[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55591.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
   13::87      6e-07  36%  323 aa  RODZ_SERP5 RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  368 aa  RODZ_YERPY RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  362 aa  RODZ_YERPS RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  345 aa  RODZ_YERPP RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  345 aa  RODZ_YERPN RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  345 aa  RODZ_YERPG RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  345 aa  RODZ_YERPE RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  362 aa  RODZ_YERPB RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  345 aa  RODZ_YERPA RecName: Full=Cytoskeleton protein rodZ;
   14::79      3e-05  36%  363 aa  RODZ_YERP3 RecName: Full=Cytoskeleton protein rodZ;
   14::87      4e-05  34%  338 aa  RODZ_YERE8 RecName: Full=Cytoskeleton protein rodZ;
   16::87      6e-05  33%  340 aa  RODZ_ERWT9 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHISS RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHIFL RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHIF8 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHIDS RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHIBS RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_SHIB3 RecName: Full=Cytoskeleton protein rodZ;
   14::87      7e-05  32%  331 aa  RODZ_KLEP7 RecName: Full=Cytoskeleton protein rodZ;
   14::87      7e-05  32%  330 aa  RODZ_KLEP3 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  338 aa  RODZ_ESCF3 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECOUT RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  336 aa  RODZ_ECOSM RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOSE RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOLU RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOLI RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOLC RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECOL6 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECOL5 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECOK1 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOHS RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECODH RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECOBW RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECO8A RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECO81 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  336 aa  RODZ_ECO7I RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECO5E RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECO57 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECO55 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECO45 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  335 aa  RODZ_ECO27 RecName: Full=Cytoskeleton protein rodZ;
   13::79      7e-05  34%  337 aa  RODZ_ECO24 RecName: Full=Cytoskeleton protein rodZ;
   14::87      1e-04  34%  338 aa  RODZ_ENTS8 RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALTY RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  324 aa  RODZ_SALTI RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALSV RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALPK RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALPC RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALPB RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALPA RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  336 aa  RODZ_SALNS RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALHS RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALG2 RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALEP RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALDC RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALCH RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  321 aa  RODZ_SALAR RecName: Full=Cytoskeleton protein rodZ;
   14::79      2e-04  35%  334 aa  RODZ_SALA4 RecName: Full=Cytoskeleton protein rodZ;
   13::82      3e-04  31%  336 aa  RODZ_ENT38 RecName: Full=Cytoskeleton protein rodZ;
   16::79      3e-04  34%  337 aa  RODZ_CITK8 RecName: Full=Cytoskeleton protein rodZ;
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTFGTILREARERKGYDLATAARRLRIRPDILRAIEEDDFSRMPPRGYARNMVNAYARLVGLNPTEMTRM
RODZ_SERP5      MTTGERLRQAREQLGLSQQAVAERLCLKMSTVRDIEEDNLSADLASTFVRGYIRSYAKLVRLPEDELLPM
RODZ_YERPY      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPS      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPP      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPN      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPG      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPE      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPB      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERPA      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERP3      -TPGVRLRQARESLGLTQQTVAERLCLKVSTIRDIEEDNAQANLASTFHRGYIRSYAKLVHLPEDEL---
RODZ_YERE8      -TTGVRLRQAREALGLTQQMVAERLCLKVSTIRDIEEDKAQANLASTFHRGYIRSYAKLVHLPEDELLPM
RODZ_ERWT9      ---GERLRTAREQMGLTQQNVAERLCLKLSTIRDIEEDNSPASLASTFLRGYIRSYARLVHVPEEELLPM
RODZ_SHISS      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_SHIFL      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_SHIF8      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_SHIDS      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_SHIBS      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_SHIB3      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_KLEP7      -TTGARLRHAREQLGLSQQAVAERLCLKVSTVRDIEDDKAPADLASTFLRGYIRSYARLVHIPEDELLPM
RODZ_KLEP3      -TTGARLRHAREQLGLSQQAVAERLCLKVSTVRDIEDDKAPADLASTFLRGYIRSYARLVHIPEEELLPM
RODZ_ESCF3      LTTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOUT      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOSM      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOSE      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOLU      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOLI      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOLC      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOL6      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOL5      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOK1      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOHS      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECODH      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECOBW      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO8A      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO81      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO7I      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO5E      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO57      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO55      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO45      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO27      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ECO24      LTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---
RODZ_ENTS8      -TTGERLRLAREQLGLSQQVVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHVPEEELLPM
RODZ_SALTY      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALTI      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALSV      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALPK      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALPC      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALPB      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALPA      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALNS      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALHS      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALG2      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALEP      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALDC      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALCH      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALAR      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_SALA4      -TTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPSDLASTFLRGYIRSYARLVHVPEEEL---
RODZ_ENT38      LSTGVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYAKLVHIPEEELLPM
RODZ_CITK8      ---GVRLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEEL---


                         .         .         *         .         .         .         .:140
query           YLDEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODZ_SERP5      LAKQA-----------------------------------------------------------------
RODZ_YERPY      ----------------------------------------------------------------------
RODZ_YERPS      ----------------------------------------------------------------------
RODZ_YERPP      ----------------------------------------------------------------------
RODZ_YERPN      ----------------------------------------------------------------------
RODZ_YERPG      ----------------------------------------------------------------------
RODZ_YERPE      ----------------------------------------------------------------------
RODZ_YERPB      ----------------------------------------------------------------------
RODZ_YERPA      ----------------------------------------------------------------------
RODZ_YERP3      ----------------------------------------------------------------------
RODZ_YERE8      LAKQA-----------------------------------------------------------------
RODZ_ERWT9      MAKQA-----------------------------------------------------------------
RODZ_SHISS      ----------------------------------------------------------------------
RODZ_SHIFL      ----------------------------------------------------------------------
RODZ_SHIF8      ----------------------------------------------------------------------
RODZ_SHIDS      ----------------------------------------------------------------------
RODZ_SHIBS      ----------------------------------------------------------------------
RODZ_SHIB3      ----------------------------------------------------------------------
RODZ_KLEP7      MAKQA-----------------------------------------------------------------
RODZ_KLEP3      MAKQA-----------------------------------------------------------------
RODZ_ESCF3      ----------------------------------------------------------------------
RODZ_ECOUT      ----------------------------------------------------------------------
RODZ_ECOSM      ----------------------------------------------------------------------
RODZ_ECOSE      ----------------------------------------------------------------------
RODZ_ECOLU      ----------------------------------------------------------------------
RODZ_ECOLI      ----------------------------------------------------------------------
RODZ_ECOLC      ----------------------------------------------------------------------
RODZ_ECOL6      ----------------------------------------------------------------------
RODZ_ECOL5      ----------------------------------------------------------------------
RODZ_ECOK1      ----------------------------------------------------------------------
RODZ_ECOHS      ----------------------------------------------------------------------
RODZ_ECODH      ----------------------------------------------------------------------
RODZ_ECOBW      ----------------------------------------------------------------------
RODZ_ECO8A      ----------------------------------------------------------------------
RODZ_ECO81      ----------------------------------------------------------------------
RODZ_ECO7I      ----------------------------------------------------------------------
RODZ_ECO5E      ----------------------------------------------------------------------
RODZ_ECO57      ----------------------------------------------------------------------
RODZ_ECO55      ----------------------------------------------------------------------
RODZ_ECO45      ----------------------------------------------------------------------
RODZ_ECO27      ----------------------------------------------------------------------
RODZ_ECO24      ----------------------------------------------------------------------
RODZ_ENTS8      LAKQA-----------------------------------------------------------------
RODZ_SALTY      ----------------------------------------------------------------------
RODZ_SALTI      ----------------------------------------------------------------------
RODZ_SALSV      ----------------------------------------------------------------------
RODZ_SALPK      ----------------------------------------------------------------------
RODZ_SALPC      ----------------------------------------------------------------------
RODZ_SALPB      ----------------------------------------------------------------------
RODZ_SALPA      ----------------------------------------------------------------------
RODZ_SALNS      ----------------------------------------------------------------------
RODZ_SALHS      ----------------------------------------------------------------------
RODZ_SALG2      ----------------------------------------------------------------------
RODZ_SALEP      ----------------------------------------------------------------------
RODZ_SALDC      ----------------------------------------------------------------------
RODZ_SALCH      ----------------------------------------------------------------------
RODZ_SALAR      ----------------------------------------------------------------------
RODZ_SALA4      ----------------------------------------------------------------------
RODZ_ENT38      ----------------------------------------------------------------------
RODZ_CITK8      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODZ_SERP5      ----------------------------------------------------------------------
RODZ_YERPY      ----------------------------------------------------------------------
RODZ_YERPS      ----------------------------------------------------------------------
RODZ_YERPP      ----------------------------------------------------------------------
RODZ_YERPN      ----------------------------------------------------------------------
RODZ_YERPG      ----------------------------------------------------------------------
RODZ_YERPE      ----------------------------------------------------------------------
RODZ_YERPB      ----------------------------------------------------------------------
RODZ_YERPA      ----------------------------------------------------------------------
RODZ_YERP3      ----------------------------------------------------------------------
RODZ_YERE8      ----------------------------------------------------------------------
RODZ_ERWT9      ----------------------------------------------------------------------
RODZ_SHISS      ----------------------------------------------------------------------
RODZ_SHIFL      ----------------------------------------------------------------------
RODZ_SHIF8      ----------------------------------------------------------------------
RODZ_SHIDS      ----------------------------------------------------------------------
RODZ_SHIBS      ----------------------------------------------------------------------
RODZ_SHIB3      ----------------------------------------------------------------------
RODZ_KLEP7      ----------------------------------------------------------------------
RODZ_KLEP3      ----------------------------------------------------------------------
RODZ_ESCF3      ----------------------------------------------------------------------
RODZ_ECOUT      ----------------------------------------------------------------------
RODZ_ECOSM      ----------------------------------------------------------------------
RODZ_ECOSE      ----------------------------------------------------------------------
RODZ_ECOLU      ----------------------------------------------------------------------
RODZ_ECOLI      ----------------------------------------------------------------------
RODZ_ECOLC      ----------------------------------------------------------------------
RODZ_ECOL6      ----------------------------------------------------------------------
RODZ_ECOL5      ----------------------------------------------------------------------
RODZ_ECOK1      ----------------------------------------------------------------------
RODZ_ECOHS      ----------------------------------------------------------------------
RODZ_ECODH      ----------------------------------------------------------------------
RODZ_ECOBW      ----------------------------------------------------------------------
RODZ_ECO8A      ----------------------------------------------------------------------
RODZ_ECO81      ----------------------------------------------------------------------
RODZ_ECO7I      ----------------------------------------------------------------------
RODZ_ECO5E      ----------------------------------------------------------------------
RODZ_ECO57      ----------------------------------------------------------------------
RODZ_ECO55      ----------------------------------------------------------------------
RODZ_ECO45      ----------------------------------------------------------------------
RODZ_ECO27      ----------------------------------------------------------------------
RODZ_ECO24      ----------------------------------------------------------------------
RODZ_ENTS8      ----------------------------------------------------------------------
RODZ_SALTY      ----------------------------------------------------------------------
RODZ_SALTI      ----------------------------------------------------------------------
RODZ_SALSV      ----------------------------------------------------------------------
RODZ_SALPK      ----------------------------------------------------------------------
RODZ_SALPC      ----------------------------------------------------------------------
RODZ_SALPB      ----------------------------------------------------------------------
RODZ_SALPA      ----------------------------------------------------------------------
RODZ_SALNS      ----------------------------------------------------------------------
RODZ_SALHS      ----------------------------------------------------------------------
RODZ_SALG2      ----------------------------------------------------------------------
RODZ_SALEP      ----------------------------------------------------------------------
RODZ_SALDC      ----------------------------------------------------------------------
RODZ_SALCH      ----------------------------------------------------------------------
RODZ_SALAR      ----------------------------------------------------------------------
RODZ_SALA4      ----------------------------------------------------------------------
RODZ_ENT38      ----------------------------------------------------------------------
RODZ_CITK8      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODZ_SERP5      ----------------------------------------------------------------------
RODZ_YERPY      ----------------------------------------------------------------------
RODZ_YERPS      ----------------------------------------------------------------------
RODZ_YERPP      ----------------------------------------------------------------------
RODZ_YERPN      ----------------------------------------------------------------------
RODZ_YERPG      ----------------------------------------------------------------------
RODZ_YERPE      ----------------------------------------------------------------------
RODZ_YERPB      ----------------------------------------------------------------------
RODZ_YERPA      ----------------------------------------------------------------------
RODZ_YERP3      ----------------------------------------------------------------------
RODZ_YERE8      ----------------------------------------------------------------------
RODZ_ERWT9      ----------------------------------------------------------------------
RODZ_SHISS      ----------------------------------------------------------------------
RODZ_SHIFL      ----------------------------------------------------------------------
RODZ_SHIF8      ----------------------------------------------------------------------
RODZ_SHIDS      ----------------------------------------------------------------------
RODZ_SHIBS      ----------------------------------------------------------------------
RODZ_SHIB3      ----------------------------------------------------------------------
RODZ_KLEP7      ----------------------------------------------------------------------
RODZ_KLEP3      ----------------------------------------------------------------------
RODZ_ESCF3      ----------------------------------------------------------------------
RODZ_ECOUT      ----------------------------------------------------------------------
RODZ_ECOSM      ----------------------------------------------------------------------
RODZ_ECOSE      ----------------------------------------------------------------------
RODZ_ECOLU      ----------------------------------------------------------------------
RODZ_ECOLI      ----------------------------------------------------------------------
RODZ_ECOLC      ----------------------------------------------------------------------
RODZ_ECOL6      ----------------------------------------------------------------------
RODZ_ECOL5      ----------------------------------------------------------------------
RODZ_ECOK1      ----------------------------------------------------------------------
RODZ_ECOHS      ----------------------------------------------------------------------
RODZ_ECODH      ----------------------------------------------------------------------
RODZ_ECOBW      ----------------------------------------------------------------------
RODZ_ECO8A      ----------------------------------------------------------------------
RODZ_ECO81      ----------------------------------------------------------------------
RODZ_ECO7I      ----------------------------------------------------------------------
RODZ_ECO5E      ----------------------------------------------------------------------
RODZ_ECO57      ----------------------------------------------------------------------
RODZ_ECO55      ----------------------------------------------------------------------
RODZ_ECO45      ----------------------------------------------------------------------
RODZ_ECO27      ----------------------------------------------------------------------
RODZ_ECO24      ----------------------------------------------------------------------
RODZ_ENTS8      ----------------------------------------------------------------------
RODZ_SALTY      ----------------------------------------------------------------------
RODZ_SALTI      ----------------------------------------------------------------------
RODZ_SALSV      ----------------------------------------------------------------------
RODZ_SALPK      ----------------------------------------------------------------------
RODZ_SALPC      ----------------------------------------------------------------------
RODZ_SALPB      ----------------------------------------------------------------------
RODZ_SALPA      ----------------------------------------------------------------------
RODZ_SALNS      ----------------------------------------------------------------------
RODZ_SALHS      ----------------------------------------------------------------------
RODZ_SALG2      ----------------------------------------------------------------------
RODZ_SALEP      ----------------------------------------------------------------------
RODZ_SALDC      ----------------------------------------------------------------------
RODZ_SALCH      ----------------------------------------------------------------------
RODZ_SALAR      ----------------------------------------------------------------------
RODZ_SALA4      ----------------------------------------------------------------------
RODZ_ENT38      ----------------------------------------------------------------------
RODZ_CITK8      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODZ_SERP5      ----------------------------------------------------------------------
RODZ_YERPY      ----------------------------------------------------------------------
RODZ_YERPS      ----------------------------------------------------------------------
RODZ_YERPP      ----------------------------------------------------------------------
RODZ_YERPN      ----------------------------------------------------------------------
RODZ_YERPG      ----------------------------------------------------------------------
RODZ_YERPE      ----------------------------------------------------------------------
RODZ_YERPB      ----------------------------------------------------------------------
RODZ_YERPA      ----------------------------------------------------------------------
RODZ_YERP3      ----------------------------------------------------------------------
RODZ_YERE8      ----------------------------------------------------------------------
RODZ_ERWT9      ----------------------------------------------------------------------
RODZ_SHISS      ----------------------------------------------------------------------
RODZ_SHIFL      ----------------------------------------------------------------------
RODZ_SHIF8      ----------------------------------------------------------------------
RODZ_SHIDS      ----------------------------------------------------------------------
RODZ_SHIBS      ----------------------------------------------------------------------
RODZ_SHIB3      ----------------------------------------------------------------------
RODZ_KLEP7      ----------------------------------------------------------------------
RODZ_KLEP3      ----------------------------------------------------------------------
RODZ_ESCF3      ----------------------------------------------------------------------
RODZ_ECOUT      ----------------------------------------------------------------------
RODZ_ECOSM      ----------------------------------------------------------------------
RODZ_ECOSE      ----------------------------------------------------------------------
RODZ_ECOLU      ----------------------------------------------------------------------
RODZ_ECOLI      ----------------------------------------------------------------------
RODZ_ECOLC      ----------------------------------------------------------------------
RODZ_ECOL6      ----------------------------------------------------------------------
RODZ_ECOL5      ----------------------------------------------------------------------
RODZ_ECOK1      ----------------------------------------------------------------------
RODZ_ECOHS      ----------------------------------------------------------------------
RODZ_ECODH      ----------------------------------------------------------------------
RODZ_ECOBW      ----------------------------------------------------------------------
RODZ_ECO8A      ----------------------------------------------------------------------
RODZ_ECO81      ----------------------------------------------------------------------
RODZ_ECO7I      ----------------------------------------------------------------------
RODZ_ECO5E      ----------------------------------------------------------------------
RODZ_ECO57      ----------------------------------------------------------------------
RODZ_ECO55      ----------------------------------------------------------------------
RODZ_ECO45      ----------------------------------------------------------------------
RODZ_ECO27      ----------------------------------------------------------------------
RODZ_ECO24      ----------------------------------------------------------------------
RODZ_ENTS8      ----------------------------------------------------------------------
RODZ_SALTY      ----------------------------------------------------------------------
RODZ_SALTI      ----------------------------------------------------------------------
RODZ_SALSV      ----------------------------------------------------------------------
RODZ_SALPK      ----------------------------------------------------------------------
RODZ_SALPC      ----------------------------------------------------------------------
RODZ_SALPB      ----------------------------------------------------------------------
RODZ_SALPA      ----------------------------------------------------------------------
RODZ_SALNS      ----------------------------------------------------------------------
RODZ_SALHS      ----------------------------------------------------------------------
RODZ_SALG2      ----------------------------------------------------------------------
RODZ_SALEP      ----------------------------------------------------------------------
RODZ_SALDC      ----------------------------------------------------------------------
RODZ_SALCH      ----------------------------------------------------------------------
RODZ_SALAR      ----------------------------------------------------------------------
RODZ_SALA4      ----------------------------------------------------------------------
RODZ_ENT38      ----------------------------------------------------------------------
RODZ_CITK8      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODZ_SERP5      ----------------------------
RODZ_YERPY      ----------------------------
RODZ_YERPS      ----------------------------
RODZ_YERPP      ----------------------------
RODZ_YERPN      ----------------------------
RODZ_YERPG      ----------------------------
RODZ_YERPE      ----------------------------
RODZ_YERPB      ----------------------------
RODZ_YERPA      ----------------------------
RODZ_YERP3      ----------------------------
RODZ_YERE8      ----------------------------
RODZ_ERWT9      ----------------------------
RODZ_SHISS      ----------------------------
RODZ_SHIFL      ----------------------------
RODZ_SHIF8      ----------------------------
RODZ_SHIDS      ----------------------------
RODZ_SHIBS      ----------------------------
RODZ_SHIB3      ----------------------------
RODZ_KLEP7      ----------------------------
RODZ_KLEP3      ----------------------------
RODZ_ESCF3      ----------------------------
RODZ_ECOUT      ----------------------------
RODZ_ECOSM      ----------------------------
RODZ_ECOSE      ----------------------------
RODZ_ECOLU      ----------------------------
RODZ_ECOLI      ----------------------------
RODZ_ECOLC      ----------------------------
RODZ_ECOL6      ----------------------------
RODZ_ECOL5      ----------------------------
RODZ_ECOK1      ----------------------------
RODZ_ECOHS      ----------------------------
RODZ_ECODH      ----------------------------
RODZ_ECOBW      ----------------------------
RODZ_ECO8A      ----------------------------
RODZ_ECO81      ----------------------------
RODZ_ECO7I      ----------------------------
RODZ_ECO5E      ----------------------------
RODZ_ECO57      ----------------------------
RODZ_ECO55      ----------------------------
RODZ_ECO45      ----------------------------
RODZ_ECO27      ----------------------------
RODZ_ECO24      ----------------------------
RODZ_ENTS8      ----------------------------
RODZ_SALTY      ----------------------------
RODZ_SALTI      ----------------------------
RODZ_SALSV      ----------------------------
RODZ_SALPK      ----------------------------
RODZ_SALPC      ----------------------------
RODZ_SALPB      ----------------------------
RODZ_SALPA      ----------------------------
RODZ_SALNS      ----------------------------
RODZ_SALHS      ----------------------------
RODZ_SALG2      ----------------------------
RODZ_SALEP      ----------------------------
RODZ_SALDC      ----------------------------
RODZ_SALCH      ----------------------------
RODZ_SALAR      ----------------------------
RODZ_SALA4      ----------------------------
RODZ_ENT38      ----------------------------
RODZ_CITK8      ----------------------------