyl-tRNA synthetase;       
  258::328     0.001  26%  470 aa  SYC_LACBA RecName: Full=Cysteinyl-tRNA synthetase;       
  215::314     0.001  28%  488 aa  SYC_HELHP RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     0.001  29%  459 aa  SYC_HAEIN RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     0.001  29%  459 aa  SYC_HAEI8 RecName: Full=Cysteinyl-tRNA synthetase;       
  254::323     0.001  33%  459 aa  SYC_FRAP2 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::324     0.001  29%  461 aa  SYC_ENTS8 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::319     0.001  31%  461 aa  SYC_ENT38 RecName: Full=Cysteinyl-tRNA synthetase;       
  255::324     0.001  36%  461 aa  SYC_ECOL5 RecName: Full=Cysteinyl-tRNA synthetase;       
  289::367     0.001  28%  498 aa  SYC_DEIRA RecName: Full=Cysteinyl-tRNA synthetase;       
  252::325     0.001  35%  478 aa  SYC_CORJK RecName: Full=Cysteinyl-tRNA synthetase;       
  266::323     0.001  34%  460 aa  SYC_CORGB RecName: Full=Cysteinyl-tRNA synthetase;       
  221::338     0.001  27%  482 aa  SYC_BDEBA RecName: Full=Cysteinyl-tRNA synthetase;       
  266::323     0.001  34%  460 aa  SYC1_CORGL RecName: Full=Cysteinyl-tRNA synthetase 1;       
  422::645     2e-10  30%  826 aa  SYL_DESAP RecName: Full=Leucyl-tRNA synthetase;       (query 468->682)
  412::702     3e-14  30%  813 aa  SYL_CLOBH RecName: Full=Leucyl-tRNA synthetase;       (query 468->751)
  412::702     3e-14  30%  813 aa  SYL_CLOB1 RecName: Full=Leucyl-tRNA synthetase;       (query 468->751)
   24::427     6e-13  25%  811 aa  SYL_CLOK5 RecName: Full=Leucyl-tRNA synthetase;       (query 44->421)
  412::642     6e-14  31%  813 aa  SYL_CLOBL RecName: Full=Leucyl-tRNA synthetase;       (query 468->688)
   15::429     8e-16  26%  812 aa  SYL_CLOTE RecName: Full=Leucyl-tRNA synthetase;       (query 32->421)
  389::602     5e-08  35%  804 aa  SYL_BACSU RecName: Full=Leucyl-tRNA synthetase;       (query 442->642)
  407::755     1e-06  28%  820 aa  SYL_CHLPN RecName: Full=Leucyl-tRNA synthetase;       (query 468->817)
  156::223     0.001  34%  861 aa  SYL_ACTPJ RecName: Full=Leucyl-tRNA synthetase;       (query 390->477)
  156::223     0.001  34%  861 aa  SYL_ACTP2 RecName: Full=Leucyl-tRNA synthetase;       (query 390->477)
  426::545     2e-05  30%  870 aa  SYL_AZOVD RecName: Full=Leucyl-tRNA synthetase;       (query 468->589)
  156::243     5e-04  35%  861 aa  SYL_HAEDU RecName: Full=Leucyl-tRNA synthetase;       (query 390->493)
  156::223     0.001  34%  834 aa  SYL_ACTP7 RecName: Full=Leucyl-tRNA synthetase;       (query 390->477)
  155::195     7e-04  27%  867 aa  SYL_BLOFL RecName: Full=Leucyl-tRNA synthetase;       (query 389->431)
  156::212     2e-04  26%  872 aa  SYL_BLOPB RecName: Full=Leucyl-tRNA synthetase;       (query 390->450)
  453::662     2e-07  30%  864 aa  SYL_LEPBL RecName: Full=Leucyl-tRNA synthetase;       (query 451->642)
  453::662     2e-07  30%  864 aa  SYL_LEPBJ RecName: Full=Leucyl-tRNA synthetase;       (query 451->642)
  325::427     2e-04  29%  793 aa  SYL_MYCPN RecName: Full=Leucyl-tRNA synthetase;       (query 328->426)
  389::602     2e-05  31%  799 aa  SYL_MYCPE RecName: Full=Leucyl-tRNA synthetase;       (query 443->643)
    1::948

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
SYI_MOOTA       ----YSKTLNLPRTDFPMRANLPQREPEILKFWEENDIYGKVQEANRGKPKFILHDGPPYANGHLHLGHT
SYI_KOSOT       ----YKDTLNLPKTSFSMRANLVRKEPEQLKKWEEMDLYKYV-QKNREGAPFVLHDGPPYANGNIHVGTA
SYI_THETN       ----YNKTLNLPKTDFPMKANLPVREPEILKKWEEMDIYRRVLEKNKGKEKYILHDGPPYANGDIHIGTA
SYI_PELCD       ----YKQTLNLPDTQFPMRGNLPKREPEILEKWQSMGLYEKMEEAGRTRPNFTLHDGPPYANGHIHIGHA
SYI_THEPX       ----YNKTLNLPRTDFPMKANLPTREPEILKRWEEMDIYHKTLEKNKGKEKYILHDGPPYANGDIHIGTA
SYI_THEP3       ----YNKTLNLPRTDFPMKANLPTREPEILKRWEEMDIYHKTLEKNKGKEKYILHDGPPYANGDIHIGTA
SYI_CARHZ       ----YGKTLNLPVTDFPMRGNLPEREPEILAYWQKIDLYRKVQQKNEGRPKFILHDGPPYANGDIHMGHV
SYI_GEOSL       ----YKSTLNLPVTDFPMKANLPQREPEILAAWQQGDLYGTIAKAGKGKPRYVLHDGPPYANGHIHIGHA
SYI_SYNWW       ----YDGTLNLPQTGFPMRANLPQREPEILKFWDEIDIYRRIQEKNAGRPQFILHDGPPYANGNIHLGHT
SYI_DESHD       ----YRNTLNLPETDFPMRGNLPQREPEILQKWEEEDIYATV-QKARAGRPFVLHDGPPYANGDIHLGHA
SYI_DESHY       ----YRNTLNLPETDFPMRGNLPQREPEILQKWEEEDIYATV-QKARAGRPFVLHDGPPYANGDIHLGHA
SYI_HALOH       ----YKETINLPRTEFPMRANLSKREPGIEKYWEENNVYEKAIKNREGNKQFILHDGPPYANGDIHIGHA
SYI_THEMA       ----YKNTLNLPKTSFPMKANLVNKEKVFLEEWEKMDLYNYVLEQRK-GKPFVLHDGPPYANGHIHIGTA
SYI_THEP1       ----YKNTLNLPKTSFPMKANLVNKEKVFLEEWEKMDLYNYVLEQRK-GKPFVLHDGPPYANGHIHIGTA
SYI_THEAB       ----YKETLNLPSTEFSMRANLVKKEPEMLKKWKEMDDYNLVL-KSREGKPFVLHDGPPYANGNIHIGTA
SYI_THENN       ----YKNTLNLPKTSFPMRANLVNKEKAFLKEWEEMDLYNYVLEQRK-GKPFVLHDGPPYANGHIHIGTA
SYI_DESAD       ----YKKTLCLPKTKFPMKANLKQREPEMLKRWEETGVYEKMVEANAEAEQYVLHDGPPYANGHIHMGTA
SYI_BREBN       ----YSKTLALPKTEFPMRGNLPSREPQMQAVWEEQNIYQQVLDRTKDRPSFVLHDGPPYANGDIHIGHA
SYI_DESVM       ----YKKTLHLPDTKFPMKANLTQREPEMLKFWEGIDAYAAMAQASGQKGQYVLHDGPPYANGHIHLGTA
SYI_PETMO       ----YKDTINLPKTSFKMKANLKEKEPQILQKWEDINIAYYLRNIRIGGTKFVLHDGPPYANGDIHMGTA
SYI_SYMTH       ----YKATLNMPRTDFPMRANLPTREPEQLKKWEEMDLYNLVQRATAGRPKFVLHDGPPYANGDIHLGTA
SYI_DESRM       ----YSKTLNLPQTQFPMRGNLPQREPETQKYWQEIDLYKKVQEKNKGKTKFILHDGPPYANGHIHLGHT
SYI_NATTJ       ----YKDTLNLPKTDFPMKAKLPSREPEFLQEWESNNLYQRVQQK-RSGKPYILHDGPPYANGNIHMGHA
SYI_THEM4       ----YKETLNLPSTEFSMRANLVKKEPEMIKKWHEMDDYNLIL-KSREGKPFVLHDGPPYANGNIHIGTA
SYI_DESPS       ----YRDSLNLPKTNFKMKANLAQREPMILKRWEKEGLYQMLQERAQDRPLFVLHDGPPYANGHIHLGHA
SYI_DESDA       ----YKKTLNLPQTAFPMKANLAQREPEAIKKWEXXXXXXXXXXXSGSEGTYILHDGPPYANGHLHMGHA
SYI_CALS8       ----WSQTLNLPKTDFPMRANLAQREPQFLRFWEENDIFXXXXXXXXXXXXFILHDGPPYANGDIHLGHA
SYI_FERNB       ----YKETLNLPQTNFQMKANLVQKEPNMLKYWEEKEIYKKTLETREGAPTYLLHDGPPYANGDIHLGTA
SYI_DESDG       ----YKKTLHLPVTKFPMKANLTQKEPEMLKRWEQTDAYRIMYSTGATKEPFVLHDGPPYANGNIHLGHA
SYI_FUSNN       ----YTSTLHLPKTDFQMKANLPNKEPKYIKKWTEEKIYEKGLEKNKNGETFILHDGPPYANGNTHIGHA
SYI_FERPE       ----YKATLNLPQTNFQMKANLVNKEPEMLKFWEEKEIYKKTLETRANAPTYLLHDGPPYANGDIHLGTA
SYI_DESVH       ----