[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55587.1

[Show Plain Result]


## Summary of Sequence Search
    1::352
    5::326     e-105  63%  346 aa  RECA_HELMI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::330     e-105  67%  349 aa  RECA_CLOAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::330     e-105  58%  348 aa  RECA_AMYMD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::349     e-105  59%  352 aa  RECA_CLOPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::333     e-104  60%  352 aa  RECA_CLOPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::333     e-104  60%  352 aa  RECA_CLOP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::326     e-104  60%  351 aa  RECA_CHLSY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::326     e-104  60%  351 aa  RECA_CHLAA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-104  63%  362 aa  RECA_RHILW RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-104  63%  364 aa  RECA_RHIL3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-104  59%  361 aa  RECA_AGRRK RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  62%  362 aa  RECA_RHIE6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISWE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISW6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISIV RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  365 aa  RECA_RHILO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISMH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISMC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::327     e-103  63%  348 aa  RECA_LISIN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  62%  361 aa  RECA_RHIET RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_OCHA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::340     e-103  57%  356 aa  RECA_CLOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUME RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUMB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-103  58%  361 aa  RECA_BRUA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::340     e-103  57%  356 aa  RECA_CLOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::327     e-102  55%  350 aa  RECA_DICNV RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-102  57%  361 aa  RECA_BRUSI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::337     e-102  62%  352 aa  RECA_BREBN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::344     e-102  56%  397 aa  RECA_BIFLO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::331     e-102  60%  350 aa  RECA_CLOTE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::324     e-102  62%  351 aa  RECA_RHILV RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::344     e-102  56%  392 aa  RECA_BIFBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-102  66%  343 aa  RECA_BACCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::326     e-102  63%  351 aa  RECA_CHLAD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::330     e-102  59%  338 aa  RECA_GEOSL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     e-101  58%  374 aa  RECA_STRLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     e-101  58%  374 aa  RECA_STRCO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     e-101  58%  372 aa  RECA_STRAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::343     e-101  58%  345 aa  RECA_RHOE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-101  56%  362 aa  RECA_AGRVS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     e-101  57%  376 aa  RECA_STRRM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::332     e-101  60%  361 aa  RECA_CLOB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::324     e-101  65%  358 aa  RECA_HERA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     e-101  65%  348 aa  RECA_BACLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     e-101  65%  348 aa  RECA_BACLD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-101  56%  362 aa  RECA_NITWN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     e-101  62%  346 aa  RECA_BACP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::330     e-101  58%  346 aa  RECA_SACEN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::342     e-101  57%  350 aa  RECA_NOCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-101  60%  360 aa  RECA_MESSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::340     e-101  58%  343 aa  RECA_SYNAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     e-101  65%  348 aa  RECA_BACSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::347     e-100  54%  349 aa  RECA_RHOPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::346     e-100  59%  347 aa  RECA_CHRVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     e-100  61%  347 aa  RECA_BACA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::337     e-100  56%  347 aa  RECA_ARTAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::339     e-100  59%  347 aa  RECA_OCEIH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     e-100  55%  362 aa  RECA_NITHX RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::339     e-100  58%  363 aa  RECA_METNO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::326     e-100  60%  348 aa  RECA_SALAI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::324     e-100  57%  348 aa  RECA_PROAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  62%  343 aa  RECA_BACWK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::326     e-100  60%  348 aa  RECA_SALTO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::356     e-100  54%  371 aa  RECA_CORU7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::330     e-100  58%  339 aa  RECA_GEOMG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACC4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  62%  343 aa  RECA_BACC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     e-100  61%  343 aa  RECA_BACAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::334     e-100  55%  340 aa  RECA_PORGI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::334     e-100  55%  340 aa  RECA_PORG3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     e-100  64%  330 aa  RECA_BACTN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::312     e-100  61%  318 aa  RECA_BACFR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340      e-99  56%  347 aa  RECA_THICR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::348      e-99  57%  350 aa  RECA_SYMTH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     1e-99  56%  349 aa  RECA_EXISA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-99  57%  350 aa  RECA_BACSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     2e-99  60%  343 aa  RECA_SYNFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   22::346     2e-99  59%  348 aa  RECA_KINRD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::347     2e-99  54%  352 aa  RECA_ARTCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::308     5e-99  60%  342 aa  RECA_THETN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     5e-99  61%  359 aa  RECA_MAGSA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::336     5e-99  57%  348 aa  RECA_ALTMD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::339     6e-99  56%  363 aa  RECA_METRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::318     6e-99  63%  345 aa  RECA_ACIC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     8e-99  60%  355 aa  RECA_PROMI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     8e-99  60%  355 aa  RECA_PROMH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::336     8e-99  59%  353 aa  RECA_MACCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::339     1e-98  54%  351 aa  RECA_ARTS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::321     1e-98  60%  345 aa  RECA_GLUOX RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::325     1e-98  56%  362 aa  RECA_CLAM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   13::335     2e-98  59%  340 aa  RECA_PRERU RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::334     2e-98  57%  357 aa  RECA_BORPD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::316     2e-98  60%  346 aa  RECA_MYCA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::339     2e-98  55%  348 aa  RECA_ENTFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::346     4e-98  56%  380 aa  RECA_LACPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     4e-98  56%  347 aa  RECA_EXIS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     5e-98  53%  347 aa  RECA_XYLFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     5e-98  56%  363 aa  RECA_AGRT5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     7e-98  60%  342 aa  RECA_ERWCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::311     7e-98  62%  349 aa  RECA_BACHD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     9e-98  55%  345 aa  RECA_STRMK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     9e-98  56%  342 aa  RECA_METCL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::341     1e-97  57%  349 aa  RECA_STAS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     2e-97  53%  347 aa  RECA_XYLFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     2e-97  58%  338 aa  RECA_GEOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     2e-97  58%  338 aa  RECA_GEOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     2e-97  53%  347 aa  RECA_XYLFT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     2e-97  53%  347 aa  RECA_XYLF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::324     2e-97  54%  343 aa  RECA_COXBU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::324     2e-97  59%  347 aa  RECA_BARHE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   20::338     6e-97  57%  346 aa  RECA_CHLTE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::353     8e-97  58%  366 aa  RECA_LEPIN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::353     8e-97  58%  366 aa  RECA_LEPIC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     1e-96  54%  345 aa  RECA_STRM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     1e-96  57%  355 aa  RECA_STACT RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::363     1e-96  53%  387 aa  RECA_LEPME RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::334     1e-96  56%  353 aa  RECA_BORPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::334     1e-96  56%  353 aa  RECA_BORPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::334     1e-96  56%  353 aa  RECA_BORBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     2e-96  55%  343 aa  RECA_PSEA6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::327     2e-96  55%  347 aa  RECA_DESAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::333     2e-96  60%  377 aa  RECA_CORA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::326     2e-96  58%  378 aa  RECA_LACPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   21::340     2e-96  61%  347 aa  RECA_CHLP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::329     2e-96  57%  331 aa  RECA_ACHLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::339     3e-96  59%  367 aa  RECA_DELAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::329     4e-96  57%  331 aa  RECA_ACHLA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::342     5e-96  55%  343 aa  RECA_XANCP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::342     5e-96  55%  343 aa  RECA_XANCB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::342     5e-96  55%  343 aa  RECA_XANC8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     7e-96  55%  348 aa  RECA_PSEOL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::339     7e-96  55%  357 aa  RECA_METPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::315     8e-96  57%  357 aa  RECA_LEIXX RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::326     8e-96  56%  347 aa  RECA_ALHEH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-95  59%  354 aa  RECA_SERMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::339     1e-95  61%  350 aa  RECA_CHLL2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     1e-95  57%  348 aa  RECA_STAHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-95  59%  354 aa  RECA_CITK8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::339     1e-95  56%  353 aa  RECA_CHLCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHISS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHISO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHIFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHIF8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHIDS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SHIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALTY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALTI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALSV RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALPK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALNS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALHS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALEP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALDC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_SALA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ESCF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  352 aa  RECA_ENT38 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOUT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOLU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOLC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOL6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOL5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOHS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECOBW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO8A RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO81 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO7I RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO5E RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO57 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO55 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO45 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO27 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  59%  353 aa  RECA_ECO24 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::354     2e-95  57%  362 aa  RECA_BRAJA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::349     2e-95  57%  356 aa  RECA_YERPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::349     2e-95  57%  356 aa  RECA_YERPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::349     2e-95  57%  356 aa  RECA_YERP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-95  57%  344 aa  RECA_XANOR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-95  57%  344 aa  RECA_XANOP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-95  57%  344 aa  RECA_XANOM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     2e-95  57%  347 aa  RECA_STAA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     2e-95  59%  362 aa  RECA_RHIEC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-95  58%  355 aa  RECA_PHOLL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::323     2e-95  60%  344 aa  RECA_MAGMG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::324     3e-95  54%  348 aa  RECA_RHIME RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::325     3e-95  57%  351 aa  RECA_MANSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::329     3e-95  57%  360 aa  RECA_LACJO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     3e-95  58%  357 aa  RECA_ERWCT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     4e-95  58%  356 aa  RECA_YERPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::326     4e-95  59%  358 aa  RECA_XENBV RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::351     4e-95  55%  354 aa  RECA_VIBCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     4e-95  57%  349 aa  RECA_STAES RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     4e-95  57%  349 aa  RECA_STAEQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     4e-95  56%  347 aa  RECA_MARAV RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     4e-95  59%  352 aa  RECA_KLEP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     4e-95  59%  352 aa  RECA_KLEP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     4e-95  59%  354 aa  RECA_ENTS8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::353     4e-95  54%  355 aa  RECA_DESPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-95  58%  354 aa  RECA_AERHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::332     4e-95  55%  358 aa  RECA2_MYXXA RecName: Full=Protein recA 2;AltName: Full=Recombinase
    3::326     6e-95  59%  355 aa  RECA_SHEAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     6e-95  58%  357 aa  RECA_PECCP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::326     7e-95  59%  353 aa  RECA_SHEDO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     7e-95  58%  361 aa  RECA_RHISN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::333     7e-95  59%  377 aa  RECA_BDEBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     9e-95  57%  354 aa  RECA_VIBC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::347     9e-95  52%  348 aa  RECA_VIBAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::337     9e-95  58%  361 aa  RECA_SINMW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-94  58%  356 aa  RECA_YERPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-94  58%  356 aa  RECA_YERPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-94  58%  356 aa  RECA_YERPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-94  58%  356 aa  RECA_YERPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-94  58%  356 aa  RECA_YERPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     1e-94  56%  349 aa  RECA_VIBVY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     1e-94  56%  349 aa  RECA_VIBVU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::311     1e-94  56%  360 aa  RECA_TOLAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     1e-94  58%  353 aa  RECA_SHEWM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::325     1e-94  59%  355 aa  RECA_SHEHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::363     1e-94  52%  387 aa  RECA_LEPBP RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::363     1e-94  52%  387 aa  RECA_LEPBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::328     1e-94  55%  377 aa  RECA_LACBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::347     1e-94  58%  350 aa  RECA_CLONN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-94  58%  354 aa  RECA_YERE8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-94  58%  353 aa  RECA_SHELP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-94  58%  353 aa  RECA_SERP5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-94  52%  347 aa  RECA_VIBPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::325     2e-94  59%  355 aa  RECA_SHEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
   13::347     2e-94  53%  375 aa  RECA_CORJK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     3e-94  56%  362 aa  RECA_LACRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     3e-94  56%  362 aa  RECA_LACRD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::326     4e-94  56%  437 aa  RECA_TROWT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::326     4e-94  56%  437 aa  RECA_TROW8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::329     4e-94  53%  355 aa  RECA_LACSS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::348     4e-94  56%  354 aa  RECA_ENTAG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-94  58%  353 aa  RECA_EDWI9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::310     4e-94  60%  347 aa  RECA_BARQU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     5e-94  56%  344 aa  RECA_XANC5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-94  58%  357 aa  RECA_SHESW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-94  58%  357 aa  RECA_SHESA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-94  58%  357 aa  RECA_SHEPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-94  58%  357 aa  RECA_SHEON RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::338     6e-94  57%  343 aa  RECA_ACICJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::346     8e-94  57%  355 aa  RECA_ERWT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-93  58%  355 aa  RECA_SHEB9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-93  58%  355 aa  RECA_SHEB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-93  58%  355 aa  RECA_SHEB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-93  58%  355 aa  RECA_SHEB2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     1e-93  55%  343 aa  RECA_RICB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-93  56%  344 aa  RECA_XANCI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     2e-93  56%  344 aa  RECA_XANAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::323     2e-93  51%  342 aa  RECA_TERTT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     2e-93  56%  377 aa  RECA_STRAW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-93  58%  357 aa  RECA_SHESR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-93  58%  357 aa  RECA_SHESM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::328     2e-93  60%  348 aa  RECA_ENTGA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::308     2e-93  60%  347 aa  RECA_BART1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-93  58%  354 aa  RECA_SHEFN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::323     2e-93  58%  348 aa  RECA_SACD2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::344     2e-93  58%  346 aa  RECA_ENTHR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::330     2e-93  56%  348 aa  RECA_CLOD6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::338     2e-93  59%  357 aa  RECA_CHLT3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     3e-93  55%  340 aa  RECA_RICTY RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::339     3e-93  55%  363 aa  RECA_METS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::344     3e-93  59%  346 aa  RECA_ENTMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::311     3e-93  59%  353 aa  RECA_AERS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::345     4e-93  57%  353 aa  RECA_ROSS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::335     4e-93  54%  366 aa  RECA_RHORT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-93  57%  355 aa  RECA_SODGM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     5e-93  57%  355 aa  RECA_SODGL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     5e-93  55%  340 aa  RECA_RICPR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::348     5e-93  58%  351 aa  RECA_DESDG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     7e-93  58%  347 aa  RECA_SULNB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::326     9e-93  58%  358 aa  RECA_XENNE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::325     9e-93  55%  343 aa  RECA_THISH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::331     9e-93  55%  377 aa  RECA_STRVL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::349     9e-93  55%  353 aa  RECA_LACF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     1e-92  53%  347 aa  RECA_ALISL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::331     1e-92  51%  348 aa  RECA_VIBNA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     1e-92  58%  353 aa  RECA_ROSCS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::321     2e-92  57%  353 aa  RECA_SHESH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::310     2e-92  57%  347 aa  RECA_METCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::338     3e-92  53%  353 aa  RECA_RALEJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::338     3e-92  57%  355 aa  RECA_RHOCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::337     4e-92  52%  367 aa  RECA_JANMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::325     4e-92  59%  355 aa  RECA_HAES2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::325     4e-92  59%  355 aa  RECA_HAES1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::331     6e-92  55%  350 aa  RECA_NAUPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::313     7e-92  56%  343 aa  RECA_RICFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::315     7e-92  56%  343 aa  RECA_RICCK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::318     7e-92  58%  325 aa  RECA_PROVU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     7e-92  53%  354 aa  RECA_HAEIN RecName: Full=Protein recA;AltName: Full=Recombinase
    5::325     7e-92  53%  354 aa  RECA_HAEIG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     7e-92  53%  354 aa  RECA_HAEIE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     7e-92  53%  354 aa  RECA_HAEI8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::350     7e-92  56%  376 aa  RECA_CORGL RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::350     7e-92  56%  376 aa  RECA_CORGB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRATF RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::323     1e-91  56%  359 aa  RECA_FRAT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::318     1e-91  56%  360 aa  RECA_FRAP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::328     1e-91  60%  349 aa  RECA_ENTFC RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::330     1e-91  61%  348 aa  RECA_AQUPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::326     1e-91  56%  352 aa  RECA_ACTAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::336     1e-91  50%  349 aa  RECA_ACIAD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     1e-91  53%  348 aa  RECA_VIBFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     1e-91  53%  348 aa  RECA_VIBF1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::329     1e-91  55%  343 aa  RECA_NITEC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::319     2e-91  57%  348 aa  RECA_RHOOB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::326     2e-91  62%  344 aa  RECA_NITSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::348     2e-91  52%  386 aa  RECA_COREF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::338     3e-91  53%  354 aa  RECA_CUPTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::308     3e-91  58%  347 aa  RECA_BARBK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::313     4e-91  56%  343 aa  RECA_RICAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::351     4e-91  52%  354 aa  RECA_RALEH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::330     4e-91  61%  352 aa  RECA_CHLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::330     4e-91  61%  352 aa  RECA_CHLTB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::330     4e-91  61%  352 aa  RECA_CHLT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::328     4e-91  56%  354 aa  RECA_CHLMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::313     5e-91  56%  343 aa  RECA_RICCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::338     6e-91  53%  343 aa  RECA_RHOS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::352     6e-91  53%  357 aa  RECA_RHOS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::319     8e-91  57%  347 aa  RECA_RHOSR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::345     8e-91  54%  357 aa  RECA_RHOS5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::346     8e-91  55%  354 aa  RECA_HAMD5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::349     8e-91  53%  350 aa  RECA_CHLFF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::354     8e-91  56%  369 aa  RECA_AZOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::333     1e-90  55%  348 aa  RECA_SYNP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::341     1e-90  54%  348 aa  RECA_LEGPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-90  54%  372 aa  RECA_IDILO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::326     1e-90  56%  345 aa  RECA_HELHP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::332     1e-90  55%  350 aa  RECA_CHRVO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::341     1e-90  54%  348 aa  RECA_LEGPH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::341     1e-90  54%  348 aa  RECA_LEGPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::341     1e-90  54%  348 aa  RECA_LEGPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::330     1e-90  61%  352 aa  RECA_CHLTA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::340     2e-90  56%  372 aa  RECA_CORDI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::343     2e-90  59%  343 aa  RECA_DECAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIBY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIBT RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIBC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-90  51%  349 aa  RECA_ACIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   14::357     3e-90  55%  358 aa  RECA_RHOCS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     3e-90  56%  348 aa  RECA_LEGPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::340     3e-90  56%  369 aa  RECA_CORPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::313     4e-90  55%  343 aa  RECA_RICPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::324     4e-90  55%  348 aa  RECA_RHOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::319     4e-90  60%  347 aa  RECA_NOCFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::344     4e-90  54%  349 aa  RECA_MYCS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::317     4e-90  56%  350 aa  RECA_MYCGI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::342     9e-90  51%  384 aa  RECA_POLNA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     9e-90  56%  350 aa  RECA_BAUCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::328     9e-90  59%  345 aa  RECA_AQUAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::336     1e-89  59%  358 aa  RECA_DEIGD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::333     2e-89  55%  353 aa  RECA_RALME RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::342     2e-89  54%  346 aa  RECA_FRAAA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::333     2e-89  53%  357 aa  RECA_DESVV RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::333     2e-89  53%  357 aa  RECA_DESVH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::344     2e-89  57%  349 aa  RECA_CYAP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     3e-89  56%  350 aa  RECA_CHLCV RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::325     3e-89  53%  352 aa  RECA_CHRSD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     5e-89  51%  383 aa  RECA_STRGC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::317     5e-89  56%  350 aa  RECA_MYCVP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     5e-89  54%  344 aa  RECA_CAMLR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::332     5e-89  56%  359 aa  RECA_ANAMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::333     6e-89  54%  353 aa  RECA_RALEU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     6e-89  54%  343 aa  RECA_NITEU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     6e-89  55%  353 aa  RECA_CHLPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::332     6e-89  56%  359 aa  RECA_ANAMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     8e-89  49%  348 aa  RECA_NEIMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     1e-88  49%  348 aa  RECA_NEIGO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     1e-88  49%  348 aa  RECA_NEIG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     1e-88  49%  348 aa  RECA_NEIG1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::331     1e-88  55%  355 aa  RECA_WOLWR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::331     1e-88  55%  355 aa  RECA_WOLPM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     1e-88  55%  354 aa  RECA_PASMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     1e-88  49%  348 aa  RECA_NEIMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::324     1e-88  53%  346 aa  RECA_AZOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::326     2e-88  54%  331 aa  RECA_WIGBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::317     2e-88  53%  347 aa  RECA_MYCSS RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::317     2e-88  53%  347 aa  RECA_MYCSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::317     2e-88  53%  347 aa  RECA_MYCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::337     2e-88  58%  356 aa  RECA_CAUCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::337     2e-88  58%  356 aa  RECA_CAUCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::328     2e-88  52%  347 aa  RECA_SILPO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::346     2e-88  49%  348 aa  RECA_NEIMB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   21::329     2e-88  58%  363 aa  RECA_LACAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
   27::331     2e-88  56%  351 aa  RECA_HERSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     2e-88  53%  344 aa  RECA_CAMLA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     2e-88  53%  343 aa  RECA_CAMJR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     2e-88  53%  343 aa  RECA_CAMJJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     2e-88  53%  343 aa  RECA_CAMJE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     2e-88  53%  343 aa  RECA_CAMJ8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::322     3e-88  53%  344 aa  RECA_RUBXD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::338     4e-88  59%  414 aa  RECA_TREDE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRZT RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRZP RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRZJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRR6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRPI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::368     4e-88  53%  388 aa  RECA_STRP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::337     4e-88  50%  367 aa  RECA_HERAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   22::318     4e-88  58%  369 aa  RECA_GLOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     5e-88  51%  379 aa  RECA_STRU0 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     5e-88  54%  339 aa  RECA_NITMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::349     5e-88  52%  354 aa  RECA_HALHL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::333     5e-88  56%  357 aa  RECA_EHRRW RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::333     5e-88  56%  357 aa  RECA_EHRRG RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::333     5e-88  56%  359 aa  RECA_DESDA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::336     5e-88  59%  363 aa  RECA_DEIRA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    2::323     7e-88  51%  339 aa  RECA_ZYMMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  55%  378 aa  RECA_STRPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  55%  378 aa  RECA_STRPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  55%  378 aa  RECA_STRPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  55%  378 aa  RECA_STRP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  55%  378 aa  RECA_STRP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  56%  379 aa  RECA_STRA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     7e-88  56%  379 aa  RECA_STRA3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   27::345     7e-88  52%  375 aa  RECA_RHOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   22::344     7e-88  52%  353 aa  RECA_BORA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::334     9e-88  54%  355 aa  RECA_WOLPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::316     9e-88  53%  350 aa  RECA_MYCPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::316     9e-88  53%  350 aa  RECA_MYCA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::326     9e-88  54%  345 aa  RECA_COLP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     1e-87  55%  383 aa  RECA_STRMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     1e-87  55%  378 aa  RECA_STRPM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     1e-87  56%  381 aa  RECA_STRPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     1e-87  55%  378 aa  RECA_STRP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::316     2e-87  52%  346 aa  RECA_MYCMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     2e-87  55%  378 aa  RECA_STRPF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     2e-87  55%  378 aa  RECA_STRPD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     2e-87  55%  378 aa  RECA_STRP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::353     2e-87  54%  378 aa  RECA_STREM RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-87  55%  355 aa  RECA_SHEPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::338     2e-87  54%  356 aa  RECA_PARDE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     3e-87  55%  378 aa  RECA_STRS7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     3e-87  55%  378 aa  RECA_STRE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::313     3e-87  53%  346 aa  RECA_MYCUA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   35::338     4e-87  57%  368 aa  RECA_PASHA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::328     4e-87  56%  348 aa  RECA_ACEPO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::364     6e-87  54%  407 aa  RECA_TREPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::364     6e-87  54%  407 aa  RECA_TREPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     6e-87  55%  378 aa  RECA_STRPZ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   25::325     6e-87  53%  365 aa  RECA_PARL1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::354     6e-87  56%  356 aa  RECA_CAUSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::309     6e-87  53%  348 aa  RECA_BURS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::329     7e-87  57%  357 aa  RECA_EHRCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::344     9e-87  57%  369 aa  RECA_LACDB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     1e-86  55%  382 aa  RECA_STRSV RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::324     1e-86  57%  344 aa  RECA_AZOSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::342     2e-86  55%  387 aa  RECA_LACLS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::342     2e-86  55%  387 aa  RECA_LACLM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::342     2e-86  55%  387 aa  RECA_LACLC RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::342     2e-86  55%  387 aa  RECA1_LACLA RecName: Full=Protein recA, chromosomal;AltName:
   17::344     2e-86  55%  379 aa  RECA_STRAG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::309     2e-86  53%  347 aa  RECA_BURCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::309     2e-86  53%  347 aa  RECA_BURCE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   13::338     3e-86  53%  355 aa  RECA_CYTH3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-86  54%  346 aa  RECA_PSEAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-86  54%  346 aa  RECA_PSEAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-86  54%  346 aa  RECA_PSEA8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-86  54%  346 aa  RECA_PSEA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::352     4e-86  55%  357 aa  RECA_EHRCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     5e-86  52%  343 aa  RECA_RICBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::309     5e-86  52%  348 aa  RECA_BURM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     6e-86  54%  355 aa  RECA_PSEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::325     6e-86  59%  331 aa  RECA_LACDA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     1e-85  54%  379 aa  RECA_STRTD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     1e-85  54%  384 aa  RECA_STRT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  54%  355 aa  RECA_PSEE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  52%  345 aa  RECA_HAHCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  54%  349 aa  RECA_AZOVD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    4::331     1e-85  51%  349 aa  RECA_THEM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     1e-85  54%  384 aa  RECA_STRT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  54%  355 aa  RECA_PSEPK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  54%  355 aa  RECA_PSEPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     1e-85  54%  355 aa  RECA_PSEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     2e-85  51%  344 aa  RECA_METFK RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::318     2e-85  52%  356 aa  RECA_BURPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::318     2e-85  52%  356 aa  RECA_BURMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     3e-85  53%  347 aa  RECA_PSEST RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     4e-85  54%  355 aa  RECA_PSEPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::325     4e-85  54%  348 aa  RECA_CAMHC RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::346     4e-85  55%  363 aa  RECA_BORDL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     5e-85  54%  347 aa  RECA_HELPH RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     5e-85  53%  349 aa  RECA_AZOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::331     7e-85  53%  355 aa  RECA_WOLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::334     7e-85  57%  356 aa  RECA_SYNP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::334     7e-85  57%  356 aa  RECA_SYNE7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::308     7e-85  56%  349 aa  RECA_CHLAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     7e-85  50%  345 aa  RECA_ACIF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     7e-85  50%  345 aa  RECA_ACIF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     9e-85  54%  347 aa  RECA_HELPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     9e-85  54%  347 aa  RECA_HELPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::341     1e-84  54%  379 aa  RECA_STRTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::330     1e-84  48%  352 aa  RECA_PHOPR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::330     1e-84  54%  376 aa  RECA_OENOB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::346     2e-84  54%  356 aa  RECA_BORHE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::346     2e-84  54%  356 aa  RECA_BORHD RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::313     3e-84  52%  349 aa  RECA_PSYWF RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::343     3e-84  51%  344 aa  RECA_METFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     3e-84  53%  347 aa  RECA_HELP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::313     4e-84  52%  343 aa  RECA_RICM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     4e-84  53%  347 aa  RECA_HELPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   20::343     4e-84  53%  365 aa  RECA_BORBZ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   20::343     4e-84  53%  365 aa  RECA_BORBU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     6e-84  53%  347 aa  RECA_HELAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::310     1e-83  57%  357 aa  RECA_DESVM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::348     1e-83  54%  354 aa  RECA_PSEU2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::328     2e-83  53%  347 aa  RECA_HELPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   96::422     2e-83  49%  452 aa  RECAM_DICDI RecName: Full=Mitochondrial DNA repair protein recA
    1::324     2e-83  49%  346 aa  RECA_THIFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     2e-83  55%  354 aa  RECA_PSESM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     2e-83  55%  354 aa  RECA_PSE14 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::313     3e-83  51%  352 aa  RECA_PSYCK RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     4e-83  55%  340 aa  RECA_THEAQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
   17::352     4e-83  56%  374 aa  RECA_SYNSC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::325     4e-83  53%  354 aa  RECA_LARHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   11::333     4e-83  53%  355 aa  RECA_DESMR RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::334     6e-83  56%  355 aa  RECA_THEEB RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::370     8e-83  54%  376 aa  RECA_SYNS9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::329     8e-83  54%  352 aa  RECA_PSEFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::322     1e-82  57%  351 aa  RECA_THENN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::324     1e-82  55%  352 aa  RECA_PSETO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::324     1e-82  55%  352 aa  RECA_PSEFS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   24::364     1e-82  55%  379 aa  RECA_PROMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::323     1e-82  56%  365 aa  RECA_SPIPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
   82::402     1e-82  49%  439 aa  RECAC_ARATH RecName: Full=DNA repair protein recA homolog 1,
    1::320     2e-82  58%  356 aa  RECA_THESQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::320     2e-82  58%  356 aa  RECA_THEMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::325     2e-82  52%  350 aa  RECA_WOLSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::320     2e-82  58%  356 aa  RECA_THEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::331     2e-82  56%  359 aa  RECA_NOSP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   21::332     2e-82  54%  342 aa  RECA1_MYXXA RecName: Full=Protein recA 1;AltName: Full=Recombinase
   15::324     3e-82  55%  350 aa  RECA_PSEF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::340     3e-82  54%  363 aa  RECA_BORT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   27::363     4e-82  48%  368 aa  RECA_PETMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::333     4e-82  57%  357 aa  RECA_CYAP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   20::343     7e-82  52%  365 aa  RECA_BORAP RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::354     2e-81  55%  375 aa  RECA_SYNPX RecName: Full=Protein recA;AltName: Full=Recombinase A;
   24::365     2e-81  50%  367 aa  RECA_PROM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   36::339     2e-81  55%  372 aa  RECA_HAEDU RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::313     3e-81  51%  352 aa  RECA_PSYA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   15::331     3e-81  53%  352 aa  RECA_PSEPF RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::331     3e-81  55%  358 aa  RECA_ANAVT RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::338     5e-81  56%  382 aa  RECA_SYNS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::338     5e-81  56%  382 aa  RECA_SYNPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
   10::331     5e-81  55%  357 aa  RECA_ANASP RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::344     6e-81  54%  349 aa  RECA_CYAA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::324     2e-80  49%  345 aa  RECA_SULDN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   24::343     2e-80  56%  379 aa  RECA_PROMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
   24::343     2e-80  56%  379 aa  RECA_PROM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     3e-80  55%  340 aa  RECA_THET2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::302     4e-80  60%  340 aa  RECA_THET8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     4e-80  49%  345 aa  RECA_CAMFF RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::340     4e-80  49%  345 aa  RECA_CAMFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   29::333     5e-80  55%  352 aa  RECA_RALSO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    5::341     7e-80  50%  345 aa  RECA_FRASC RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::338     7e-80  50%  343 aa  RECA_CAMJD RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::328     2e-79  55%  360 aa  RECA_TRIEI RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::302     2e-79  59%  340 aa  RECA_THETH RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::339     2e-79  55%  365 aa  RECA_PROM0 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   35::342     2e-79  52%  345 aa  RECA_MYCMS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   36::340     6e-79  52%  345 aa  RECA_MYCMY RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::339     7e-79  55%  365 aa  RECA_PROMS RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::339     7e-79  55%  365 aa  RECA_PROM9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    7::333     7e-79  55%  356 aa  RECA_CYAP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   22::329     9e-79  56%  377 aa  RECA_PROMT RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::339     9e-79  54%  365 aa  RECA_PROM2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   22::329     9e-79  56%  377 aa  RECA_PROM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   19::343     4e-78  50%  362 aa  RECA_BORGA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::345     6e-78  56%  370 aa  RECA_PROMP RecName: Full=Protein recA;AltName: Full=Recombinase A;
   21::339     1e-77  50%  339 aa  RECA_PHYMT RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::345     1e-77  55%  370 aa  RECA_PROM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    9::317     2e-76  52%  333 aa  RECA_MESFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::340     4e-76  47%  378 aa  RECA_FUSNN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   28::332     7e-76  47%  339 aa  RECA_MYCPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::270     2e-75  52%  274 aa  RECA_NEIPO RecName: Full=Protein recA;AltName: Full=Recombinase
    1::270     2e-75  52%  274 aa  RECA_NEILA RecName: Full=Protein recA;AltName: Full=Recombinase
    1::329     4e-75  52%  349 aa  RECA_ARCB4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    3::318     2e-74  52%  331 aa  RECA_MYCMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
    8::332     3e-73  52%  354 aa  RECA_SYNY3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::270     4e-72  50%  274 aa  RECA_NEIFL RecName: Full=Protein recA;AltName: Full=Recombinase
    1::270     5e-72  55%  274 aa  RECA_NEICI RecName: Full=Protein recA;AltName: Full=Recombinase
    6::302     7e-72  46%  337 aa  RECA_MYCHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::302     9e-72  45%  337 aa  RECA_MYCH7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    6::302     9e-72  45%  337 aa  RECA_MYCH2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::218     3e-69  61%  218 aa  RECA_ARTAU RecName: Full=Protein recA;AltName: Full=Recombinase
    1::270     5e-69  54%  274 aa  RECA_NEIPH RecName: Full=Protein recA;AltName: Full=Recombinase
    1::270     9e-69  53%  274 aa  RECA_NEIMU RecName: Full=Protein recA;AltName: Full=Recombinase
   17::237     1e-68  56%  237 aa  RECA_NEIEG RecName: Full=Protein recA;AltName: Full=Recombinase
    6::758     1e-67  58%  790 aa  RECA_MYCTU RecName: Full=Protein recA;AltName: Full=Recombinase
    6::758     1e-67  58%  790 aa  RECA_MYCBO RecName: Full=Protein recA;AltName: Full=Recombinase
   40::274     1e-66  58%  274 aa  RECA_NEIAN RecName: Full=Protein recA;AltName: Full=Recombinase
   57::380     9e-66  47%  430 aa  RECA3_ARATH RecName: Full=DNA repair protein recA homolog 3,
   16::349     2e-65  43%  354 aa  RECA_ACIFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::237     6e-65  56%  237 aa  RECA_NEISU RecName: Full=Protein recA;AltName: Full=Recombinase
   23::237     6e-65  56%  237 aa  RECA_NEIPE RecName: Full=Protein recA;AltName: Full=Recombinase
    6::205     2e-64  62%  711 aa  RECA_MYCLE RecName: Full=Protein recA;AltName: Full=Recombinase
    6::325     7e-63  39%  329 aa  RECA_MYCPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
   23::237     4e-61  59%  237 aa  RECA_NEISI RecName: Full=Protein recA;AltName: Full=Recombinase
   16::324     4e-58  41%  334 aa  RECA_UREPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
   16::324     4e-58  41%  334 aa  RECA_UREP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   18::339     2e-56  39%  341 aa  RECA2_LACLA RecName: Full=Protein recA, plasmid;AltName:
    4::321     4e-56  39%  333 aa  RECA_UREU1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
   37::321     9e-53  38%  336 aa  RECA_MYCPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   29::322     4e-52  38%  340 aa  RECA_MYCGE RecName: Full=Protein recA;AltName: Full=Recombinase A;
    1::142     2e-50  69%  142 aa  RECA_STRCT RecName: Full=Protein recA;AltName: Full=Recombinase
    1::182     1e-49  60%  182 aa  RECA_ACEAC RecName: Full=Protein recA;AltName: Full=Recombinase
   61::379     3e-49  40%  389 aa  RECAM_ARATH RecName: Full=DNA repair protein recA homolog 2,
    2::121     6e-39  76%  121 aa  RECA_RUMAL RecName: Full=Protein recA;AltName: Full=Recombinase
   11::178     2e-35  55%  229 aa  RECA4_ARATH RecName: Full=Putative DNA repair protein recA homolog
    2::104     2e-32  80%  104 aa  RECA_LEUME RecName: Full=Protein recA;AltName: Full=Recombinase
    2::104     2e-29  70%  104 aa  RECA_LACHE RecName: Full=Protein recA;AltName: Full=Recombinase
    2::104     3e-28  70%  104 aa  RECA_STRSL RecName: Full=Protein recA;AltName: Full=Recombinase
    2::104     2e-26  69%  104 aa  RECA_LACDE RecName: Full=Protein recA;AltName: Full=Recombinase
   15::77      9e-13  46%   77 aa  RECA_SPIME RecName: Full=Protein recA;AltName: Full=Recombinase
   75::267     5e-11  30%  311 aa  RADA_METST RecName: Full=DNA repair and recombination protein radA;
    2::158     5e-09  34%  225 aa  RADB_PYRFU RecName: Full=DNA repair and recombination protein radB;
    1::77      6e-09  45%  228 aa  RADB_THESM RecName: Full=DNA repair and recombination protein radB;
   75::267     1e-08  30%  311 aa  RADA_METTH RecName: Full=DNA repair and recombination protein radA;
   88::280     4e-08  29%  328 aa  RADA_DESK1 RecName: Full=DNA repair and recombination protein radA;
    1::290     7e-08  23%  391 aa  UVSX_BPT4 RecName: Full=Recombination and repair protein;
   12::88      9e-08  44%  228 aa  RADB_PYRHO RecName: Full=DNA repair and recombination protein radB;
   13::70      9e-08  48%  239 aa  RADB_PYRAB RecName: Full=DNA repair and recombination protein radB;
   12::70      1e-07  46%  232 aa  RADB_METST RecName: Full=DNA repair and recombination protein
   75::267     1e-07  28%  311 aa  RADA_METS3 RecName: Full=DNA repair and recombination protein radA;
   89::280     1e-07  29%  328 aa  RADA_DESAM RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULSO RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIY RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIN RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIM RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIL RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIK RecName: Full=DNA repair and recombination protein radA;
   60::277     2e-07  27%  324 aa  RADA_SULIA RecName: Full=DNA repair and recombination protein radA;
   79::280     2e-07  29%  325 aa  RADA_METBU RecName: Full=DNA repair and recombination protein radA;
    1::77      3e-07  42%  224 aa  RADB_THEON RecName: Full=DNA repair and recombination protein radB;
    1::59      3e-07  47%  220 aa  RADB_PYRKO RecName: Full=DNA repair and recombination protein radB;
   13::97      7e-07  36%  234 aa  RADB_METTH RecName: Full=DNA repair and recombination protein radB;
   79::280     1e-06  27%  325 aa  RADA_METBF RecName: Full=DNA repair and recombination protein radA;
   95::195     1e-06  43%  332 aa  DMC1_SCHPO RecName: Full=Meiotic recombination protein dmc1;
   32::106     4e-06  40%  350 aa  RAD55_SCHPO RecName: Full=DNA repair protein rhp55;AltName:
  101::204     4e-06  39%  340 aa  DMC1_MOUSE RecName: Full=Meiotic recombination protein DMC1/LIM15
    6::100     5e-06  32%  224 aa  RADB_METMJ RecName: Full=DNA repair and recombination protein radB;
  101::204     5e-06  39%  340 aa  DMC1_HUMAN RecName: Full=Meiotic recombination protein DMC1/LIM15
   79::148     8e-06  39%  325 aa  RADA_METMA RecName: Full=DNA repair and recombination protein radA;
   90::279     8e-06  30%  337 aa  RADA_ARCFU RecName: Full=DNA repair and recombination protein radA;
    8::169     1e-05  28%  216 aa  RADB_METMP RecName: Full=DNA repair and recombination protein radB;
   79::277     1e-05  26%  325 aa  RADA_METAC RecName: Full=DNA repair and recombination protein radA;
   84::277     2e-05  24%  324 aa  RADA_SULTO RecName: Full=DNA repair and recombination protein radA;
   89::277     2e-05  27%  324 aa  RADA_METS5 RecName: Full=DNA repair and recombination protein radA;
   14::63      2e-05  42%  225 aa  RADB_METBU RecName: Full=DNA repair and recombination protein
    8::169     3e-05  27%  215 aa  RADB_METM7 RecName: Full=DNA repair and recombination protein radB;
   95::281     3e-05  28%  329 aa  RADA_METLZ RecName: Full=DNA repair and recombination protein radA;
  109::193     3e-05  44%  345 aa  DMC1_SOYBN RecName: Full=Meiotic recombination protein DMC1
   81::274     4e-05  24%  321 aa  RADA_SULAC RecName: Full=DNA repair and recombination protein radA;
   68::142     4e-05  37%  444 aa  RADA_AQUAE RecName: Full=DNA repair protein radA homolog;AltName:
  102::186     4e-05  43%  339 aa  RAD51_USTMA RecName: Full=DNA repair protein RAD51;
  101::288     5e-05  27%  332 aa  RADA_PYRCJ RecName: Full=DNA repair and recombination protein radA;
    8::40      7e-05  55%  236 aa  RADB_HALSA RecName: Full=DNA repair and recombination protein
    8::40      7e-05  55%  236 aa  RADB_HALS3 RecName: Full=DNA repair and recombination protein
  113::197     7e-05  41%  349 aa  DMC1_LILLO RecName: Full=Meiotic recombination protein DMC1
  108::192     7e-05  43%  344 aa  DMC1_ARATH RecName: Full=Meiotic recombination protein DMC1
   77::167     9e-05  31%  458 aa  RADA_HAEIN RecName: Full=DNA repair protein radA homolog;AltName:
   25::67      1e-04  33%  234 aa  RADB_METS3 RecName: Full=DNA repair and recombination protein
   81::170     1e-04  36%  319 aa  RADA_AERPE RecName: Full=DNA repair and recombination protein radA;
  160::244     1e-04  43%  400 aa  RAD51_YEAST RecName: Full=DNA repair protein RAD51;
    8::169     2e-04  27%  216 aa  RADB_METM5 RecName: Full=DNA repair and recombination protein radB;
  650::729     2e-04  34% 1523 aa  MRP3_MOUSE RecName: Full=Canalicular multispecific organic anion
  102::186     3e-04  39%  333 aa  RADA_PYRAR RecName: Full=DNA repair and recombination protein radA;
  102::186     3e-04  37%  333 aa  RADA_PYRAE RecName: Full=DNA repair and recombination protein radA;
   99::183     3e-04  39%  330 aa  RADA_THENV RecName: Full=DNA repair and recombination protein radA;
   99::183     3e-04  39%  330 aa  RADA_PYRIL RecName: Full=DNA repair and recombination protein radA;
   25::68      3e-04  43%  357 aa  CYSA_BACCR RecName: Full=Sulfate/thiosulfate import ATP-binding
   14::69      4e-04  36%  234 aa  RADB_THEVO RecName: Full=DNA repair and recombination protein
  107::305     4e-04  30%  352 aa  RADA_METJA RecName: Full=DNA repair and recombination protein radA;
   75::140     6e-04  37%  354 aa  RAD57_SCHPO RecName: Full=DNA repair protein rhp57;AltName:
  649::728     6e-04  34% 1522 aa  MRP3_RAT RecName: Full=Canalicular multispecific organic anion
   10::51      6e-04  43%  291 aa  MIAA_SILPO RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
  191::247     8e-04  33%  459 aa  RCA_SOLPN RecName: Full=Ribulose bisphosphate carboxylase/oxygenase
  196::252     8e-04  33%  439 aa  RCA2_TOBAC RecName: Full=Ribulose bisphosphate
  196::252     8e-04  33%  442 aa  RCA1_TOBAC RecName: Full=Ribulose bisphosphate
   78::170     8e-04  37%  350 aa  RA51B_MOUSE RecName: Full=DNA repair protein RAD51 homolog 2;      
   22::77      0.001  40%  221 aa  RADB_THEGJ RecName: Full=DNA repair and recombination protein radB;
   98::161     0.001  41%  376 aa  RA51C_HUMAN RecName: Full=DNA repair protein RAD51 homolog 3;      
   98::187     0.001  39%  340 aa  R51A1_MAIZE RecName: Full=DNA repair protein RAD51 homolog
    1::352

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
RECA_HELMI      --DNKLQALQQALNSIEKAFGKGSIMRLGEASAKLLVEVIPTGSIALDMALGIGGVPRGRIVEVYGPESS
RECA_CLOAB      MDNEKLKAIDAAMSQIEKQFGKGAIMKLGEQDI-LNIDAISTGCLSLDIALGIGGVPRGRVVEIYGPESS
RECA_AMYMD      ---DKDKALELALAQIDKQYGKGSVMRLGEEGR-APIAVIPTGAIALDVALGIGGLPRGRVIEVYGPESS
RECA_CLOPS      IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGRIIEIYGPESS
RECA_CLOPE      IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGRIIEIYGPESS
RECA_CLOP1      IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGRIIEIYGPESS
RECA_CHLSY      ---EKEKALAATMAQIDRKFGKGSIMKMGEASSRLAIEAIPTGSIALDIALGIGGVPRGRVVEIFGPESS
RECA_CHLAA      ---EKEKALAATMAQIDRKFGKGSIMKMGEASSRLAIEAIPTGSIALDIALGIGGVPRGRVVEIFGPESS
RECA_RHILW      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_RHIL3      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_AGRRK      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETVSTGSLSLDIALGIGGLPKGRIVEIYGPESS
RECA_RHIE6      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVIEIETISTGSLGLDIALGVGGLPKGRIIEIYGPESS
RECA_LISWE      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISW6      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISSE      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISIV      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_RHILO      ---DKSKALDAALSQIERAFGKGSIMRLGANEQVVEIETVPTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_LISMO      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISMH      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISMF      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISMC      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_LISIN      ---DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIEVYGPESS
RECA_RHIET      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVIEIETISTGSLGLDIALGVGGLPKGRIIEIYGPESS
RECA_OCHA4      ---DKTKALDAALSQIERAFGKGSIMRLGKNAPVIEIETVPTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_CLOBA      ----KLKAIENAMGQIEKQFGKGSVMKLGEDSV-LNIDAISTGCLDLDIALGIGGVPKGRIVEIYGPESS
RECA_BRUSU      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUME      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUMB      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUC2      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUAB      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUA2      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BRUA1      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_CLOBB      ----KLKAIENAMGQIEKQFGKGSVMKLGENSV-LNIDAISTGCLDLDIALGIGGVPKGRIVEIYGPESS
RECA_DICNV      MNEEQKKALTAVLTQLDKQFGKGTVMRLGEQVAAHDIQAISTGSLTLDIALGIGGLPKGRIVEIYGPESS
RECA_BRUSI      ---DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_BREBN      ---DRRAALESALRQIEKQFGKGSIMKLGEVSN-IQISTASSGALALDIALGVGGFPRGRIVEIYGPESS
RECA_BIFLO      LDPKRKAALDTALAQVEKSFGKGSAMRLGDQPEQ-NVEVIPTGSLALDMALGIGGLPKGRIVEIYGPESS
RECA_CLOTE      MDKEKLKAIEAAMGNIEKQFGKGSVMKLGEK-NILDIEAISTGCLGMDIALGIGGVPKGRIVEIYGPESS
RECA_RHILV      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_BIFBR      LDPKRKAALDTALAQVEKSFGKGSAMRLGDQPVQ-NVEVIPTGSLALDMALGIGGLPKGRIVEIYGPESS
RECA_BACCN      ---DRQAALDMALKQIEKQFGKGSIMKMGEQA-ERKVSTVPSGSLSLDVALGVGGYPRGRIIEIYGPESS
RECA_CHLAD      ---EKEKALAAAMAQIDRKFGKGSIMKMGEVGGRLAIEAIPTGSIALDIALGIGGVPRGRVIEIFGPESS
RECA_GEOSL      MTQEREKAIELALSQIEKQFGKGAIMRLGADEALPDVAAIPTGSLSLDLALGVGGVPRGRIIEIYGPESS
RECA_STRLI      ---DREKALDAALAQIERQFGKGAVMRMGDRTNE-PIEVIPTGSTALDVALGVGGIPRGRVVEVYGPESS
RECA_STRCO      ---DREKALDAALAQIERQFGKGAVMRMGDRTNE-PIEVIPTGSTALDVALGVGGIPRGRVVEVYGPESS
RECA_STRAM      ---DREKALDAALAQIERQFGKGAVMRMGDRSKE-PIEVIPTGSTALDVALGVGGLPRGRVIEVYGPESS
RECA_RHOE4      ---DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_AGRVS      ---DKSKALEAALSQIERSFGKGSIMKLGANEKIVEVETVSTGSLSLDIALGIGGLPKGRIIEIYGPESS
RECA_STRRM      ---DREKALDAALAQIERQFGKGAVMRMGERSKE-PIEVIPTASTALDVALGVGGIPRGRVVEIYGPESS
RECA_CLOB8      INAEKLKAIESAMSHIEKQFGKGSVMKLGD--HNINMDAISTGCLDLDIALGIGGVPKGRIIEIYGPESS
RECA_HERA2      ISPEKEKALAAALSQIDRQFGKGAIMRMSD--QRLSIEAIPTGSIALDLALGVGGIPRGRVIEIYGPESS
RECA_BACLI      ---DRQAALDMALKQIEKQFGKGSIMKLGEQT-ETRISTVPSGSLALDAALGVGGYPRGRIIEVYGPESS
RECA_BACLD      ---DRQAALDMALKQIEKQFGKGSIMKLGEQT-ETRISTVPSGSLALDAALGVGGYPRGRIIEVYGPESS
RECA_NITWN      ---DKSKALSAALSQIERQFGKGSVMKLGKNDKSMDVEVISSGSLGLDIALGVGGLPKGRIVEVYGPESS
RECA_BACP2      ---DRQAALDMALKQIEKQFGKGSIMKLGEQT-DTRISTVPSGSLALDTALGIGGYPRGRIIEVYGPESS
RECA_SACEN      ---DKGKALELALAQIDKQYGKGSVMRLGDETR-APIEVIPTGSISLDVALGIGGLPRGRIVEVYGPESS
RECA_NOCSJ      ---DREKALDAALANIEKQFGKGSVMRLGDEVR-APLEIIPSGSIALDVALGLGGFPRGRVVEIYGPESS
RECA_MESSB      ---DKSKALDAALSQIERAFGKGSIMRLGANDKVVEIETISTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_SYNAS      ---DRAKAVDLAISQIERQFGKGSIMRLGAKERIEDIAVIPTGALSLDIALGIGGVPRGRIIEIFGPESG
RECA_BACSU      ---DRQAALDMALKQIEKQFGKGSIMKLGEKT-DTRISTVPSGSLALDTALGIGGYPRGRIIEVYGPESS
RECA_RHOPA      ---DKSKALSAALSQIERQFGKGSVMRLGKNDRSMDIETISSGSLGLDIALGVGGLPKGRIVEIYGPESS
RECA_CHRVI      MDENRKKALAAALTQIEKQFGKGSVMRMGDVGAVRNIEAISTGSLGLDLALGIGGVPKGRVIEIYGPESS
RECA_BACA2      ---DRQAALDMALKQIEKQFGKGSIMKLGEKT-DTRISTVPSGSLALDTALGIGGYPRGRIIEVYGPESS
RECA_ARTAT      ---DREKALEAALAQIDKQFGKGSIMRLGDDTR-APIEVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_OCEIH      ---DRKQALDMALRQIEKQFGKGSIMKMGENEIP-KIATIPSGSLALDVALGIGGYPRGRVVEIYGPESS
RECA_NITHX      ---DKSKALSAALSQIERQFGKGSVMKLGKNDKSMDIEVISSGSLGLDIALGVGGLPKGRVVEIYGPESS
RECA_METNO      MDKDKSKAIDAALAQIERAFGKGSIMRLGKGDKVQEVETISTGSLGLDIALGVGGLPRGRVIEIYGPESS
RECA_SALAI      ---DRERALDLALAQIDKQFGKGSVMRLGERPV-VQTAVVPTGSIALDVALGVGGLPRGRVIEVYGPESS
RECA_PROAC      ---DREKALATALQQIEKQHGKGSIMRLGEQ-ETVKIAAIPTGSVALDVALGVGGLPRGRIVEIYGPESS
RECA_BACWK      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRISTISSGSLALDVALGVGGYPRGRVIEIYGPESS
RECA_SALTO      ---DRERALDLALAQIDKQFGKGSVMRLGERPV-VETAVVPTGSIALDVALGVGGLPRGRVIEVYGPESS
RECA_CORU7      ---DRSKALDLAMAQIEKDFGKGAIMRLGDENRP-PISAIPSGNIAINVALGIGGFPRGRVVEIYGPESS
RECA_GEOMG      MTQEREKAIELALSQIEKQFGKGAIMRLGADEALPDIDAIPTGALSLDIALGVGGVPRGRVIEIYGPESS
RECA_BACCR      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACC4      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACC3      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACC2      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRISTISSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACC1      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACAN      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_BACAH      ---DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESS
RECA_PORGI      -DEKKLQALRMATEKIEKTFGKGAIMNMGANTVE-DVSVIPSGSIGLDLALGVGGYPRGRIIEIYGPESS
RECA_PORG3      -DEKKLQALRMATEKIEKTFGKGAIMNMGANTVE-DVSVIPSGSIGLDLALGVGGYPRGRIIEIYGPESS
RECA_BACTN      -SSEKLKALQATMEKIEKNFGKGSIMKMGDDSVE-QVEVIPTGSIALNVALGVGGYPRGRIIEIYGPESS
RECA_BACFR      -------------DKIEKSFGKGSIMKMGEEVVE-QVEVIPTGSIALNAALGVGGYPRGRIIEIYGPESS
RECA_THICR      MDENKKKALEAALGQIEKQFGKGSIMRMGDKGAIRDIDSVSTGSLGLDVALGIGGLPRGRVVEIYGPESS
RECA_SYMTH      LDPAKQKAIDMALAQIEKQFGKGSIMRLGEQMSRLNVEVIPTGSVALDVALGVGGLPRGRITEIYGPESS
RECA_EXISA      ---DRKQALEMALRQIEKQFGKGSIMRLGENT-DQQVSVIPSGSIALDVALGAGGYPRGRVIEVYGPESS
RECA_BACSK      ---DRKQALDMALRHIEKQFGKGSIMKLGEQAEQ-RVSTVSSGTLALDIALGVGGYPKGRVIEVYGPESS
RECA_SYNFM      --DERQRAIDTAVSQIERMCGKGAIMRLGEGAQNVEIPVISTGCLSLDLALGIGGVARGRIMEIFGPESS
RECA_KINRD      -------------------FGKGSVMRLGDEVRP-PIEVIPTGSISLDVALGIGGLPRGRVVEIYGPESS
RECA_ARTCA      ---DRAKALEAALAQIDKQFGKGSVMRLGDEVR-APIEVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_THETN      ---EKQKALEMAISQIERQFGKGAIMRLGDTAK-LNVEVIPTGSLELDIALGVGGVPRGRIIEIFGPESS
RECA_MAGSA      ---DRQKALEAAVSQIERAFGKGSIMKLGGKDQVVETEVVSTGSLGLDVALGIGGVPRGRIIEVYGPESS
RECA_ALTMD      MDDNKSKALTAAVGQIEKQFGKGAIMRLGDN-QAMDIEAISTGSLTIDIALGIGGLPCGRVVEIYGPESS
RECA_METRJ      VDKDKSKAIDAALSQIERAFGKGSIMRLGKSDKVQEVETVSTGSLGLDIALGVGGLPRGRVIEIYGPESS
RECA_ACIC1      ---DREKALEHAIAQIERAHGKGSLMRLGDEAR-APIDVIPTGSIALDVALGIGGLPRGRIVEIYGPESS
RECA_PROMI      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGRIVEIYGPESS
RECA_PROMH      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGRIVEIYGPESS
RECA_MACCJ      ---ERQKALDTVIKNMEKSFGKGAVMKLGDRT-DRNVSTVSSGSITLDSALGVGGYPKGRIIEIYGPESS
RECA_ARTS2      ---DRQKALDAALAQIDKQFGKGSVMRLGDEVR-APIEVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_GLUOX      ---DKTKALEGALSQIERAFGKGSIMRMGQRPK-VETNVISTGSIGLDIALGIGGMPRGRIVEIYGPESS
RECA_CLAM3      ---DREKSLETALAQIDRQFGKGSVMRLGSDER-APVAVIPTGSVALDVALGIGGLPRGRIVEIYGPESS
RECA_PRERU      --QEKLKALQAAMSKIEKDYGKGSIMRMGDEQID-NVEVIPTGSIGLNAALGVGGYPKGRIIEIYGPESS
RECA_BORPD      --------------QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEIYGPESS
RECA_MYCA9      ---DREKALELALAQIDKSFGKGSVMRLGDEVRQ-PISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_ENTFA      MADDRKVALDAALKKIEKNFGKGSIMKLGEKA-DQKISTIPSGSLALDVALGVGGYPRGRIIEVYGPESS
RECA_LACPL      MADARKAALDTALKKIEKNFGKGAIMRMGDAAQT-TISTISSGSLALDDALGVGGYPRGRIVEIYGPESS
RECA_EXIS2      ---DRKAALEMALRQIEKQFGKGSIMKLGESA-DQRVSVISSGSITLDIALGAGGYPRGRVIEVYGPESS
RECA_XYLFA      MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGRVVEIYGPESS
RECA_AGRT5      ---DKSKALEAALSQIERSFGKGSIMKLXXXXXXXXXXXXXXXXLSLDIALGIGGLPKGRIIEIYGPESS
RECA_ERWCA      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGRIVEIYGPESY
RECA_BACHD      ---DRKAALDMALRQIEKQFGKGSIMKLGEQAEQ-RVSTISSGALALDIALGVGGYPRGRVIEVYGPESS
RECA_STRMK      MDENKKRALAAALGQIEKQFGKGSVMRMGDRVVE-PVEAIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_METCL      MDDNKSKALAAALSQIEKQFGKGSIMRMGDADIGEDLQVVSTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_STAS1      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-KARKVSSVSSGSVTLDNALGVGGYPKGRIVEIYGPESS
RECA_XYLFM      MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGRVVEIYGPESS
RECA_GEOSM      --DKAEKALDLAMSQIEKQFGKGAIMRLGNEEALPDIASIPTGSLSLDIALGVGGVPRGRVIEIFGPESS
RECA_GEOBB      --DKAEKALDLAMSQIEKQFGKGAIMRLGNEEALPDIASIPTGSLSLDIALGVGGVPRGRVIEIFGPESS
RECA_XYLFT      MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGRVVEIYGPESS
RECA_XYLF2      MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGRVVEIYGPESS
RECA_COXBU      --DNRSNALNAALSQIERQFGKGSVMRLGDPGLIPDIDVISTGSLGLDIALGVGGLPRGRIIEIYGPEAS
RECA_BARHE      ---DKIKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_CHLTE      ------KQLNLAIETLEKQFGKGAIMRLGDDSAVMHVQVISTGSMALDYALGVGGLPRGRVTEIYGPESS
RECA_LEPIN      VDDSKKLAIEQAMSQIEKQFGKGSIMKLGSDSAKQTVQVIPSGSLDLDIALGIGGYPIGRIVEIYGPESS
RECA_LEPIC      VDDSKKLAIEQAMSQIEKQFGKGSIMKLGSDSAKQTVQVIPSGSLDLDIALGIGGYPIGRIVEIYGPESS
RECA_STRM5      MDENKKRALAAALGQIEKQFGKGSVMRMGDRVVE-PVEAIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_STACT      MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KARRVSSISSGSVTLDNALGVGGYPKGRIVEIYGPESS
RECA_LEPME      --DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMAEMNVVSTGSLDLDIALGIGGFPSGRIVEIYGPESS
RECA_BORPE      --------------QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESS
RECA_BORPA      --------------QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESS
RECA_BORBR      --------------QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESS
RECA_PSEA6      MDDNKTRALTAALGQIEKQFGKGAIMRLGDN-QAMDIEAISTGSLTIDIALGIGGLPCGRVVEIYGPESS
RECA_DESAH      ---EKDKAIQTAMGQIERQFGKGSIMKLGAREIQA-VPIISTGSLALDKALGVGGFPRGRVIEIYGPESS
RECA_CORA7      --DDRQKALDAAMAMIEKDFGKGAVMRLGDDDRP-PIQAISSGNTAIDIALGVGGFPRGRIVEIYGPESS
RECA_LACPE      MADARKAALDTALKKIEKNFGKGAIMRMGDAAQT-TISTISSGSLALDDALGVGGYPRGRIVEIYGPESS
RECA_CHLP8      ------KQLNLAIETLEKQFGKGSIMRLGDDSAVMHVKAISTGSMALDYALGVGGFPRGRVTEIYGPESS
RECA_ACHLI      -DNKKQQALELALKQIEKQFGKGSIMKLGDGA-DHSIEAIPSGSIALDIALGIGGYPRGRIIEVYGPESS
RECA_DELAS      ---------------IEKQFGKGTIMRLGEGEAIQDIQVVSTGSLGLDIALGVGGLPRGRVIEIYGPESS
RECA_ACHLA      -DNKKQQALELALKQIEKQFGKGSIMKLGDGA-DHSIEAIPSGSIALDIALGIGGYPRGRIIEVYGPESS
RECA_XANCP      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_XANCB      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_XANC8      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_PSEOL      MDQAKSKALEAALSQIEKQFGKGSIMRLGSD-RTMDIDVISTGSLGLDIALGVGGLPRGRIVEIYGPESS
RECA_METPP      LNTEXXXXXXXXXXXIEKQFGKGTIMRLGEGEVIDDIEVVSTGSLGLDIALGVGGLPRGRVIEIYGPESS
RECA_LEIXX      ---DREKALVTALAQIDRQFGKGSVMRLGSDER-APVEVVPTGSIALDVALGIGGLPRGRIVEIYGPESS
RECA_ALHEH      MDENRKKALGAALGQIERQFGKGAVMRMGDARAVRDVEVISTGSLQLDIALGVGGLPKGRVVEIYGPESS
RECA_SERMA      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_CHLL2      ----KLKQLNLAVDALEKQFGKGAIMRLGDGSAVMQVQSISTGSMTLDFALGVGGLPRGRVAEIYGPESS
RECA_STAHJ      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXTLDNALGVGGYPKGRIIEIYGPESS
RECA_CITK8      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_CHLCH      VDSAKLKQLNLAVDALEKQFGKGTIMRMGDGSAGLTVQAISTGSMALDFALGVGGLPRGRVTEIYGPESS
RECA_SHISS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHISO      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHIFL      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHIF8      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHIDS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHIBS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHIB3      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALTY      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALTI      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALSV      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALPK      IDENKQKALAAAMGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALPC      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALPB      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALPA      IDENKQKALAAAMGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALNS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALHS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALG2      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALEP      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALDC      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALCH      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SALA4      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ESCF3      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ENT38      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRVVEIYGPESS
RECA_ECOUT      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOSM      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOSE      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOLU      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOLI      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOLC      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOL6      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOL5      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOHS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECOBW      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO8A      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO81      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO7I      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO5E      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO57      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO55      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO45      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO27      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ECO24      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_BRAJA      ---DKSKALAAALSQIERQFGKGSVMKLGKNDRSMDVEAVXXXXXXXXXXXXXXXXPKGRVVEIYGPESS
RECA_YERPS      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPB      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERP3      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_XANOR      MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGRVVEIYGPESS
RECA_XANOP      MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGRVVEIYGPESS
RECA_XANOM      MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGRVVEIYGPESS
RECA_STAAW      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAU      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAT      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAS      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAR      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAN      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAM      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAE      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAC      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAAB      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAA9      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAA2      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_STAA1      MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGRIIEIYGPESS
RECA_RHIEC      ---DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETVSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_PHOLL      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_MAGMG      ---DRQKALEAAVSQIERAFGKGSIMKLGGKDQVVETEVVSTRILGLDVALGIGGVPRGRIIEVYGPESS
RECA_RHIME      ---DKSKALEAALSQIERSFGKGSIMKLGAKDSVVEIETVSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_MANSM      -NDEKSKALAAALGQIEKQFGKGAIMKLGDT-QALDVESISTGSIGLDVALGIGGLPMGRVVEIFGPESS
RECA_LACJO      ----------------EKDFGKGAVMRMGEKV-DTQISTIPSGSLALDAALGVGGYPRGRIIEVYGPESS
RECA_ERWCT      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPP      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_XENBV      -DENKQKALAAALGQIEKQFGKGSIMRLGEN-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_VIBCH      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_STAES      MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXXXDNALGVGGYPKGRIIEIYGPESS
RECA_STAEQ      MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXXXDNALGVGGYPKGRIIEIYGPESS
RECA_MARAV      MEDNRKKALGAALSQIERQFGKGAVMKMGDQPREA-IPAVSTGSLGLDVALGIGGLPYGRIVEIYGPESS
RECA_KLEP7      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_KLEP3      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_ENTS8      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_DESPS      --KDKAGSVENAISQIQKQFGKGSIMRLGEQALEA-IPVISTGALSLDIALGVGGLPKGRMTEIYGPESS
RECA_AERHH      MDQNKQKALAAALGQIEKQFGKGSIMRLGDS-KTMDIEAISTGSLSLDVALGIGGLPCGRIVEIYGPESS
RECA2_MYXXA     VNQEKEKAIELAMSAVERQFGKGSIMRLGNDEPMMDVQAIPTGSISLDIALGVGGVPKGRIIEIFGPESS
RECA_SHEAM      IDPNKEKALAAVLGQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_PECCP      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHEDO      ----KEKALAAVLSQIEKQFGKGSIMKLGED-RTMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_RHISN      ---DKSKALEAALSQIERSFGKGSIMKLGSKDSVIEIETVSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_BDEBA      -NSEKIKALELAVSTIEKQFGKGSIMRLGANESLVDVEAISTGALSLDIALGIGGLPKGRICEIYGPESS
RECA_VIBC3      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_VIBAN      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RTMDVETISTGSLSLDIALGAGGLPMGRIVEVYGPESS
RECA_SINMW      ---DKSKALEAALSQIERAFGKGSIMKLGAKDSVVEIETVSTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_YERPY      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPN      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPG      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPE      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_YERPA      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_VIBVY      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_VIBVU      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_TOLAT      MDSNKEKALAAALGQIEKQFGKGSIMRLGDT-QSLDIDSIPTGSLSLDIALGIGGLPMGRIVEIFGPESS
RECA_SHEWM      IDANKEKALNAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEHH      ----KEKALNAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_LEPBP      --DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMSEMNVVSTGSLDLDIALGIGGFPSGRIIEIYGPESS
RECA_LEPBA      --DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMSEMNVVSTGSLDLDIALGIGGFPSGRIIEIYGPESS
RECA_LACBA      MADERQAALDKALKKIEKDFGKGSIMRLGDNSN-LEVETVPSGSLALDVALGVGGYPRGRIVEIYGPESS
RECA_CLONN      MNNEKMKALQAAITQIEKQFGKGSVMKLGEE-HVLNVEAISTGSLSLDIALXXXXXXXXXXXXXXXXESS
RECA_YERE8      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHELP      IDANKEKALSAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDVALGAGGLPLGRIVEIYGPESS
RECA_SERP5      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_VIBPA      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHEPW      ----KEKALNAVLGQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_CORJK      --KDRSKALELAMAQIEKDFGKGAIMRLGDDTRP-PXXXXXXXXXXXXXXLGIGGFPRGRVVEIYGPESS
RECA_LACRJ      MADQRKAALDVAIRKIEKNFGKGSIMRMGDAT-DMKVASVSSGSLAIDKALGIGGYPRGRIVEIYGPESS
RECA_LACRD      MADQRKAALDVAIRKIEKNFGKGSIMRMGDAT-DMKVASVSSGSLAIDKALGIGGYPRGRIVEIYGPESS
RECA_TROWT      ----RTRALELALANIDRQYGKGAVMRMNDA-QKAYIDVIPTGSIALDYALGVGGLPRGRIVEIYGPESS
RECA_TROW8      ----RTRALELALANIDRQYGKGAVMRMNDA-QKAYIDVIPTGSIALDYALGVGGLPRGRIVEIYGPESS
RECA_LACSS      --DERQAALDAALKKIEKNFGKGSIMRMGEKV-DTQVSTVSSGSLALDEALGVGGYPRGRIVEIYGPESS
RECA_ENTAG      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_EDWI9      MDENKQRALAAALGQIEKQFGKGSIMRLGDT-QTLDIESISTGSLSLDVALGIGGLPMGRIVEIFGPESS
RECA_BARQU      ---DKTKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLSLDIALGVGGLPKGRIVEIYGPESS
RECA_XANC5      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_SHESW      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHESA      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEPC      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEON      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_ACICJ      ---EKNKALDAALAQIERAFGKGSIMRMGSRSESEAIDVISTXXXXXXXXXXXXXXPRGRVIEIYGPESS
RECA_ERWT9      IDDNKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SHEB9      VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEB8      VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEB5      VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHEB2      VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_RICB8      -NIDKEKAVAAALAQIEKSYGKGSVMKLGQRPN-VDIESVSTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_XANCI      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_XANAC      MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGRVVEIYGPESS
RECA_TERTT      MDANKEKALQAALQQIDRQFGKGTVMRMGDKELEA-IPAVSTGSLGLDVALGIGGLPKGRIVEIYGPESS
RECA_STRAW      ---DREKALDAALAQIERQFGKGAVMRLGERPNE-PIEVIPTGSTALDXXXXXXXXXXXXXXEVYGPESS
RECA_SHESR      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_SHESM      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEIYGPESS
RECA_ENTGA      ---------------IEKNYGKGAIMKLGEKV-DQQISTIPSGSLALDVALGVGGYPRGRIVEVYGPESS
RECA_BART1      ---DKTKALDAALSQIERSFGKGSIMRLGQKEQVVEIETVPTGSLSLDIALGIGGLPKGRIVEIYGPESS
RECA_SHEFN      VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RTMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SACD2      --------------QIDRQFGKGTVMRLGDKGRE-KMPAISTGSLGLDVALGIGGLPKGRIVEIYGPESS
RECA_ENTHR      ---------------IEKNYGKGSIMKLGEK-IDQQVSTIPSGSLALDVALGVGGYPRGRIIEVYGPESS
RECA_CLOD6      VDQEKLKALNEALGKIEKDFGKGSVMKLGEAT-SMSIDVISTXXXXXXXXXXXXXXPRGRIVEVYGPESS
RECA_CHLT3      VKDEKLKQLNLAVESLEKQFGKGAIMRLGDDAV-VQVPVVSTGSISLDYALGVGGLPKGRIVEIYGPESS
RECA_RICTY      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAISTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_METS4      MDKDKSKAIDAALAQIERAFGKGSIMRLGKGDKVQEVETISTXXXXXXXXXXXXXXPRGRVIEIYGPESS
RECA_ENTMU      ---------------IEKNYGKGSIMKLGEK-IDQQISTIPSGSLALDVALGIGGYPRGRIIEVYGPESS
RECA_AERS4      MDQNKQKALAAALGQIEKQFGKGSIMRLGDS-KTMDIEAISTGSLSLDVALGIGGLPCGRIVEIYGPESS
RECA_ROSS1      LSPEKEKALAAAMSQIDRKYGKGSIMRMGEVSSKLAIEVIPTGSIALDIALXXXXXXXXXXXEIYGPESS
RECA_RHORT      ---DKQKALEAAVGQIERAFGKGSIMKLGQRGSVVDIESISTXXXXXXXXXXXXXXPRGRIVEIYGPESS
RECA_SODGM      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_SODGL      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_RICPR      -NIDKERAIAAALAQIEKSYGKGSVMKLGQRPN-VDIEAISTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_DESDG      --EMRREALNTALSTIERKYGSGSVMKLSDDAHT-NVAVIPSGSIGLDLALGVGGIPRGRVTEIYGPESS
RECA_SULNB      MDAQKQKALDMAIKQIDKTFGKGTLMRLGDKEFE-PIAAISTGSLGLDMALGIGGIPQGRIVEVYGPESS
RECA_XENNE      -DENKQKALAAALGQIEKQFGKGSIMRLGEN-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_THISH      MDENRKKALSAALGQIERQFGKGAVMRMGDSTAVRDVEAISTXXXXXXXXXXXXXXPKGRVVEIYGPESS
RECA_STRVL      ---DREKALDAALAQIERQFGKGAVMRMGDRTQE-PIEVISTGSTALDIAXXXXXXXXXXXXEIYGPESS
RECA_LACF3      MADQRKAALDNALRKIEKNFGKGSIMRMGDAA-DTKIATISSGSLAIDEALGVGGYPRGRIIEMYGPESS
RECA_ALISL      --------------QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_VIBNA      MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGRIVEVYGPESS
RECA_ROSCS      LSPEKEKALAAAMSQIDRKYGKGSIMRMGEASSKLAIEVIPTGSIALDIALXXXXXXXXXXXEIYGPESS
RECA_SHESH      IDANKEKALNAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_METCA      MDENKRKALGAALSQIEKQFGKGSVMRMGDVAAVRDIDVIPTGSLALDIALGCGGLPRGRIVEIYGPESS
RECA_RALEJ      LSAEKQKALAAALSQIEKQFGKGSIMRMGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_RHOCA      ---DKQKALECALAQIERQFGKGSIMKLGGDTPPPEIEATSTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_JANMA      -SSDKSKXXXXXXXQIEKQFGKGSVMRMEDGAVVEEVQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_HAES2      --------------QIEKQFGKGAIMKLGET-QKLDIEAISTGSLSLDVALGIGGLPMGRIVEIFGPESS
RECA_HAES1      --------------QIEKQFGKGAIMKLGET-QKLDIEAISTGSLSLDVALGIGGLPMGRIVEIFGPESS
RECA_NAUPA      MDANKQKALELAMKQIDKQFGKGSLVKLSDKDIE-PIAAIPTGSFGLDLALGIGGIPKGRITEIYGPESS
RECA_RICFE      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAVSTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_RICCK      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAVSTGSLGLDMALGIGGVPKGRIIEIFGPESS
RECA_PROVU      IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_HAEIN      --EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIVEIFGPESS
RECA_HAEIG      --EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIVEIFGPESS
RECA_HAEIE      --EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIVEIFGPESS
RECA_HAEI8      --EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIVEIFGPESS
RECA_CORGL      ---DRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQTISSGNTAIDIALGIGGFPRGRIVEVYGPESS
RECA_CORGB      ---DRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQTISSGNTAIDIALGIGGFPRGRIVEVYGPESS
RECA_FRATW      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATT      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATO      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATN      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATM      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATH      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRATF      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRAT1      ----KEKALESALSQIEKQFGKGAIMRLGEAAHDID--VIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_FRAP2      ----KEKALESALSQIEKQFGKGSIMRLGDQETAHDIDVIPSGIIALDVALGIGGYPKGRIIEIYGHESS
RECA_ENTFC      ---------------IEKSYGKGSIMKLGEK-IDQQISTIPSGSLALDVALGVGGYPRGRIIEVYGPESS
RECA_AQUPY      ---EKMKALEVALSSIEKRFGKGAVMPL-KAVETVEVETIPTGSISLDIATGVGGIPKGRITEIFGVESS
RECA_ACTAC      --EEKQKALDAALGQIEKQFGKGAIMKLGDS-QKLDIEAISTGSFGLDLALGIGGLPMGRIVEIFGPESS
RECA_ACIAD      MDDNKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIVEIYGPESS
RECA_VIBFM      --------------QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_VIBF1      --------------QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIFGPESS
RECA_NITEC      MDENKNKALTAALAQIEKQYGKGSIMRLGDSDVAKDIQVVSTGSLSLDIALGVGGLPRGRIIEIYGPESS
RECA_RHOOB      ---DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSISLDVALGIGGLPRGRVVEIYGPESS
RECA_NITSB      MDTNKQKALDLAIKQIDKAFGKGALVKLGDKQIE-PIESISTGSLGLDLALGIGGVPKGRIVEIYGPESS
RECA_COREF      --DDRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQVISSGNTALDIALGIGGFPRGRIVEVYGPESS
RECA_CUPTR      VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_BARBK      ---DKKKALDAALSQIERSFGKGSIMRLGQKEGVVEIETISTGSLSLDIALGVGGLPKGRIIEIYGPESS
RECA_RICAE      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_RALEH      VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_CHLTR      ---DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_CHLTB      ---DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_CHLT2      ---DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_CHLMU      ---DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIIEIFGPESS
RECA_RICCN      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_RHOS4      ---DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_RHOS1      ---DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_RHOSR      ---DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_RHOS5      ---DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_HAMD5      ---------------IEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_CHLFF      ---DRKKALEAAIAYIEKQFGSGSIMSLGKHSATHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_AZOLI      ---DKQKALDAALSQIERAFGKGSIMKLGARENLVETEVISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_SYNP2      -NPDKEKALNLVLNQIERNFGKGAIMRLGDAAQ-MKVATIPSGALTLDQAMG-GGFPRGRIVEIYGPESS
RECA_LEGPN      MEENKQKALSAAVSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_IDILO      MSNDRQKALDAALGQIERQFGKGSIMRLGDN-QTLDIDSVSTXXXXXXXXXXXXXXPFGRVVEIYGPESS
RECA_HELHP      VDEKRQKAIELALKQIDKAFGKGALVRLGDKQVE-KIDSISTGSLGLDMALGIGGVPKGRIIEIYGPESS
RECA_CHRVO      -SEDKSKALAAALAQIEKQFGKGSIMRMSDNQITENLQVISTGSLTLDLAXXXXXXXXXXXXEIYGPESS
RECA_LEGPH      MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_LEGPC      MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_LEGPA      MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_CHLTA      ---DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_CORDI      --DNRKKALDAALAMIEKDFGKGAVMRLGDENRP-PISAISSGNTAIDVALGIGGFPRGRIVEVYGPESS
RECA_DECAR      ---------------IEKQFGKGSIMKMGDAEIDEGIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_ACIBY      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_ACIBT      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_ACIBS      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_ACIBC      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_ACIB5      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_ACIB3      MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGRIIEIYGPESS
RECA_RHOCS      ---DKQKALDAALGQIERAFGKGSIMKLGAREAMAETEAISTXXXXXXXXXXXXXXPRGRIVEIYGPESS
RECA_LEGPL      MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_CORPS      --DNRQKALDAALAMIEKDFGKGAVMRLGDDNRP-PISAISSGNTAIDVALGIGGFPKGRIVEVYGPESS
RECA_RICPU      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRIIEIFGPESS
RECA_RHOVI      ---DKTKALDAALTQIERAFGKGSIMRLGKSGAALEVETISTXXXXXXXXXXXXXXPRGRVVEIFGPESS
RECA_NOCFA      ---DRDKALELALAQVEKSFGKGAVMRLGEEARQ-PISVIPTGSIALDVALGIGGLPRGRIVEIYGPESS
RECA_MYCS2      ---DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIEIYGPESS
RECA_MYCGI      ---DREKALELALAQIDKNFGKGSVMRLGEDVRP-PIAVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_POLNA      LNTEKARALAVALAQIEKQFGKGTIMKLGAGEVIEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_BAUCH      IDENKQKALAAALSLIEKQFGTGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
RECA_AQUAE      ---EKKKALEVALSNIEKRFGKGAVMPL-KSVEKVQVETIPTGSLALDIATGVGGIPKGRITEIFGVESS
RECA_DEIGD      -SKERLKAIETAMTQIEKAFGKGSIMRLGAESK-LDVQAVSTGSLSLDLALGVGGIPRGRITEIYGPESG
RECA_RALME      VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEIEQDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_FRAAA      ---DRDKALDNALAQIDKAFGKGSVMRLGDDTRP-PIQAIPTGSIALDVALGIGGLPKGRVIEIYGPESS
RECA_DESVV      --EMRREALETALSTIERKYGLGAVMKLSDEAH-VAIPVIPTGSIGLDLALGVGGVPRGRVTEIYGPESS
RECA_DESVH      --EMRREALETALSTIERKYGLGAVMKLSDEAH-VAIPVIPTGSIGLDLALGVGGVPRGRVTEIYGPESS
RECA_CYAP8      -NPDKEKALGLVLNQIERNFGKGSIMRLGDAAR-MRVETISSGSLTLDLALG-GGLPQGRIIEIYGPESS
RECA_CHLCV      ---DRKKALEAAIAYIEKQFGAGSIMSLGKHSATHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_CHRSD      -DDNRSKALNAALSQIERQFGKGAVMRLGDTPR-VATPAISTGSLGLDIALGVGGLPMGRVVEIFGPESS
RECA_STRGC      --DERQKALDNALKNIEKDFGKGAIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_MYCVP      ---DREKALELALAQIDKNFGKGSVMRLGEEVRQ-PIAVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_CAMLR      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-KIDSIPTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_ANAMF      VESEKQKALDAAISQIERAFGRGAIMKLKQHPAE-KMDSVSTGSIALDAALGIGGLPKGRIVEIFGPESS
RECA_RALEU      VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEIEQDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_NITEU      MDENKNKALSAALAQIEKQYGKGSIMRLGDSDVAKDIQVVSTGSLGLDIALGVGGLPRGRIIEIYGPESS
RECA_CHLPN      ---DRKKALEAAVAYIEKQFGAGSIMSLGRHSATHEISTIKTGALSLDLALGIHGVPKGRVIEIFGPESS
RECA_ANAMM      VESEKQKALDAAISQIERAFGRGAIMKLKQHPAE-KMDSVSTGSIALDAALGIGGLPKGRIVEIFGPESS
RECA_NEIMF      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_NEIGO      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_NEIG2      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_NEIG1      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_WOLWR      -NSDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRIIEIFGPESS
RECA_WOLPM      -NSDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRIIEIFGPESS
RECA_PASMU      --EEKNKXXXXXXGQIEKQFGKGSIMKLGDT-QALDVEAVSTGSLSLDVALGIGGLPMGRIVEIFGPESS
RECA_NEIMA      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_AZOSE      --------------QIEKQFGKGSIMRMGDGTIERDIQTVSTXXXXXXXXXXXXXXPRGRVVEIYGPESS
RECA_WIGBR      IENNKKKALEKALDKIEKQFGKGSIMTLGEN-RSMDIETISTGSLSLDIALGTGGLPMGRIVEIYGPESS
RECA_MYCSS      ---DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_MYCSK      ---DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_MYCSJ      ---DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_CAUCR      ---DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEIESVSTXXXXXXXXXXXXXXPKGRIVEVYGPESS
RECA_CAUCN      ---DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEIESVSTXXXXXXXXXXXXXXPKGRIVEVYGPESS
RECA_SILPO      ---DKQKALDSALAQIERQFGKGSIMRLGGENAIQEIEASSTXXXXXXXXXXXXXXPMGRIVEIYGPESS
RECA_NEIMB      --------------QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_LACAC      -------------------FGKGAVMRMGEKA-DTQISTVPTGSLALDAAIGVGGYPRGRIIEVYGPESS
RECA_HERSE      -------------------FGKGSVMRMEDGVIAEEIQAVSTXXXXXXXXXXXXXXPRGRVIEIYGPESS
RECA_CAMLA      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-KIDSIPTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_CAMJR      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_CAMJJ      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_CAMJE      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_CAMJ8      MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGRIIEIYGPESS
RECA_RUBXD      ---DKSKALDTAVSQIERQFGKGSIMRMGDRASQ-KVASISTXXXXXXXXXXXXXXPRGRIVEIFGPESS
RECA_TREDE      --DDKLKALEAARLQIEKQFGQGSLMKLGNNSAIGNIEIIPSGSILLDEALGIGGYPRGRIIEIFGPESS
RECA_STRZT      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRZP      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRZJ      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRR6      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRPS      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRPN      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRPJ      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRPI      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRP7      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRP4      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_STRP2      ---EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESS
RECA_HERAR      -SSDKSKXXXXXXXQIEKQFGKGSVMRMEDGAVVEEVQVVSTXXXXXXXXXXXXXXXXXXXXEIYGPESS
RECA_GLOVI      ---QKQKALKMVLTQIKRNFGEGAIMRLGENTR-IRVETVPSGAITLDLALG-GGLPRGRVIEIYGPESS
RECA_STRU0      --EDRRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_NITMU      MDENRSKALAAALSQIEKQFGKGSIMRLGASDVGKDVQVISTGSLGLDIALGVGGLPRGRIVEIYGPESS
RECA_HALHL      MDDDRKKALGAALGQIEKQFGKGAVMRMGDARAVRDVKSISTGSLALDVALGIGGLPRGRVVEIYGPESS
RECA_EHRRW      LNHDRQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSIPTGSIALDTALGIGGFPKGRIIEIFGPESS
RECA_EHRRG      LNHDRQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSIPTGSIALDTALGIGGFPKGRIIEIFGPESS
RECA_DESDA      --EARAEALGTALATIERKYGKGAVMKLSDDAH-VNIPVIPTGSIGLDLALGVGGIPRGRISEIFGPESS
RECA_DEIRA      --KERSKAIETAMSQIEKAFGKGSIMKLGAESK-LDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESG
RECA_ZYMMO      ---DKQKALEAALAQIDRAFGKGSVMRLGSR-EKIEIDTXXXXXXXXXXXXXXXXXPRGRIVEIYGPESS
RECA_STRPG      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRPC      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRPB      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRP8      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRP6      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRA5      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_STRA3      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_RHOBA      ---EKEPGLKTTLQQIEKSFGDGAIMPLG-ASQKLTIDCISTGSLSLDMALGGKGIPRGRIIEVFGPESS
RECA_BORA1      --------------QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_WOLPP      -NNDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRIIEIFGPESS
RECA_MYCPA      ---DREKALELAMAQIEKSYGKGSVMRLGDEMRQ-PISVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_MYCA1      ---DREKALELAMAQIEKSYGKGSVMRLGDEMRQ-PISVIPTGSIALDVALGIGGLPRGRVVEIYGPESS
RECA_COLP3      MKDDKEKALSAALAQIERQFGKGSIMKLGDNT-TMDVETISTXXXXXXXXXXXXXXPMGRVVEIYGPESS
RECA_STRMU      --DERKKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_STRPM      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRPA      --DEREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRP1      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_MYCMM      ---DREKALELAMAQIEKSYGKGSVMRLGDEVRQ-PISIIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_STRPF      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRPD      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRP3      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STREM      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_SHEPA      IDPNKEKALNAVLGQIEKQFGKGSIMKLGED-RSMDVETISTXXXXXXXXXXXXXXPMGRIVEIYGPESS
RECA_PARDE      ---DKQKALDSALAQIERQFGKGSIMKLGADNPVAEIEATSTXXXXXXXXXXXXXXPKGRIIEIFGPESS
RECA_STRS7      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRE4      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_MYCUA      ---DREKALELAMAQIEKSYGKGSVMRLGDEVRQ-PISIIPTGSIALDVALGIGGLPRGRVIEIYGPESS
RECA_PASHA      -------------------FGKGSIMKLGDT-QALDIEAVSTGSLGLDSALGIGGLPMGRIVEIYGPESS
RECA_ACEPO      ---DKSKALEGALSQIERAFGKGSIMRMGERPTE-QVDVISTXXXXXXXXXXXXXXXXXXXXEIYGPESS
RECA_TREPS      --EEKMKALEAARLQIEKQFGQGSLMKLGKDDAVQGVEVIPTGNILLDEALGIGGYPRGRIIEIFGPESS
RECA_TREPA      --EEKMKALEAARLQIEKQFGQGSLMKLGKDDAVQGVEVIPTGNILLDEALGIGGYPRGRIIEIFGPESS
RECA_STRPZ      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_PARL1      --------------QIERSFGKGSIMRLGKNEQIVEIESVSTXXXXXXXXXXXXXXXXXXXXEIYGPESS
RECA_CAUSK      ---DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEMESISTXXXXXXXXXXXXXXPKGRVIEIYGPESS
RECA_BURS3      MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEATENIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_EHRCR      LNQERQKALDSAISQIEKAFGRGAIMKLKQGAIE-KIDSISTGSIALDTALGIGGFPKGRIVEIFGPESS
RECA_LACDB      ---------------IEKNFGKGAVMRMGEKV-DTQISTVPSGSLALDAALGVGGYPRGRIVEIYGPESS
RECA_STRSV      --DERQKALDNALKNIEKDFGKGAIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_AZOSB      --------------QIEKQFGKGSIMRMGDGNVEKDIQTVSTXXXXXXXXXXXXXXPRGRVVEIYGPESS
RECA_LACLS      ---ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_LACLM      ---ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_LACLC      ---ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA1_LACLA     ---ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_STRAG      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIVEIYGPESS
RECA_BURCJ      MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_BURCE      MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_CYTH3      ---EKLKALQLTIDKLEKTYGKGTVMKLSDEVV-MDVPVISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEAE      MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEAB      MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEA8      MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEA7      MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_EHRCJ      LNQERQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSISTGSIALDTALGIGGFPKGRIVEIFGPESS
RECA_RICBR      -NIDKEKAVAAALAQIEKSYGKGSVMKLGQRPN-VDIESVSTXXXXXXXXXXXXXXPKGRIIEIFGPESS
RECA_BURM1      MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_PSEPW      MDDNKKRALAAALGQIERQFGKGAVMRMGD--HETGIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_LACDA      ---------------IEKNFGKGAVMRMGEKV-DTQISTVPSGSLALDAALGVGGYPRGRIVEIYGPESS
RECA_STRTD      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_STRT2      --DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_PSEE4      MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_HAHCH      MDDNRKKALTAALSQIERQFGKGAVMRMGEQPREI-IPSVSTXXXXXXXXXXXXXXPYGRIVEIYGPESS
RECA_AZOVD      MDENKKRALAAALGQIEKQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_THEM4      -NKQKKEVLKKAIGKIEKTFGKGSIMFLGEENAVQNIETISSGSVAIDIASGVGGYPRGRIVEIYGPESS
RECA_STRT1      --DERLKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_PSEPK      MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQ-GIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEPG      MDDNKKRALAAALGQIERQFGKGAVMRMGDQERQ-GIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEP1      MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQ-GIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_METFK      MDENRSKALAAALSQIEKQFGKGSIMRMGDTDVAADIQAVSTXXXXXXXXXXXXXXPRGRIVEIYGPESS
RECA_BURPS      LTAEKSKXXXXXXXQIEKQFGKGSIMRLGDGEAVEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_BURMA      LTAEKSKXXXXXXXQIEKQFGKGSIMRLGDGEAVEDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESS
RECA_PSEST      MDENKKRALAAALGQIEKQFGKGAVMRMGD--HDRQIPSISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_PSEPU      MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_CAMHC      MDDNKKKMLESALKSIDKAFGKGTLVRLGDKEVE-KIDSISTGSVGLDIALGIGGVPKGRIVEIYGPESS
RECA_BORDL      ----KEKAIELARVQIEKDFGKGSLIKMGESPVGKYLESIPSGSILLDEAIGIGGYPRGRVVEIFGPESS
RECA_HELPH      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_AZOVI      MDENKKRALAAALGQIEKQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_WOLTR      -SNDRQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRIVEIFGPESS
RECA_SYNP6      ---EKEKALNLVLSQIERNFGKGAIMRLGDAAR-LRVETI-SXXXXXXXXXXXXXXPKGRIIEVYGPESS
RECA_SYNE7      ---EKEKALNLVLSQIERNFGKGAIMRLGDAAR-LRVETI-SXXXXXXXXXXXXXXPKGRIIEVYGPESS
RECA_CHLAB      ---DRKKALEAAIAYIEKQFGSGSIMSLGKHSASHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESS
RECA_ACIF5      MDEQRSKALSAALSQIDKQFGKGAVMRLGDHNAIKDIEVYSTXXXXXXXXXXXXXXXXXXXXEIYGPESS
RECA_ACIF2      MDEQRSKALSAALSQIDKQFGKGAVMRLGDHNAIKDIEVYSTXXXXXXXXXXXXXXXXXXXXEIYGPESS
RECA_HELPY      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_HELPG      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_STRTR      --DERWKALDDALKNIGKDFGKGAVMRLGERAEE-KVQVMSSGSLALDIALGAGGYPKGRIIEIYGPESS
RECA_PHOPR      MDDNKQKALAAALGQIEKQFGKGSIMRLGDN-KTMDIETVSTXXXXXXXXXXXXXXPMGRIVEIYGPESS
RECA_OENOB      MASGRKAALDAALKKIEKDFGKGSIMRLGENVHT-QVDVISTGSLKLDIALGVGGYPKGRIIEVFGPESS
RECA_BORHE      ----REKAIELARVQIEKDFGKGSLIKMGESPVXXXXXXXXXXXXLLDEAIGVGGYPRGRIIEIFGPESS
RECA_BORHD      ----REKAIELARVQIEKDFGKGSLIKMGESPVXXXXXXXXXXXXLLDEAIGVGGYPRGRIIEIFGPESS
RECA_PSYWF      --------------QIEKQFGKNTIMHLGDNSATLDVDVVSTXXXXXXXXXXXXXXPKGRIIEIYGPESS
RECA_METFL      MDENRSKALAAALSQIEKQFGKGSIMRMGDTDVAADIQAVSTXXXXXXXXXXXXXXPRGRIVEIYGPESS
RECA_HELP2      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_RICM5      -NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTXXXXXXXXXXXXXXPKGRIIEIFGPESS
RECA_HELPS      IDEDKQKAISLAIKQIDKIFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_BORBZ      ----KEEAIELARVQIEKAFGKGSLIKMGESPVGQGIKSMSSGSIVLDEALGIGGYPRGRIIEIFGPESS
RECA_BORBU      ----KEEAIELARVQIEKAFGKGSLIKMGESPVGQGIKSMSSGSIVLDEALGIGGYPRGRIIEIFGPESS
RECA_HELAH      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECA_DESVM      --EMRREALSTALSTIERKYGQGSVMKLSDTAH-VNIPVIPTGSIGLDLALGVGGIPRGRVSEIYGPESS
RECA_PSEU2      --------------QIERQFGKGAVMRMGD--HDRQIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESS
RECA_HELPJ      IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGRIIEIYGPESS
RECAM_DICDI     --------------ELEKSFGKGTLMKLGSQFSTQKVEVIPSGSMGLDIALGVGGLPKGRVTEIFGPESS
RECA_THIFE      MDEQRSKGLSAALSQIDKQFGKGAVMRLG<