[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55872.1

[Show Plain Result]


## Summary of Sequence Search
    1::183
  134::182     2e-05  37%  190 aa  Y416_METJA RecName: Full=Uncharacterized protein MJ0416;
  298::338     5e-04  46%  421 aa  PDLI7_XENLA RecName: Full=PDZ and LIM domain protein 7;
  708::761     9e-04  26%  790 aa  WDR24_MOUSE RecName: Full=WD repeat-containing protein 24;
  838::891     9e-04  26%  920 aa  WDR24_HUMAN RecName: Full=WD repeat-containing protein 24;
    1::183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y416_METJA      ----------------------------------------------------------------------
PDLI7_XENLA     ----------------------------------------------------------------------
WDR24_MOUSE     ----------------------------------------------------------------------
WDR24_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxLKQRELMKYGECANCGYPVEADFVLCPNCHQRLKNLCGTCNHALDPTWTVCPYCATP
Y416_METJA      ------------------------CPNCNNYISDSWKYCAHCGAKLKERCPNCKRPVQPEWIVCPYC---
PDLI7_XENLA     ----------------------------------DARFAPNCAKCKKKITGEIMHALKMTWHVCAYCKTP
WDR24_MOUSE     -------------LNQASTTLHVNCSHCKRPMSSRGWVCDRCH-RCASMCAVCHHVVKGLFVWCQGCS--
WDR24_HUMAN     -------------LNQASTTLHVNCSHCKRPMSSRGWVCDRCH-RCASMCAVCHHVVKGLFVWCQGCS--


                         +         .         .         .         .         *         .:210
query           Vxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y416_METJA      -------------------------------------------
PDLI7_XENLA     I------------------------------------------
WDR24_MOUSE     -------------------------------------------
WDR24_HUMAN     -------------------------------------------