[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55893.1

[Show Plain Result]


## Summary of Sequence Search
    1::501
    1::363     4e-41  30%  434 aa  TIG_BACSK RecName: Full=Trigger factor;         Short=TF;
    4::429     3e-39  26%  438 aa  TIG_SYNWW RecName: Full=Trigger factor;         Short=TF;
    4::363     3e-39  29%  427 aa  TIG_BACCN RecName: Full=Trigger factor;         Short=TF;
    1::425     5e-39  28%  471 aa  TIG_NOCSJ RecName: Full=Trigger factor;         Short=TF;
    1::355     5e-39  35%  429 aa  TIG_LYSSC RecName: Full=Trigger factor;         Short=TF;
    6::363     3e-38  30%  433 aa  TIG_STAAR RecName: Full=Trigger factor;         Short=TF;
    6::363     3e-38  30%  433 aa  TIG_STAAE RecName: Full=Trigger factor;         Short=TF;
    6::363     3e-38  30%  433 aa  TIG_STAAB RecName: Full=Trigger factor;         Short=TF;
    6::428     4e-38  28%  436 aa  TIG_STAS1 RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAW RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAT RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAS RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAN RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAM RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAAC RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAA9 RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAA8 RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAA3 RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAA2 RecName: Full=Trigger factor;         Short=TF;
    6::363     4e-38  30%  433 aa  TIG_STAA1 RecName: Full=Trigger factor;         Short=TF;
    1::420     4e-38  27%  429 aa  TIG_HALOH RecName: Full=Trigger factor;         Short=TF;
    6::428     1e-37  28%  433 aa  TIG_STAES RecName: Full=Trigger factor;         Short=TF;
    6::428     1e-37  28%  433 aa  TIG_STAEQ RecName: Full=Trigger factor;         Short=TF;
    6::367     1e-37  30%  440 aa  TIG_STACT RecName: Full=Trigger factor;         Short=TF;
    6::364     6e-37  28%  430 aa  TIG_BREBN RecName: Full=Trigger factor;         Short=TF;
    1::361     7e-37  28%  526 aa  TIG_CORJK RecName: Full=Trigger factor;         Short=TF;
    6::367     1e-36  29%  434 aa  TIG_STAHJ RecName: Full=Trigger factor;         Short=TF;
    1::361     1e-36  26%  469 aa  TIG_MYCS2 RecName: Full=Trigger factor;         Short=TF;
    1::426     3e-36  27%  426 aa  TIG1_DESHY RecName: Full=Trigger factor 1;         Short=TF 1;
    1::361     4e-36  26%  478 aa  TIG_MYCSS RecName: Full=Trigger factor;         Short=TF;
    1::361     4e-36  26%  478 aa  TIG_MYCSK RecName: Full=Trigger factor;         Short=TF;
    1::361     5e-36  26%  482 aa  TIG_MYCSJ RecName: Full=Trigger factor;         Short=TF;
    1::431     1e-35  29%  431 aa  TIG_CLOAB RecName: Full=Trigger factor;         Short=TF;
    1::361     2e-35  27%  479 aa  TIG_MYCGI RecName: Full=Trigger factor;         Short=TF;
    1::367     2e-35  29%  446 aa  TIG_MOOTA RecName: Full=Trigger factor;         Short=TF;
    1::368     2e-35  28%  428 aa  TIG_GEOSW RecName: Full=Trigger factor;         Short=TF;
    1::368     2e-35  30%  424 aa  TIG_BACLD RecName: Full=Trigger factor;         Short=TF;
    4::363     2e-35  28%  425 aa  TIG_BACCQ RecName: Full=Trigger factor;         Short=TF;
    4::363     2e-35  28%  425 aa  TIG_BACC7 RecName: Full=Trigger factor;         Short=TF;
    3::367     3e-35  27%  465 aa  TIG_NOCFA RecName: Full=Trigger factor;         Short=TF;
    4::363     4e-35  28%  425 aa  TIG_BACC1 RecName: Full=Trigger factor;         Short=TF;
    9::363     4e-35  27%  428 aa  TIG_ALKMQ RecName: Full=Trigger factor;         Short=TF;
    1::361     5e-35  28%  457 aa  TIG_RHOE4 RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACHK RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACCZ RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACC3 RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACC0 RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACAN RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACAH RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACAC RecName: Full=Trigger factor;         Short=TF;
    4::363     5e-35  28%  425 aa  TIG_BACAA RecName: Full=Trigger factor;         Short=TF;
    1::430     7e-35  25%  438 aa  TIG_PELTS RecName: Full=Trigger factor;         Short=TF;
    6::364     7e-35  27%  446 aa  TIG_NATTJ RecName: Full=Trigger factor;         Short=TF;
    6::372     9e-35  28%  427 aa  TIG_STRP7 RecName: Full=Trigger factor;         Short=TF;
    1::430     9e-35  26%  435 aa  TIG_DESRM RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-34  28%  427 aa  TIG_STRR6 RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-34  28%  427 aa  TIG_STRP2 RecName: Full=Trigger factor;         Short=TF;
    4::363     2e-34  32%  428 aa  TIG_ALKOO RecName: Full=Trigger factor;         Short=TF;
    4::364     2e-34  29%  428 aa  TIG_CLOPH RecName: Full=Trigger factor;         Short=TF;
    1::363     3e-34  28%  425 aa  TIG_BACWK RecName: Full=Trigger factor;         Short=TF;
    1::361     3e-34  26%  473 aa  TIG_MYCVP RecName: Full=Trigger factor;         Short=TF;
    4::367     3e-34  26%  430 aa  TIG_EXISA RecName: Full=Trigger factor;         Short=TF;
    1::368     5e-34  28%  427 aa  TIG_MACCJ RecName: Full=Trigger factor;         Short=TF;
    4::367     5e-34  29%  431 aa  TIG_BACHD RecName: Full=Trigger factor;         Short=TF;
    1::368     6e-34  28%  428 aa  TIG_GEOKA RecName: Full=Trigger factor;         Short=TF;
    1::361     6e-34  26%  451 aa  TIG_CORA7 RecName: Full=Trigger factor;         Short=TF;
    1::425     1e-33  26%  464 aa  TIG_MYCPA RecName: Full=Trigger factor;         Short=TF;
    1::425     1e-33  26%  464 aa  TIG_MYCA1 RecName: Full=Trigger factor;         Short=TF;
    1::368     1e-33  29%  424 aa  TIG_BACA2 RecName: Full=Trigger factor;         Short=TF;
    1::364     1e-33  25%  490 aa  TIG_MYCA9 RecName: Full=Trigger factor;         Short=TF;
   28::430     4e-33  27%  438 aa  TIG_ANATD RecName: Full=Trigger factor;         Short=TF;
    1::354     5e-33  25%  484 aa  TIG_MYCMM RecName: Full=Trigger factor;         Short=TF;
    1::429     5e-33  25%  435 aa  TIG_GEOSF RecName: Full=Trigger factor;         Short=TF;
   12::428     7e-33  27%  436 aa  TIG_LACS1 RecName: Full=Trigger factor;         Short=TF;
    5::367     7e-33  27%  431 aa  TIG_GEOSL RecName: Full=Trigger factor;         Short=TF;
    9::365     9e-33  26%  440 aa  TIG_FINM2 RecName: Full=Trigger factor;         Short=TF;
    1::362     9e-33  28%  427 aa  TIG_CLOB8 RecName: Full=Trigger factor;         Short=TF;
    1::367     9e-33  29%  424 aa  TIG_BACP2 RecName: Full=Trigger factor;         Short=TF;
    1::367     2e-32  28%  427 aa  TIG_CLOBB RecName: Full=Trigger factor;         Short=TF;
    1::368     4e-32  27%  428 aa  TIG_GEOTN RecName: Full=Trigger factor;         Short=TF;
    1::354     7e-32  25%  484 aa  TIG_MYCUA RecName: Full=Trigger factor;         Short=TF;
    1::362     7e-32  25%  428 aa  TIG_CLOPS RecName: Full=Trigger factor;         Short=TF;
    1::427     9e-32  24%  466 aa  TIG_MYCBT RecName: Full=Trigger factor;         Short=TF;
    1::427     9e-32  24%  466 aa  TIG_MYCBP RecName: Full=Trigger factor;         Short=TF;
    1::427     9e-32  24%  466 aa  TIG_MYCBO RecName: Full=Trigger factor;         Short=TF;
    6::352     1e-31  28%  429 aa  TIG_SYMTH RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRZT RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRZP RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRZJ RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRPS RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRPJ RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRPI RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-31  27%  427 aa  TIG_STRP4 RecName: Full=Trigger factor;         Short=TF;
    6::371     1e-31  27%  427 aa  TIG_CARHZ RecName: Full=Trigger factor;         Short=TF;
    6::372     2e-31  27%  427 aa  TIG_STRPN RecName: Full=Trigger factor;         Short=TF;
    1::423     2e-31  24%  443 aa  TIG_EUBR3 RecName: Full=Trigger factor;         Short=TF;
    1::353     2e-31  28%  432 aa  TIG_CLONN RecName: Full=Trigger factor;         Short=TF;
    1::428     3e-31  24%  432 aa  TIG_DESVM RecName: Full=Trigger factor;         Short=TF;
    1::368     3e-31  29%  424 aa  TIG_BACSU RecName: Full=Trigger factor;         Short=TF;AltName:
    1::427     4e-31  24%  466 aa  TIG_MYCTU RecName: Full=Trigger factor;         Short=TF;
    1::427     4e-31  24%  466 aa  TIG_MYCTA RecName: Full=Trigger factor;         Short=TF;
    1::363     4e-31  24%  438 aa  TIG_DESAP RecName: Full=Trigger factor;         Short=TF;
    4::365     5e-31  28%  428 aa  TIG_OCEIH RecName: Full=Trigger factor;         Short=TF;
    1::361     8e-31  27%  448 aa  TIG_CORDI RecName: Full=Trigger factor;         Short=TF;
    1::424     1e-30  25%  427 aa  TIG_STRS7 RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-30  25%  427 aa  TIG_STRGC RecName: Full=Trigger factor;         Short=TF;
    1::358     2e-30  27%  449 aa  TIG_CORGL RecName: Full=Trigger factor;         Short=TF;
    1::358     2e-30  27%  449 aa  TIG_CORGB RecName: Full=Trigger factor;         Short=TF;
    1::361     2e-30  25%  454 aa  TIG_COREF RecName: Full=Trigger factor;         Short=TF;
    1::349     2e-30  30%  459 aa  TIG_BIFLO RecName: Full=Trigger factor;         Short=TF;
    1::349     2e-30  30%  459 aa  TIG_BIFLD RecName: Full=Trigger factor;         Short=TF;
    1::361     3e-30  26%  464 aa  TIG_RHOSR RecName: Full=Trigger factor;         Short=TF;
    1::410     3e-30  25%  466 aa  TIG_LEIXX RecName: Full=Trigger factor;         Short=TF;
    1::402     3e-30  28%  459 aa  TIG_BIFLI RecName: Full=Trigger factor;         Short=TF;
    1::365     5e-30  26%  428 aa  TIG_ANOFW RecName: Full=Trigger factor;         Short=TF;
    1::424     9e-30  24%  427 aa  TIG_STREM RecName: Full=Trigger factor;         Short=TF;
    1::360     9e-30  25%  431 aa  TIG_CLOTE RecName: Full=Trigger factor;         Short=TF;
    1::363     9e-30  27%  437 aa  TIG_BDEBA RecName: Full=Trigger factor;         Short=TF;
    1::361     1e-29  26%  464 aa  TIG_RHOOB RecName: Full=Trigger factor;         Short=TF;
    1::361     1e-29  27%  439 aa  TIG_PELCD RecName: Full=Trigger factor;         Short=TF;
    1::359     2e-29  30%  471 aa  TIG_STRGG RecName: Full=Trigger factor;         Short=TF;
    1::361     2e-29  26%  448 aa  TIG_SALAI RecName: Full=Trigger factor;         Short=TF;
    1::429     2e-29  27%  435 aa  TIG_GEOSM RecName: Full=Trigger factor;         Short=TF;
    1::363     2e-29  26%  425 aa  TIG_BACCR RecName: Full=Trigger factor;         Short=TF;
    1::363     2e-29  26%  425 aa  TIG_BACC4 RecName: Full=Trigger factor;         Short=TF;
    1::363     2e-29  26%  425 aa  TIG_BACC2 RecName: Full=Trigger factor;         Short=TF;
    6::425     2e-29  25%  483 aa  TIG_FRASC RecName: Full=Trigger factor;         Short=TF;
    1::424     3e-29  24%  427 aa  TIG_STRE4 RecName: Full=Trigger factor;         Short=TF;
    1::362     3e-29  27%  427 aa  TIG_CLOBA RecName: Full=Trigger factor;         Short=TF;
    1::426     6e-29  30%  438 aa  TIG_CALS8 RecName: Full=Trigger factor;         Short=TF;
   24::401     7e-29  25%  456 aa  TIG_STRPC RecName: Full=Trigger factor;         Short=TF;
   17::367     7e-29  25%  430 aa  TIG_CLOBL RecName: Full=Trigger factor;         Short=TF;
   17::367     7e-29  25%  430 aa  TIG_CLOBK RecName: Full=Trigger factor;         Short=TF;
   17::367     7e-29  25%  430 aa  TIG_CLOBH RecName: Full=Trigger factor;         Short=TF;
   17::367     7e-29  25%  430 aa  TIG_CLOB6 RecName: Full=Trigger factor;         Short=TF;
   17::367     7e-29  25%  430 aa  TIG_CLOB1 RecName: Full=Trigger factor;         Short=TF;
    4::365     1e-28  27%  429 aa  TIG_FUSNN RecName: Full=Trigger factor;         Short=TF;
    6::359     1e-28  25%  493 aa  TIG_FRAAA RecName: Full=Trigger factor;         Short=TF;
    4::366     1e-28  28%  440 aa  TIG_LACPL RecName: Full=Trigger factor;         Short=TF;
    1::349     2e-28  27%  425 aa  TIG_MYXXD RecName: Full=Trigger factor;         Short=TF;
   17::367     2e-28  25%  430 aa  TIG_CLOBM RecName: Full=Trigger factor;         Short=TF;
    1::424     2e-28  25%  467 aa  TIG_SACEN RecName: Full=Trigger factor;         Short=TF;
    1::417     2e-28  31%  448 aa  TIG_KOCRD RecName: Full=Trigger factor;         Short=TF;
    4::367     2e-28  25%  428 aa  TIG_CLOTH RecName: Full=Trigger factor;         Short=TF;
   17::367     2e-28  25%  430 aa  TIG_CLOBJ RecName: Full=Trigger factor;         Short=TF;
    1::360     3e-28  24%  438 aa  TIG_DESAA RecName: Full=Trigger factor;         Short=TF;
    1::362     3e-28  24%  428 aa  TIG_CLOPE RecName: Full=Trigger factor;         Short=TF;
    1::362     3e-28  24%  428 aa  TIG_CLOP1 RecName: Full=Trigger factor;         Short=TF;
    5::427     3e-28  24%  434 aa  TIG2_DESHY RecName: Full=Trigger factor 2;         Short=TF 2;
    1::367     4e-28  26%  427 aa  TIG_LISIN RecName: Full=Trigger factor;         Short=TF;
   24::455     5e-28  24%  456 aa  TIG_STRPD RecName: Full=Trigger factor;         Short=TF;
   24::401     6e-28  25%  456 aa  TIG_STRPM RecName: Full=Trigger factor;         Short=TF;
   24::401     6e-28  25%  456 aa  TIG_STRPF RecName: Full=Trigger factor;         Short=TF;
    1::367     6e-28  25%  438 aa  TIG_DESDG RecName: Full=Trigger factor;         Short=TF;
    1::372     8e-28  26%  427 aa  TIG_STRPZ RecName: Full=Trigger factor;         Short=TF;
    1::372     8e-28  26%  427 aa  TIG_STRPG RecName: Full=Trigger factor;         Short=TF;
    1::372     8e-28  26%  427 aa  TIG_STRP8 RecName: Full=Trigger factor;         Short=TF;
    1::372     8e-28  26%  427 aa  TIG_STRP6 RecName: Full=Trigger factor;         Short=TF;
    1::372     8e-28  26%  427 aa  TIG_STRP3 RecName: Full=Trigger factor;         Short=TF;
    1::367     8e-28  26%  427 aa  TIG_LISMH RecName: Full=Trigger factor;         Short=TF;
    8::361     8e-28  29%  448 aa  TIG_DEHE1 RecName: Full=Trigger factor;         Short=TF;
    4::366     1e-27  26%  435 aa  TIG_PEDPA RecName: Full=Trigger factor;         Short=TF;
    1::367     1e-27  26%  427 aa  TIG_LISMO RecName: Full=Trigger factor;         Short=TF;
    1::367     1e-27  26%  427 aa  TIG_LISMF RecName: Full=Trigger factor;         Short=TF;
    1::367     1e-27  26%  427 aa  TIG_LISMC RecName: Full=Trigger factor;         Short=TF;
    1::424     1e-27  27%  436 aa  TIG_AERHH RecName: Full=Trigger factor;         Short=TF;
    1::372     1e-27  26%  427 aa  TIG_STRP1 RecName: Full=Trigger factor;         Short=TF;
   14::363     1e-27  30%  428 aa  TIG_CLOCE RecName: Full=Trigger factor;         Short=TF;
    1::359     2e-27  26%  463 aa  TIG_STRAW RecName: Full=Trigger factor;         Short=TF;
    1::362     5e-27  26%  427 aa  TIG_STRA1 RecName: Full=Trigger factor;         Short=TF;
    1::367     5e-27  26%  427 aa  TIG_LISW6 RecName: Full=Trigger factor;         Short=TF;
    1::362     7e-27  26%  427 aa  TIG_STRA5 RecName: Full=Trigger factor;         Short=TF;
    6::372     9e-27  24%  427 aa  TIG_STRSV RecName: Full=Trigger factor;         Short=TF;
    1::401     9e-27  24%  461 aa  TIG_BIFA0 RecName: Full=Trigger factor;         Short=TF;
    3::364     2e-26  25%  530 aa  TIG_PROAC RecName: Full=Trigger factor;         Short=TF;
    8::350     2e-26  27%  438 aa  TIG_DEIDV RecName: Full=Trigger factor;         Short=TF;
    1::424     2e-26  28%  436 aa  TIG_AERS4 RecName: Full=Trigger factor;         Short=TF;
    1::372     2e-26  26%  427 aa  TIG_STRU0 RecName: Full=Trigger factor;         Short=TF;
    1::362     2e-26  26%  427 aa  TIG_STRA3 RecName: Full=Trigger factor;         Short=TF;
    1::363     3e-26  25%  435 aa  TIG_GEOBB RecName: Full=Trigger factor;         Short=TF;
    5::367     5e-26  24%  433 aa  TIG_GEOMG RecName: Full=Trigger factor;         Short=TF;
    1::369     5e-26  24%  427 aa  TIG_ENTFA RecName: Full=Trigger factor;         Short=TF;
    8::360     6e-26  26%  447 aa  TIG_DEHSB RecName: Full=Trigger factor;         Short=TF;
    1::361     8e-26  24%  495 aa  TIG_CORK4 RecName: Full=Trigger factor;         Short=TF;
    8::360     1e-25  26%  447 aa  TIG_DEHSC RecName: Full=Trigger factor;         Short=TF;
    5::428     1e-25  22%  475 aa  TIG_RUBXD RecName: Full=Trigger factor;         Short=TF;
    5::431     2e-25  22%  433 aa  TIG_GEOUR RecName: Full=Trigger factor;         Short=TF;
    1::334     2e-25  26%  468 aa  TIG_STRCO RecName: Full=Trigger factor;         Short=TF;
    1::304     2e-25  27%  456 aa  TIG_BIFAA RecName: Full=Trigger factor;         Short=TF;
    6::427     4e-25  23%  507 aa  TIG_FRASN RecName: Full=Trigger factor;         Short=TF;
    9::362     4e-25  24%  428 aa  TIG_CLOD6 RecName: Full=Trigger factor;         Short=TF;
    1::357     4e-25  25%  449 aa  TIG_ACIC1 RecName: Full=Trigger factor;         Short=TF;
    5::367     5e-25  24%  432 aa  TIG_THETN RecName: Full=Trigger factor;         Short=TF;
    1::304     5e-25  25%  469 aa  TIG_MYCLE RecName: Full=Trigger factor;         Short=TF;
    1::304     5e-25  25%  469 aa  TIG_MYCLB RecName: Full=Trigger factor;         Short=TF;
    1::342     5e-25  27%  533 aa  TIG_ERYLH RecName: Full=Trigger factor;         Short=TF;
    1::425     9e-25  24%  463 aa  TIG_THEFY RecName: Full=Trigger factor;         Short=TF;
    1::360     9e-25  28%  440 aa  TIG_GEOLS RecName: Full=Trigger factor;         Short=TF;
    1::426     1e-24  25%  427 aa  TIG_STRMU RecName: Full=Trigger factor;         Short=TF;
    1::367     1e-24  27%  430 aa  TIG_CLOK5 RecName: Full=Trigger factor;         Short=TF;
    1::367     1e-24  27%  430 aa  TIG_CLOK1 RecName: Full=Trigger factor;         Short=TF;
    1::357     1e-24  26%  441 aa  TIG_DESPS RecName: Full=Trigger factor;         Short=TF;
    2::367     2e-24  21%  430 aa  TIG_ONYPE RecName: Full=Trigger factor;         Short=TF;
    5::369     2e-24  22%  490 aa  TIG_THERP RecName: Full=Trigger factor;         Short=TF;
    1::377     2e-24  24%  447 aa  TIG_SYNS9 RecName: Full=Trigger factor;         Short=TF;
    4::366     2e-24  25%  436 aa  TIG_LACBA RecName: Full=Trigger factor;         Short=TF;
    3::358     2e-24  27%  448 aa  TIG_HERAR RecName: Full=Trigger factor;         Short=TF;
   15::363     2e-24  27%  430 aa  TIG_EXIS2 RecName: Full=Trigger factor;         Short=TF;
    1::424     2e-24  25%  448 aa  TIG_CHRSD RecName: Full=Trigger factor;         Short=TF;
    5::367     3e-24  23%  432 aa  TIG_THEPX RecName: Full=Trigger factor;         Short=TF;
    5::367     3e-24  23%  432 aa  TIG_THEP3 RecName: Full=Trigger factor;         Short=TF;
    1::229     3e-24  30%  450 aa  TIG_ALHEH RecName: Full=Trigger factor;         Short=TF;
    1::305     4e-24  29%  471 aa  TIG_KINRD RecName: Full=Trigger factor;         Short=TF;
    1::423     6e-24  26%  433 aa  TIG_VIBCM RecName: Full=Trigger factor;         Short=TF;
    1::423     6e-24  26%  433 aa  TIG_VIBCH RecName: Full=Trigger factor;         Short=TF;
    1::423     6e-24  26%  433 aa  TIG_VIBC3 RecName: Full=Trigger factor;         Short=TF;
    1::350     6e-24  27%  435 aa  TIG_SYNFM RecName: Full=Trigger factor;         Short=TF;
    1::220     6e-24  31%  444 aa  TIG_SACD2 RecName: Full=Trigger factor;         Short=TF;
    1::434     6e-24  25%  452 aa  TIG_RHOPT RecName: Full=Trigger factor;         Short=TF;
   25::428     6e-24  24%  433 aa  TIG_DESVV RecName: Full=Trigger factor;         Short=TF;
   25::381     6e-24  31%  471 aa  TIG_ANAVT RecName: Full=Trigger factor;         Short=TF;
    4::317     7e-24  23%  451 aa  TIG_TREDE RecName: Full=Trigger factor;         Short=TF;
    1::366     7e-24  25%  431 aa  TIG_LACSS RecName: Full=Trigger factor;         Short=TF;
    1::366     7e-24  24%  445 aa  TIG_LACCB RecName: Full=Trigger factor;         Short=TF;
    1::366     7e-24  24%  445 aa  TIG_LACC3 RecName: Full=Trigger factor;         Short=TF;
   15::350     9e-24  25%  436 aa  TIG_THICR RecName: Full=Trigger factor;         Short=TF;
    1::421     9e-24  25%  434 aa  TIG_PSEHT RecName: Full=Trigger factor;         Short=TF;
    1::418     9e-24  26%  434 aa  TIG_MARAV RecName: Full=Trigger factor;         Short=TF;
    5::436     9e-24  24%  449 aa  TIG_AZOC5 RecName: Full=Trigger factor;         Short=TF;
   25::381     1e-23  31%  471 aa  TIG_ANASP RecName: Full=Trigger factor;         Short=TF;
   25::428     2e-23  24%  433 aa  TIG_DESVH RecName: Full=Trigger factor;         Short=TF;
    1::428     2e-23  23%  452 aa  TIG_DESDA RecName: Full=Trigger factor;         Short=TF;
    4::309     2e-23  27%  492 aa  TIG_ZYMMO RecName: Full=Trigger factor;         Short=TF;
    1::360     2e-23  26%  437 aa  TIG_PELPD RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-23  30%  437 aa  TIG_ALCBS RecName: Full=Trigger factor;         Short=TF;
    1::438     3e-23  25%  453 aa  TIG_RHOPB RecName: Full=Trigger factor;         Short=TF;
    4::345     3e-23  29%  513 aa  TIG_NOVAD RecName: Full=Trigger factor;         Short=TF;
    1::422     4e-23  25%  436 aa  TIG_THISH RecName: Full=Trigger factor;         Short=TF;
   11::316     4e-23  27%  557 aa  TIG_SYNJA RecName: Full=Trigger factor;         Short=TF;
    1::320     5e-23  27%  432 aa  TIG_VIBSL RecName: Full=Trigger factor;         Short=TF;
    1::377     6e-23  25%  469 aa  TIG_SYNSC RecName: Full=Trigger factor;         Short=TF;
   14::374     6e-23  24%  539 aa  TIG_ROSS1 RecName: Full=Trigger factor;         Short=TF;
   11::378     8e-23  26%  556 aa  TIG_SYNJB RecName: Full=Trigger factor;         Short=TF;
    1::417     8e-23  23%  471 aa  TIG_RENSM RecName: Full=Trigger factor;         Short=TF;
    1::329     8e-23  27%  436 aa  TIG_LARHH RecName: Full=Trigger factor;         Short=TF;
    1::320     8e-23  26%  439 aa  TIG_DICNV RecName: Full=Trigger factor;         Short=TF;
    5::299     1e-22  25%  411 aa  TIG_THEYD RecName: Full=Trigger factor;         Short=TF;
    1::328     1e-22  26%  435 aa  TIG_CHRVO RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-22  24%  427 aa  TIG_STRSY RecName: Full=Trigger factor;         Short=TF;
    6::372     1e-22  24%  427 aa  TIG_STRS2 RecName: Full=Trigger factor;         Short=TF;
    3::359     1e-22  27%  449 aa  TIG_JANMA RecName: Full=Trigger factor;         Short=TF;
   18::429     1e-22  24%  443 aa  TIG_DESOH RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-22  25%  436 aa  TIG_PSEU5 RecName: Full=Trigger factor;         Short=TF;
    1::218     2e-22  28%  443 aa  TIG_NITOC RecName: Full=Trigger factor;         Short=TF;
   14::365     2e-22  24%  442 aa  TIG_LACAC RecName: Full=Trigger factor;         Short=TF;
    1::419     2e-22  24%  433 aa  TIG_IDILO RecName: Full=Trigger factor;         Short=TF;
    1::345     2e-22  27%  480 aa  TIG_CLAMS RecName: Full=Trigger factor;         Short=TF;
    1::315     2e-22  26%  470 aa  TIG_BEUC1 RecName: Full=Trigger factor;         Short=TF;
    1::422     3e-22  24%  436 aa  TIG_PSEPF RecName: Full=Trigger factor;         Short=TF;
    6::368     3e-22  23%  427 aa  TIG_LACLS RecName: Full=Trigger factor;         Short=TF;
   13::344     4e-22  26%  404 aa  TIG_THET2 RecName: Full=Trigger factor;         Short=TF;
   15::221     4e-22  32%  442 aa  TIG_MAGSM RecName: Full=Trigger factor;         Short=TF;
    6::368     4e-22  22%  427 aa  TIG_LACLM RecName: Full=Trigger factor;         Short=TF;
    1::315     4e-22  27%  432 aa  TIG_ECOSE RecName: Full=Trigger factor;         Short=TF;
    1::315     4e-22  27%  432 aa  TIG_ECO24 RecName: Full=Trigger factor;         Short=TF;
    1::345     4e-22  27%  484 aa  TIG_CLAM3 RecName: Full=Trigger factor;         Short=TF;
    1::423     9e-22  25%  432 aa  TIG_VIBVU RecName: Full=Trigger factor;         Short=TF;
    5::308     9e-22  26%  448 aa  TIG_RHOCS RecName: Full=Trigger factor;         Short=TF;
    7::428     9e-22  24%  442 aa  TIG_COXB2 RecName: Full=Trigger factor;         Short=TF;
    7::428     9e-22  24%  442 aa  TIG_COXB1 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_SHISS RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_SHIFL RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_SHIF8 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_SHIDS RecName: Full=Trigger factor;         Short=TF;
   25::376     1e-21  29%  480 aa  TIG_NOSP7 RecName: Full=Trigger factor;         Short=TF;
    2::418     1e-21  26%  431 aa  TIG_MANSM RecName: Full=Trigger factor;         Short=TF;
    6::368     1e-21  22%  427 aa  TIG_LACLA RecName: Full=Trigger factor;         Short=TF;
   16::223     1e-21  28%  435 aa  TIG_LACF3 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  429 aa  TIG_ECOUT RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOSM RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOLU RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOLI RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOLC RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  429 aa  TIG_ECOK1 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOHS RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECODH RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECOBW RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO8A RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO81 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO7I RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO5E RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO57 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO55 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  429 aa  TIG_ECO45 RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-21  27%  432 aa  TIG_ECO27 RecName: Full=Trigger factor;         Short=TF;
    5::387     1e-21  26%  436 aa  TIG_DELAS RecName: Full=Trigger factor;         Short=TF;
    1::424     1e-21  24%  437 aa  TIG_CELJU RecName: Full=Trigger factor;         Short=TF;
    5::329     1e-21  27%  436 aa  TIG_BORPD RecName: Full=Trigger factor;         Short=TF;
    5::329     1e-21  25%  436 aa  TIG_ACIAC RecName: Full=Trigger factor;         Short=TF;
    6::349     2e-21  25%  437 aa  TIG_NEIG1 RecName: Full=Trigger factor;         Short=TF;
    1::348     2e-21  22%  477 aa  TIG_PELUB RecName: Full=Trigger factor;         Short=TF;
    1::389     2e-21  26%  436 aa  TIG_HALHL RecName: Full=Trigger factor;         Short=TF;
    1::428     2e-21  20%  435 aa  TIG_DESAD RecName: Full=Trigger factor;         Short=TF;
    5::329     2e-21  26%  436 aa  TIG_BORA1 RecName: Full=Trigger factor;         Short=TF;
    1::422     3e-21  25%  434 aa  TIG_SHEAM RecName: Full=Trigger factor;         Short=TF;
    1::315     3e-21  27%  432 aa  TIG_SALPC RecName: Full=Trigger factor;         Short=TF;
    1::315     3e-21  27%  432 aa  TIG_SALCH RecName: Full=Trigger factor;         Short=TF;
    1::434     3e-21  25%  452 aa  TIG_RHOPA RecName: Full=Trigger factor;         Short=TF;
    1::422     3e-21  23%  436 aa  TIG_PSEF5 RecName: Full=Trigger factor;         Short=TF;
    1::359     3e-21  22%  450 aa  TIG_DESAH RecName: Full=Trigger factor;         Short=TF;
   12::332     3e-21  26%  476 aa  TIG_MESSB RecName: Full=Trigger factor;         Short=TF;
    1::418     3e-21  23%  438 aa  TIG_FRATN RecName: Full=Trigger factor;         Short=TF;
    1::315     3e-21  29%  432 aa  TIG_ECOL6 RecName: Full=Trigger factor;         Short=TF;
    1::315     3e-21  29%  432 aa  TIG_ECOL5 RecName: Full=Trigger factor;         Short=TF;
    7::428     3e-21  23%  442 aa  TIG_COXBU RecName: Full=Trigger factor;         Short=TF;
    1::315     4e-21  27%  432 aa  TIG_SHIBS RecName: Full=Trigger factor;         Short=TF;
    1::324     4e-21  25%  434 aa  TIG_SHELP RecName: Full=Trigger factor;         Short=TF;
    1::315     6e-21  27%  432 aa  TIG_SHIB3 RecName: Full=Trigger factor;         Short=TF;
    1::438     6e-21  22%  453 aa  TIG_RHOP5 RecName: Full=Trigger factor;         Short=TF;
    6::349     6e-21  25%  437 aa  TIG_NEIG2 RecName: Full=Trigger factor;         Short=TF;
    6::377     6e-21  25%  464 aa  TIG_MICAN RecName: Full=Trigger factor;         Short=TF;
    5::418     6e-21  24%  433 aa  TIG_HAEDU RecName: Full=Trigger factor;         Short=TF;
    1::315     6e-21  27%  432 aa  TIG_ESCF3 RecName: Full=Trigger factor;         Short=TF;
    6::379     6e-21  23%  455 aa  TIG_CYAP8 RecName: Full=Trigger factor;         Short=TF;
    5::293     6e-21  26%  433 aa  TIG_ACTP2 RecName: Full=Trigger factor;         Short=TF;
    5::329     7e-21  25%  440 aa  TIG_VEREI RecName: Full=Trigger factor;         Short=TF;
    3::375     7e-21  24%  474 aa  TIG_SYNE7 RecName: Full=Trigger factor;         Short=TF;
    5::345     7e-21  26%  436 aa  TIG_RHOFD RecName: Full=Trigger factor;         Short=TF;
    1::434     7e-21  26%  440 aa  TIG_OPITP RecName: Full=Trigger factor;         Short=TF;
   14::365     7e-21  23%  449 aa  TIG_LACGA RecName: Full=Trigger factor;         Short=TF;
    4::219     7e-21  28%  431 aa  TIG_ACTSZ RecName: Full=Trigger factor;         Short=TF;
    1::220     1e-20  27%  432 aa  TIG_ENT38 RecName: Full=Trigger factor;         Short=TF;
    5::429     1e-20  24%  444 aa  TIG_AZOBR RecName: Full=Trigger factor;         Short=TF;
    3::375     1e-20  24%  474 aa  TIG_SYNP6 RecName: Full=Trigger factor;         Short=TF;
    1::418     1e-20  25%  434 aa  TIG_SHEHH RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-20  29%  432 aa  TIG_SALTY RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-20  29%  432 aa  TIG_SALTI RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-20  29%  432 aa  TIG_SALNS RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-20  29%  432 aa  TIG_SALHS RecName: Full=Trigger factor;         Short=TF;
   17::316     1e-20  27%  443 aa  TIG_ROSDO RecName: Full=Trigger factor;         Short=TF;
    1::220     1e-20  26%  432 aa  TIG_CITK8 RecName: Full=Trigger factor;         Short=TF;
    1::365     1e-20  25%  429 aa  TIG_ANADE RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALSV RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALPK RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALPB RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALPA RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALG2 RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALEP RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALDC RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_SALA4 RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  434 aa  TIG_PECCP RecName: Full=Trigger factor;         Short=TF;
    6::349     2e-20  24%  437 aa  TIG_NEIMB RecName: Full=Trigger factor;         Short=TF;
    5::437     2e-20  27%  448 aa  TIG_BURVG RecName: Full=Trigger factor;         Short=TF;
    5::437     2e-20  27%  448 aa  TIG_BURCM RecName: Full=Trigger factor;         Short=TF;
    1::216     2e-20  29%  460 aa  TIG_ARTAT RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  434 aa  TIG_SERP5 RecName: Full=Trigger factor;         Short=TF;
    1::315     2e-20  29%  432 aa  TIG_SALAR RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-20  27%  432 aa  TIG_ENTS8 RecName: Full=Trigger factor;         Short=TF;
    1::321     3e-20  27%  435 aa  TIG_VIBHB RecName: Full=Trigger factor;         Short=TF;
   17::316     3e-20  29%  443 aa  TIG_SILST RecName: Full=Trigger factor;         Short=TF;
    1::337     3e-20  27%  445 aa  TIG_PSYWF RecName: Full=Trigger factor;         Short=TF;
    1::427     3e-20  22%  440 aa  TIG_DESMR RecName: Full=Trigger factor;         Short=TF;
    5::437     3e-20  29%  448 aa  TIG_BURCC RecName: Full=Trigger factor;         Short=TF;
    5::293     3e-20  25%  433 aa  TIG_ACTPJ RecName: Full=Trigger factor;         Short=TF;
    5::293     3e-20  25%  433 aa  TIG_ACTP7 RecName: Full=Trigger factor;         Short=TF;
    1::382     4e-20  24%  472 aa  TIG_SYNPX RecName: Full=Trigger factor;         Short=TF;
    4::322     4e-20  28%  536 aa  TIG_SPHAL RecName: Full=Trigger factor;         Short=TF;
    1::422     4e-20  23%  436 aa  TIG_PSEAE RecName: Full=Trigger factor;         Short=TF;
    1::422     4e-20  23%  436 aa  TIG_PSEAB RecName: Full=Trigger factor;         Short=TF;
    1::422     4e-20  23%  436 aa  TIG_PSEA8 RecName: Full=Trigger factor;         Short=TF;
    1::329     4e-20  27%  435 aa  TIG_NITMU RecName: Full=Trigger factor;         Short=TF;
    5::434     4e-20  24%  453 aa  TIG_NITHX RecName: Full=Trigger factor;         Short=TF;
   14::372     4e-20  23%  452 aa  TIG_LACH4 RecName: Full=Trigger factor;         Short=TF;
    1::418     4e-20  22%  438 aa  TIG_FRAP2 RecName: Full=Trigger factor;         Short=TF;
    5::437     4e-20  28%  448 aa  TIG_BURCH RecName: Full=Trigger factor;         Short=TF;
    5::437     4e-20  28%  448 aa  TIG_BURCA RecName: Full=Trigger factor;         Short=TF;
    5::437     4e-20  27%  448 aa  TIG_BURA4 RecName: Full=Trigger factor;         Short=TF;
    1::342     5e-20  27%  432 aa  TIG_VIBVY RecName: Full=Trigger factor;         Short=TF;
    4::355     5e-20  27%  462 aa  TIG_MAGSA RecName: Full=Trigger factor;         Short=TF;
    5::419     5e-20  26%  432 aa  TIG_HAES2 RecName: Full=Trigger factor;         Short=TF;
    5::419     5e-20  26%  432 aa  TIG_HAES1 RecName: Full=Trigger factor;         Short=TF;
    1::422     6e-20  23%  436 aa  TIG_PSE14 RecName: Full=Trigger factor;         Short=TF;
    1::315     6e-20  25%  437 aa  TIG_NITSB RecName: Full=Trigger factor;         Short=TF;
    6::349     6e-20  24%  437 aa  TIG_NEIMA RecName: Full=Trigger factor;         Short=TF;
    5::348     6e-20  24%  436 aa  TIG_NEIM0 RecName: Full=Trigger factor;         Short=TF;
    1::345     8e-20  24%  441 aa  TIG_TERTT RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  24%  434 aa  TIG_SHESW RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  24%  434 aa  TIG_SHESR RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  24%  434 aa  TIG_SHESM RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  24%  434 aa  TIG_SHEPC RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  23%  436 aa  TIG_PSEU2 RecName: Full=Trigger factor;         Short=TF;
    1::422     8e-20  24%  436 aa  TIG_PSEA7 RecName: Full=Trigger factor;         Short=TF;
    1::220     8e-20  27%  434 aa  TIG_ERWT9 RecName: Full=Trigger factor;         Short=TF;
    7::318     8e-20  30%  454 aa  TIG_BORBU RecName: Full=Trigger factor;         Short=TF;
    9::359     8e-20  24%  474 aa  TIG_BARBK RecName: Full=Trigger factor;         Short=TF;
    1::351     8e-20  26%  437 aa  TIG_AZOSB RecName: Full=Trigger factor;         Short=TF;
    1::216     8e-20  29%  464 aa  TIG_ARTCA RecName: Full=Trigger factor;         Short=TF;
    1::422     1e-19  23%  436 aa  TIG_PSESM RecName: Full=Trigger factor;         Short=TF;
    5::419     1e-19  28%  432 aa  TIG_PASMU RecName: Full=Trigger factor;         Short=TF;
    1::315     1e-19  28%  432 aa  TIG_KLEP3 RecName: Full=Trigger factor;         Short=TF;
    1::220     1e-19  27%  446 aa  TIG_HAHCH RecName: Full=Trigger factor;         Short=TF;
    5::320     1e-19  24%  431 aa  TIG_HAEPS RecName: Full=Trigger factor;         Short=TF;
    1::334     1e-19  25%  436 aa  TIG_AKKM8 RecName: Full=Trigger factor;         Short=TF;
   27::341     1e-19  28%  437 aa  TIG_ACIBL RecName: Full=Trigger factor;         Short=TF;
   11::368     1e-19  23%  427 aa  TIG_STRT2 RecName: Full=Trigger factor;         Short=TF;
   11::368     1e-19  23%  427 aa  TIG_STRT1 RecName: Full=Trigger factor;         Short=TF;
    1::418     1e-19  25%  434 aa  TIG_SHESH RecName: Full=Trigger factor;         Short=TF;
    1::337     1e-19  25%  453 aa  TIG_RHOPS RecName: Full=Trigger factor;         Short=TF;
    5::329     1e-19  25%  436 aa  TIG_POLNA RecName: Full=Trigger factor;         Short=TF;
    1::348     1e-19  28%  434 aa  TIG_METFK RecName: Full=Trigger factor;         Short=TF;
    1::146     1e-19  30%  481 aa  TIG_HERA2 RecName: Full=Trigger factor;         Short=TF;
    1::418     1e-19  23%  438 aa  TIG_FRATT RecName: Full=Trigger factor;         Short=TF;
    1::418     1e-19  23%  438 aa  TIG_FRAT1 RecName: Full=Trigger factor;         Short=TF;
    1::308     2e-19  27%  434 aa  TIG_VIBPA RecName: Full=Trigger factor;         Short=TF;
   11::368     2e-19  23%  427 aa  TIG_STRTD RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-19  24%  434 aa  TIG_SHESA RecName: Full=Trigger factor;         Short=TF;
    1::418     2e-19  24%  434 aa  TIG_SHEPA RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-19  24%  434 aa  TIG_SHEB9 RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-19  24%  434 aa  TIG_SHEB8 RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-19  24%  434 aa  TIG_SHEB5 RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-19  24%  434 aa  TIG_SHEB2 RecName: Full=Trigger factor;         Short=TF;
   15::358     2e-19  25%  445 aa  TIG_RICBR RecName: Full=Trigger factor;         Short=TF;
   15::358     2e-19  25%  445 aa  TIG_RICB8 RecName: Full=Trigger factor;         Short=TF;
    5::345     2e-19  25%  436 aa  TIG_POLSJ RecName: Full=Trigger factor;         Short=TF;
    5::365     2e-19  25%  485 aa  TIG_METS4 RecName: Full=Trigger factor;         Short=TF;
    5::329     2e-19  24%  436 aa  TIG_DIAST RecName: Full=Trigger factor;         Short=TF;
    5::339     2e-19  25%  451 aa  TIG_CUPTR RecName: Full=Trigger factor;         Short=TF;
    5::437     2e-19  27%  448 aa  TIG_BURCJ RecName: Full=Trigger factor;         Short=TF;
    5::329     2e-19  24%  436 aa  TIG_ACISJ RecName: Full=Trigger factor;         Short=TF;
   13::344     2e-19  25%  404 aa  TIG_THET8 RecName: Full=Trigger factor;         Short=TF;
    1::315     2e-19  28%  432 aa  TIG_KLEP7 RecName: Full=Trigger factor;         Short=TF;
    5::362     2e-19  26%  445 aa  TIG_HYPNA RecName: Full=Trigger factor;         Short=TF;
    1::418     2e-19  23%  438 aa  TIG_FRATW RecName: Full=Trigger factor;         Short=TF;
    4::336     3e-19  23%  422 aa  TIG_SOLUE RecName: Full=Trigger factor;         Short=TF;
    1::418     3e-19  25%  434 aa  TIG_SHEWM RecName: Full=Trigger factor;         Short=TF;
    6::349     3e-19  24%  437 aa  TIG_NEIMF RecName: Full=Trigger factor;         Short=TF;
    5::419     3e-19  25%  432 aa  TIG_HAEI8 RecName: Full=Trigger factor;         Short=TF;
    1::220     3e-19  26%  434 aa  TIG_ERWCT RecName: Full=Trigger factor;         Short=TF;
    5::437     3e-19  25%  448 aa  TIG_BURM1 RecName: Full=Trigger factor;         Short=TF;
    5::329     4e-19  24%  434 aa  TIG_METPP RecName: Full=Trigger factor;         Short=TF;
    5::419     4e-19  26%  432 aa  TIG_HAEIN RecName: Full=Trigger factor;         Short=TF;
    5::419     4e-19  25%  432 aa  TIG_HAEIE RecName: Full=Trigger factor;         Short=TF;
    1::418     4e-19  23%  438 aa  TIG_FRATM RecName: Full=Trigger factor;         Short=TF;
    4::335     4e-19  25%  495 aa  TIG_AGRRK RecName: Full=Trigger factor;         Short=TF;
   43::433     5e-19  26%  452 aa  TIG_XANP2 RecName: Full=Trigger factor;         Short=TF;
    5::419     5e-19  26%  432 aa  TIG_HAEIG RecName: Full=Trigger factor;         Short=TF;
    1::418     5e-19  22%  438 aa  TIG_FRATH RecName: Full=Trigger factor;         Short=TF;
    5::329     5e-19  26%  436 aa  TIG_BORPA RecName: Full=Trigger factor;         Short=TF;
    5::329     5e-19  26%  436 aa  TIG_BORBR RecName: Full=Trigger factor;         Short=TF;
    1::352     5e-19  26%  430 aa  TIG_ANADF RecName: Full=Trigger factor;         Short=TF;
    4::335     7e-19  24%  494 aa  TIG_RHIEC RecName: Full=Trigger factor;         Short=TF;
    1::422     7e-19  23%  436 aa  TIG_PSEMY RecName: Full=Trigger factor;         Short=TF;
    5::437     7e-19  26%  448 aa  TIG_BURS3 RecName: Full=Trigger factor;         Short=TF;
    1::422     9e-19  24%  437 aa  TIG_PSEE4 RecName: Full=Trigger factor;         Short=TF;
    1::422     9e-19  24%  433 aa  TIG_PHOPR RecName: Full=Trigger factor;         Short=TF;
    1::418     1e-18  25%  434 aa  TIG_SHEON RecName: Full=Trigger factor;         Short=TF;
    1::422     1e-18  23%  437 aa  TIG_PSEPW RecName: Full=Trigger factor;         Short=TF;
    1::422     1e-18  24%  437 aa  TIG_PSEPG RecName: Full=Trigger factor;         Short=TF;
    1::419     1e-18  26%  434 aa  TIG_PROMH RecName: Full=Trigger factor;         Short=TF;
   18::317     1e-18  30%  444 aa  TIG_PARDP RecName: Full=Trigger factor;         Short=TF;
   43::438     1e-18  29%  451 aa  TIG_BRASO RecName: Full=Trigger factor;         Short=TF;
    5::329     1e-18  26%  436 aa  TIG_BORPE RecName: Full=Trigger factor;         Short=TF;
    1::420     2e-18  24%  436 aa  TIG_TOLAT RecName: Full=Trigger factor;         Short=TF;
   17::316     2e-18  29%  443 aa  TIG_SILPO RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-18  24%  436 aa  TIG_PSEFS RecName: Full=Trigger factor;         Short=TF;
   10::233     2e-18  23%  431 aa  TIG_LEUCK RecName: Full=Trigger factor;         Short=TF;
    1::418     2e-18  22%  438 aa  TIG_FRATO RecName: Full=Trigger factor;         Short=TF;
    1::418     2e-18  22%  438 aa  TIG_FRATF RecName: Full=Trigger factor;         Short=TF;
   17::363     2e-18  27%  452 aa  TIG_CAUCR RecName: Full=Trigger factor;         Short=TF;
   17::363     2e-18  27%  452 aa  TIG_CAUCN RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURPS RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURP6 RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURP1 RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURP0 RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURMS RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURMA RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURM9 RecName: Full=Trigger factor;         Short=TF;
    5::438     2e-18  26%  449 aa  TIG_BURM7 RecName: Full=Trigger factor;         Short=TF;
    1::418     2e-18  25%  432 aa  TIG_VIBFM RecName: Full=Trigger factor;         Short=TF;
    5::337     2e-18  24%  447 aa  TIG_PSYCK RecName: Full=Trigger factor;         Short=TF;
    5::337     2e-18  25%  447 aa  TIG_PSYA2 RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-18  24%  437 aa  TIG_PSEPK RecName: Full=Trigger factor;         Short=TF;
    1::422     2e-18  24%  437 aa  TIG_PSEP1 RecName: Full=Trigger factor;         Short=TF;
    7::318     2e-18  29%  452 aa  TIG_BORAP RecName: Full=Trigger factor;         Short=TF;
    1::418     3e-18  24%  432 aa  TIG_VIBF1 RecName: Full=Trigger factor;         Short=TF;
    4::335     3e-18  24%  495 aa  TIG_RHIE6 RecName: Full=Trigger factor;         Short=TF;
    5::339     3e-18  25%  451 aa  TIG_RALEH RecName: Full=Trigger factor;         Short=TF;
   12::312     3e-18  30%  511 aa  TIG_PARL1 RecName: Full=Trigger factor;         Short=TF;
   17::357     3e-18  27%  462 aa  TIG_METSB RecName: Full=Trigger factor;         Short=TF;
    1::325     3e-18  23%  435 aa  TIG_COLP3 RecName: Full=Trigger factor;         Short=TF;
    9::359     3e-18  22%  475 aa  TIG_BART1 RecName: Full=Trigger factor;         Short=TF;
    9::359     3e-18  22%  469 aa  TIG_BARQU RecName: Full=Trigger factor;         Short=TF;
    1::422     5e-18  25%  434 aa  TIG_SHEDO RecName: Full=Trigger factor;         Short=TF;
    1::309     5e-18  24%  435 aa  TIG_PSYIN RecName: Full=Trigger factor;         Short=TF;
    5::437     5e-18  25%  448 aa  TIG_BURP8 RecName: Full=Trigger factor;         Short=TF;
    1::422     5e-18  23%  436 aa  TIG_AZOVD RecName: Full=Trigger factor;         Short=TF;
    1::220     6e-18  25%  434 aa  TIG_SODGM RecName: Full=Trigger factor;         Short=TF;
    1::377     6e-18  22%  479 aa  TIG_PROMM RecName: Full=Trigger factor;         Short=TF;
    5::337     6e-18  25%  453 aa  TIG_NITWN RecName: Full=Trigger factor;         Short=TF;
    1::216     6e-18  27%  469 aa  TIG_ARTS2 RecName: Full=Trigger factor;         Short=TF;
    5::317     8e-18  27%  444 aa  TIG_RHOS4 RecName: Full=Trigger factor;         Short=TF;
    5::317     8e-18  27%  444 aa  TIG_RHOS1 RecName: Full=Trigger factor;         Short=TF;
    7::318     8e-18  29%  452 aa  TIG_BORGA RecName: Full=Trigger factor;         Short=TF;
    5::329     1e-17  25%  437 aa  TIG_VARPS RecName: Full=Trigger factor;         Short=TF;
    4::335     1e-17  24%  494 aa  TIG_RHIL3 RecName: Full=Trigger factor;         Short=TF;
    9::377     1e-17  26%  481 aa  TIG_PROM9 RecName: Full=Trigger factor;         Short=TF;
    5::367     1e-17  25%  478 aa  TIG_METEP RecName: Full=Trigger factor;         Short=TF;
    5::367     1e-17  25%  478 aa  TIG_METC4 RecName: Full=Trigger factor;         Short=TF;
    5::314     1e-17  29%  441 aa  TIG_JANSC RecName: Full=Trigger factor;         Short=TF;
    6::373     1e-17  23%  461 aa  TIG_GLOVI RecName: Full=Trigger factor;         Short=TF;
   17::334     2e-17  24%  452 aa  TIG_OLICO RecName: Full=Trigger factor;         Short=TF;
   15::357     2e-17  22%  451 aa  TIG_LEPBL RecName: Full=Trigger factor;         Short=TF;
   15::357     2e-17  22%  451 aa  TIG_LEPBJ RecName: Full=Trigger factor;         Short=TF;
    8::355     2e-17  23%  449 aa  TIG_DEIGD RecName: Full=Trigger factor;         Short=TF;
    9::368     2e-17  22%  469 aa  TIG_BARHE RecName: Full=Trigger factor;         Short=TF;
    1::425     2e-17  24%  436 aa  TIG_PSEA6 RecName: Full=Trigger factor;         Short=TF;
    5::367     2e-17  25%  478 aa  TIG_METPB RecName: Full=Trigger factor;         Short=TF;
    9::375     3e-17  24%  473 aa  TIG_PROMP RecName: Full=Trigger factor;         Short=TF;
    5::365     3e-17  24%  473 aa  TIG_METNO RecName: Full=Trigger factor;         Short=TF;
    5::348     3e-17  25%  440 aa  TIG_ACICJ RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPY RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPS RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPP RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPN RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPG RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPE RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPB RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERPA RecName: Full=Trigger factor;         Short=TF;
    1::220     4e-17  25%  434 aa  TIG_YERP3 RecName: Full=Trigger factor;         Short=TF;
    5::438     4e-17  26%  449 aa  TIG_BURTA RecName: Full=Trigger factor;         Short=TF;
    9::377     5e-17  25%  476 aa  TIG_PROM2 RecName: Full=Trigger factor;         Short=TF;
   15::357     5e-17  23%  451 aa  TIG_LEPIN RecName: Full=Trigger factor;         Short=TF;
   15::357     5e-17  23%  451 aa  TIG_LEPIC RecName: Full=Trigger factor;         Short=TF;
    2::357     5e-17  18%  431 aa  TIG_AYWBP RecName: Full=Trigger factor;         Short=TF;
    4::335     5e-17  27%  492 aa  TIG_AGRT5 RecName: Full=Trigger factor;         Short=TF;
    1::377     7e-17  26%  474 aa  TIG_PROMS RecName: Full=Trigger factor;         Short=TF;
    1::341     7e-17  21%  479 aa  TIG_PROM3 RecName: Full=Trigger factor;         Short=TF;
    1::377     7e-17  26%  477 aa  TIG_PROM0 RecName: Full=Trigger factor;         Short=TF;
    1::220     7e-17  25%  433 aa  TIG_EDWI9 RecName: Full=Trigger factor;         Short=TF;
   25::378     9e-17  26%  485 aa  TIG_TRIEI RecName: Full=Trigger factor;         Short=TF;
    4::372     9e-17  22%  473 aa  TIG_THEEB RecName: Full=Trigger factor;         Short=TF;
    5::329     9e-17  23%  435 aa  TIG_LEPCP RecName: Full=Trigger factor;         Short=TF;
    1::220     9e-17  26%  443 aa  TIG_LEGPH RecName: Full=Trigger factor;         Short=TF;
    1::220     9e-17  26%  459 aa  TIG_LEGPC RecName: Full=Trigger factor;         Short=TF;
    1::220     9e-17  26%  443 aa  TIG_LEGPA RecName: Full=Trigger factor;         Short=TF;
    1::419     1e-16  25%  434 aa  TIG_YERE8 RecName: Full=Trigger factor;         Short=TF;
    4::316     1e-16  25%  495 aa  TIG_RHILW RecName: Full=Trigger factor;         Short=TF;
   12::378     1e-16  21%  439 aa  TIG_OENOB RecName: Full=Trigger factor;         Short=TF;
   16::358     1e-16  23%  443 aa  TIG_GLUOX RecName: Full=Trigger factor;         Short=TF;
   14::220     1e-16  26%  434 aa  TIG_AZOSE RecName: Full=Trigger factor;         Short=TF;
    1::334     1e-16  22%  443 aa  TIG_SYNAS RecName: Full=Trigger factor;         Short=TF;
    1::422     1e-16  23%  434 aa  TIG_SHEFN RecName: Full=Trigger factor;         Short=TF;
    5::438     1e-16  24%  451 aa  TIG_RALEJ RecName: Full=Trigger factor;         Short=TF;
   16::360     1e-16  26%  445 aa  TIG_GLUDA RecName: Full=Trigger factor;         Short=TF;
    5::381     2e-16  23%  491 aa  TIG_SYNR3 RecName: Full=Trigger factor;         Short=TF;
   17::437     2e-16  22%  460 aa  TIG_BEII9 RecName: Full=Trigger factor;         Short=TF;
   16::317     2e-16  26%  444 aa  TIG_RHOCA RecName: Full=Trigger factor;         Short=TF;
   12::316     2e-16  26%  492 aa  TIG_RHILO RecName: Full=Trigger factor;         Short=TF;
   16::223     2e-16  24%  436 aa  TIG_LACRJ RecName: Full=Trigger factor;         Short=TF;
   16::223     2e-16  24%  436 aa  TIG_LACRD RecName: Full=Trigger factor;         Short=TF;
    1::326     3e-16  23%  429 aa  TIG_VESOH RecName: Full=Trigger factor;         Short=TF;
    1::424     3e-16  28%  431 aa  TIG_STRMK RecName: Full=Trigger factor;         Short=TF;
   14::365     4e-16  22%  439 aa  TIG_LACDB RecName: Full=Trigger factor;         Short=TF;
   14::365     4e-16  22%  439 aa  TIG_LACDA RecName: Full=Trigger factor;         Short=TF;
    5::339     6e-16  24%  449 aa  TIG_RALME RecName: Full=Trigger factor;         Short=TF;
    1::220     6e-16  24%  434 aa  TIG_PHOLL RecName: Full=Trigger factor;         Short=TF;
   43::438     6e-16  28%  452 aa  TIG_BRASB RecName: Full=Trigger factor;         Short=TF;
    4::335     7e-16  24%  491 aa  TIG_SINMW RecName: Full=Trigger factor;         Short=TF;
    1::418     7e-16  23%  432 aa  TIG_ALISL RecName: Full=Trigger factor;         Short=TF;
    6::381     1e-15  22%  471 aa  TIG_SYNY3 RecName: Full=Trigger factor;         Short=TF;
    4::335     1e-15  23%  491 aa  TIG_RHISN RecName: Full=Trigger factor;         Short=TF;
   17::337     1e-15  25%  473 aa  TIG_METRJ RecName: Full=Trigger factor;         Short=TF;
   16::307     2e-15  24%  442 aa  TIG_DINSH RecName: Full=Trigger factor;         Short=TF;
    1::324     2e-15  21%  429 aa  TIG_RUTMC RecName: Full=Trigger factor;         Short=TF;
    1::324     3e-15  29%  431 aa  TIG_STRM5 RecName: Full=Trigger factor;         Short=TF;
    4::335     3e-15  23%  491 aa  TIG_RHIME RecName: Full=Trigger factor;         Short=TF;
    4::433     4e-15  23%  451 aa  TIG_HELPS RecName: Full=Trigger factor;         Short=TF;
    4::346     5e-15  24%  434 aa  TIG_DECAR RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIBY RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIBT RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIBS RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIBC RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIB5 RecName: Full=Trigger factor;         Short=TF;
    1::228     5e-15  25%  444 aa  TIG_ACIB3 RecName: Full=Trigger factor;         Short=TF;
    6::380     6e-15  25%  454 aa  TIG_SYNP2 RecName: Full=Trigger factor;         Short=TF;
   12::160     1e-14  24%  480 aa  TIG_RHOBA RecName: Full=Trigger factor;         Short=TF;
    1::338     1e-14  24%  449 aa  TIG_RALSO RecName: Full=Trigger factor;         Short=TF;
    1::323     2e-14  22%  430 aa  TIG_XANCP RecName: Full=Trigger factor;         Short=TF;
    5::317     2e-14  25%  444 aa  TIG_RHOSK RecName: Full=Trigger factor;         Short=TF;
    1::337     2e-14  23%  452 aa  TIG_RHOP2 RecName: Full=Trigger factor;         Short=TF;
    8::153     2e-14  28%  465 aa  TIG_DEIRA RecName: Full=Trigger factor;         Short=TF;
    1::323     2e-14  22%  430 aa  TIG_XANCB RecName: Full=Trigger factor;         Short=TF;
    1::323     2e-14  22%  430 aa  TIG_XANC8 RecName: Full=Trigger factor;         Short=TF;
   17::384     2e-14  23%  445 aa  TIG_RICRS RecName: Full=Trigger factor;         Short=TF;
   17::384     2e-14  23%  445 aa  TIG_RICRO RecName: Full=Trigger factor;         Short=TF;
    1::341     2e-14  21%  467 aa  TIG_PROMA RecName: Full=Trigger factor;         Short=TF;
    9::335     2e-14  23%  477 aa  TIG_BRUO2 RecName: Full=Trigger factor;         Short=TF;
    9::335     2e-14  23%  477 aa  TIG_BRUME RecName: Full=Trigger factor;         Short=TF;
    9::335     2e-14  23%  471 aa  TIG_BRUAB RecName: Full=Trigger factor;         Short=TF;
    9::335     2e-14  23%  471 aa  TIG_BRUA2 RecName: Full=Trigger factor;         Short=TF;
    9::335     2e-14  23%  471 aa  TIG_BRUA1 RecName: Full=Trigger factor;         Short=TF;
   16::341     3e-14  22%  481 aa  TIG_SYNPW RecName: Full=Trigger factor;         Short=TF;
   17::329     3e-14  23%  445 aa  TIG_RICAH RecName: Full=Trigger factor;         Short=TF;
    1::422     3e-14  21%  439 aa  TIG_NITEU RecName: Full=Trigger factor;         Short=TF;
    1::317     3e-14  20%  430 aa  TIG_LAWIP RecName: Full=Trigger factor;         Short=TF;
   17::317     3e-14  24%  453 aa  TIG_BRAJA RecName: Full=Trigger factor;         Short=TF;
    4::335     3e-14  25%  493 aa  TIG_AGRVS RecName: Full=Trigger factor;         Short=TF;
   17::384     4e-14  23%  445 aa  TIG_RICFE RecName: Full=Trigger factor;         Short=TF;
   16::317     4e-14  26%  444 aa  TIG_RHOS5 RecName: Full=Trigger factor;         Short=TF;
    9::375     4e-14  23%  473 aa  TIG_PROM5 RecName: Full=Trigger factor;         Short=TF;
    5::437     4e-14  24%  448 aa  TIG_BURXL RecName: Full=Trigger factor;         Short=TF;
    9::335     4e-14  23%  477 aa  TIG_BRUSU RecName: Full=Trigger factor;         Short=TF;
   17::384     5e-14  23%  445 aa  TIG_RICCN RecName: Full=Trigger factor;         Short=TF;
    5::328     5e-14  22%  448 aa  TIG_BORDL RecName: Full=Trigger factor;         Short=TF;
    5::328     7e-14  22%  448 aa  TIG_BORRA RecName: Full=Trigger factor;         Short=TF;
    1::307     7e-14  23%  444 aa  TIG_ACIAD RecName: Full=Trigger factor;         Short=TF;
    1::328     9e-14  23%  432 aa  TIG_THIDA RecName: Full=Trigger factor;         Short=TF;
   17::384     9e-14  23%  445 aa  TIG_RICPU RecName: Full=Trigger factor;         Short=TF;
    9::232     9e-14  25%  447 aa  TIG_RHORT RecName: Full=Trigger factor;         Short=TF;
    1::378     9e-14  21%  472 aa  TIG_PROMT RecName: Full=Trigger factor;         Short=TF;
    1::341     9e-14  19%  471 aa  TIG_PROM4 RecName: Full=Trigger factor;         Short=TF;
    1::422     9e-14  20%  441 aa  TIG_MARMS RecName: Full=Trigger factor;         Short=TF;
    4::310     1e-13  27%  551 aa  TIG_SPHWW RecName: Full=Trigger factor;         Short=TF;
    9::335     1e-13  23%  477 aa  TIG_OCHA4 RecName: Full=Trigger factor;         Short=TF;
    3::223     2e-13  20%  442 aa  TIG_TREPS RecName: Full=Trigger factor;         Short=TF;
    3::223     2e-13  20%  442 aa  TIG_TREPA RecName: Full=Trigger factor;         Short=TF;
   17::381     2e-13  22%  442 aa  TIG_RICCK RecName: Full=Trigger factor;         Short=TF;
    1::219     2e-13  26%  440 aa  TIG_HAMD5 RecName: Full=Trigger factor;         Short=TF;
    5::437     2e-13  24%  448 aa  TIG_BURPP RecName: Full=Trigger factor;         Short=TF;
   17::384     2e-13  23%  445 aa  TIG_RICM5 RecName: Full=Trigger factor;         Short=TF;
    1::220     2e-13  23%  443 aa  TIG_LEGPL RecName: Full=Trigger factor;         Short=TF;
    1::318     3e-13  20%  438 aa  TIG_NITEC RecName: Full=Trigger factor;         Short=TF;
    1::430     3e-13  20%  433 aa  TIG_SULDN RecName: Full=Trigger factor;         Short=TF;
   17::384     3e-13  23%  445 aa  TIG_RICAE RecName: Full=Trigger factor;         Short=TF;
    4::338     4e-13  25%  445 aa  TIG_POLNS RecName: Full=Trigger factor;         Short=TF;
   12::238     4e-13  22%  438 aa  TIG_OENOE RecName: Full=Trigger factor;         Short=TF;
   20::328     6e-13  23%  447 aa  TIG_WOLPP RecName: Full=Trigger factor;         Short=TF;
    4::338     8e-13  26%  445 aa  TIG_POLSQ RecName: Full=Trigger factor;         Short=TF;
   17::384     1e-12  23%  445 aa  TIG_RICPR RecName: Full=Trigger factor;         Short=TF;
    4::357     1e-12  22%  426 aa  TIG_MESFL RecName: Full=Trigger factor;         Short=TF;
   10::233     1e-12  22%  431 aa  TIG_LEUMM RecName: Full=Trigger factor;         Short=TF;
    1::378     2e-12  22%  472 aa  TIG_PROM1 RecName: Full=Trigger factor;         Short=TF;
   28::316     2e-12  23%  439 aa  TIG_ANAPZ RecName: Full=Trigger factor;         Short=TF;
    7::357     4e-12  24%  448 aa  TIG_BORHD RecName: Full=Trigger factor;         Short=TF;
   17::384     6e-12  21%  446 aa  TIG_RICTY RecName: Full=Trigger factor;         Short=TF;
   20::328     8e-12  25%  447 aa  TIG_WOLTR RecName: Full=Trigger factor;         Short=TF;
    1::429     1e-11  19%  433 aa  TIG_ARCB4 RecName: Full=Trigger factor;         Short=TF;
    9::356     2e-11  21%  428 aa  TIG_MYCMS RecName: Full=Trigger factor;         Short=TF;
    1::339     2e-11  21%  427 aa  TIG_CHLPB RecName: Full=Trigger factor;         Short=TF;
    7::357     2e-11  21%  448 aa  TIG_BORT9 RecName: Full=Trigger factor;         Short=TF;
   17::437     9e-11  19%  518 aa  TIG_MARMM RecName: Full=Trigger factor;         Short=TF;
   29::364     1e-10  23%  435 aa  TIG_PARUW RecName: Full=Trigger factor;         Short=TF;
   34::365     1e-10  20%  483 aa  TIG_MYCMO RecName: Full=Trigger factor;         Short=TF;
   51::323     2e-10  26%  441 aa  TIG_CHLAB RecName: Full=Trigger factor;         Short=TF;
    5::324     2e-10  24%  431 aa  TIG_XYLFM RecName: Full=Trigger factor;         Short=TF;
    9::341     2e-10  26%  459 aa  TIG_MYCPU RecName: Full=Trigger factor;         Short=TF;
    1::428     2e-10  24%  443 aa  TIG_CAMC1 RecName: Full=Trigger factor;         Short=TF;
    1::323     3e-10  21%  430 aa  TIG_XANC5 RecName: Full=Trigger factor;         Short=TF;
    4::433     3e-10  21%  451 aa  TIG_HELPH RecName: Full=Trigger factor;         Short=TF;
    1::323     5e-10  21%  430 aa  TIG_XANAC RecName: Full=Trigger factor;         Short=TF;
    9::239     6e-10  25%  446 aa  TIG_EHRRG RecName: Full=Trigger factor;         Short=TF;
   33::375     8e-10  25%  472 aa  TIG_UREU1 RecName: Full=Trigger factor;         Short=TF;
   16::157     8e-10  26%  449 aa  TIG_SYNS3 RecName: Full=Trigger factor;         Short=TF;
    1::224     8e-10  23%  441 aa  TIG_CAMC5 RecName: Full=Trigger factor;         Short=TF;
    4::433     1e-09  21%  451 aa  TIG_HELPY RecName: Full=Trigger factor;         Short=TF;
    4::433     1e-09  21%  451 aa  TIG_HELPG RecName: Full=Trigger factor;         Short=TF;
    9::239     1e-09  24%  446 aa  TIG_EHRRW RecName: Full=Trigger factor;         Short=TF;
    1::323     1e-09  21%  430 aa  TIG_XANOR RecName: Full=Trigger factor;         Short=TF;
    1::323     1e-09  21%  430 aa  TIG_XANOP RecName: Full=Trigger factor;         Short=TF;
    1::323     1e-09  21%  430 aa  TIG_XANOM RecName: Full=Trigger factor;         Short=TF;
   38::321     2e-09  28%  440 aa  TIG_EHRCJ RecName: Full=Trigger factor;         Short=TF;
   19::314     2e-09  25%  435 aa  TIG_CAMFF RecName: Full=Trigger factor;         Short=TF;
   43::433     3e-09  23%  451 aa  TIG_HELP2 RecName: Full=Trigger factor;         Short=TF;
   13::229     7e-09  23%  444 aa  TIG_MYCGE RecName: Full=Trigger factor;         Short=TF;
    1::224     7e-09  24%  439 aa  TIG_CAMLR RecName: Full=Trigger factor;         Short=TF;
   48::395     7e-09  26%  478 aa  TIG_AQUAE RecName: Full=Trigger factor;         Short=TF;
    5::324     9e-09  24%  431 aa  TIG_XYLFT RecName: Full=Trigger factor;         Short=TF;
    5::324     9e-09  24%  431 aa  TIG_XYLF2 RecName: Full=Trigger factor;         Short=TF;
   37::375     9e-09  24%  449 aa  TIG_UREPA RecName: Full=Trigger factor;         Short=TF;
   37::375     9e-09  24%  449 aa  TIG_UREP2 RecName: Full=Trigger factor;         Short=TF;
    8::224     9e-09  23%  451 aa  TIG_HELAH RecName: Full=Trigger factor;         Short=TF;
    9::339     9e-09  26%  441 aa  TIG_ANAMM RecName: Full=Trigger factor;         Short=TF;
   12::373     1e-08  24%  444 aa  TIG_MYCGA RecName: Full=Trigger factor;         Short=TF;
   43::426     1e-08  19%  442 aa  TIG_HELHP RecName: Full=Trigger factor;         Short=TF;
    1::244     2e-08  29%  439 aa  TIG_EHRCR RecName: Full=Trigger factor;         Short=TF;
   32::367     3e-08  22%  444 aa  TIG_MYCPN RecName: Full=Trigger factor;         Short=TF;
    1::216     6e-08  22%  427 aa  TIG_CHLL2 RecName: Full=Trigger factor;         Short=TF;
    1::163     7e-08  22%  431 aa  TIG_CHLT3 RecName: Full=Trigger factor;         Short=TF;
    5::324     1e-07  22%  431 aa  TIG_XYLFA RecName: Full=Trigger factor;         Short=TF;
   17::242     1e-07  23%  444 aa  TIG_WOLPM RecName: Full=Trigger factor;         Short=TF;
    5::216     1e-07  18%  428 aa  TIG_PROA2 RecName: Full=Trigger factor;         Short=TF;
   43::356     1e-07  22%  428 aa  TIG_MYCCT RecName: Full=Trigger factor;         Short=TF;
    1::233     2e-07  20%  427 aa  TIG_SULNB RecName: Full=Trigger factor;         Short=TF;
    8::223     2e-07  21%  451 aa  TIG_HELPJ RecName: Full=Trigger factor;         Short=TF;
    2::230     3e-07  24%  445 aa  TIG_MYCPE RecName: Full=Trigger factor;         Short=TF;
   51::319     3e-07  23%  442 aa  TIG_CHLPN RecName: Full=Trigger factor;         Short=TF;
    1::210     1e-06  19%  427 aa  TIG_CHLPD RecName: Full=Trigger factor;         Short=TF;
   12::220     1e-06  23%  436 aa  TIG_BAUCH RecName: Full=Trigger factor;         Short=TF;
    9::220     1e-06  25%  465 aa  TIG_MYCHJ RecName: Full=Trigger factor;         Short=TF;
    9::220     1e-06  25%  442 aa  TIG_MYCH7 RecName: Full=Trigger factor;         Short=TF;
    9::220     1e-06  25%  465 aa  TIG_MYCH2 RecName: Full=Trigger factor;         Short=TF;
    1::207     1e-06  25%  439 aa  TIG_KOSOT RecName: Full=Trigger factor;         Short=TF;
    1::360     3e-06  21%  444 aa  TIG_CAMJR RecName: Full=Trigger factor;         Short=TF;
    1::360     3e-06  21%  444 aa  TIG_CAMJE RecName: Full=Trigger factor;         Short=TF;
    1::360     5e-06  21%  444 aa  TIG_CAMJ8 RecName: Full=Trigger factor;         Short=TF;
   16::357     7e-06  19%  444 aa  TIG_GRABC RecName: Full=Trigger factor;         Short=TF;
   19::424     7e-06  23%  437 aa  TIG_CAMHC RecName: Full=Trigger factor;         Short=TF;
    1::216     9e-06  19%  426 aa  TIG_PELPB RecName: Full=Trigger factor;         Short=TF;
   15::221     3e-05  25%  462 aa  TIG_MYCS5 RecName: Full=Trigger factor;         Short=TF;
    1::224     3e-05  20%  444 aa  TIG_CAMJJ RecName: Full=Trigger factor;         Short=TF;
    1::339     8e-05  19%  427 aa  TIG_CHLP8 RecName: Full=Trigger factor;         Short=TF;
17198::17364   8e-04  23% 18141 aa  TITIN_DROME RecName: Full=Titin;AltName: Full=D-Titin;AltName:
    1::501

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MMEDSYVETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
TIG_BACSK       ------MSAKWEKTEENTGVLTIEVEADKVNDALDKAFXXXXXXXXXPGFRKGKVPRGLFEKQFGVESLY
TIG_SYNWW       ---------KLEKIENSEAYIEIEVSAEQVEEGLQYAYRKVIKQVAIPGFRKGKAPRELLELQFGKEVLF
TIG_BACCN       ---------KWEKLEGNVGVLTIEVDAKEVNKSLDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGVESLY
TIG_NOCSJ       ------MKSAVETLSPTRAKLTVEVPFEELKPSLDAAYKQIAKQINVPGFRRGKVPPAIIDRQVGRGAVL
TIG_LYSSC       ------MSAKWEKQEGNIGTLTIEVPAAEVDAAMDQAFKKVVKQINVPGFRKGKMPRKMFEQRFGIESLY
TIG_STAAR       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAE       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAB       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAS1       -----------EKKEGNEGVLSVTVPAEKVDKAIDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAW       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAT       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAS       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAN       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAM       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAAC       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAA9       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAA8       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAA3       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAA2       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAA1       -----------EKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_HALOH       ------MEVKKEQLEGNKVELKVEIEPERVDKALEQAYRKVVKNVSIPGFRKGKVPRRVLEARYGKEVLH
TIG_STAES       -----------EKKEGNEGVLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STAEQ       -----------EKKEGNEGVLTVTVPAEKVNKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_STACT       -----------EKKEGNQGVLSVTVPAKKVDQAIDQAFKKVVKQVNIPGFRKGKVPRQIFEQRFGVEALY
TIG_BREBN       -----------EKVENNQGVLTIEVDATQVDAALDQAFXXXXXXXXXPGFRKGKVPRKMFESRFGVESLY
TIG_CORJK       ------MKSSVEKLSATRTKLTIEVPFEELKPEFDKAYATLAQQVNMPGFRKGKVPAKILEARLGRGVVL
TIG_STAHJ       -----------EKKEGNEGLLKVTVPAEKVDKALDQAFKKVVKQINVPGFRKGKVPRPIFEQRFGVEALY
TIG_MYCS2       ------MKSTVEQLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAPRKLLEARIGRGAVL
TIG1_DESHY      ------MSVKMEKIEKNTVELEVTVDXXXXXXXXXXXXXXXXXXXNIPGFRKGKAPRTMVERYVGTAALY
TIG_MYCSS       ------MKSTVEKLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAPRKLLEARVGREAML
TIG_MYCSK       ------MKSTVEKLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAPRKLLEARVGREAML
TIG_MYCSJ       ------MKSTVEKLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAPRKLLEARVGREAML
TIG_CLOAB       ------MNSKMEKLEKNVIKFEITVDESKFNEAVIKSYNKNRRRFNVPGFRKGKAPLNIIKNYYGVGVLY
TIG_MYCGI       ------MKSTVEKLSPTRVRINVEVPFAELEPDIDKAFKQLAQQIRLPGFRPGKAPRKLLEARVGRGAVL
TIG_MOOTA       ------MKAAVEKLDKNQVLLEVEVEAPRVQKAIDQAYRRLVKQVNIPGFRKGKAPRFILEQYIGKEPIY
TIG_GEOSW       ------MSVKWEKLEGNEGVLTVEVDAEKVNEGLDAAFKKVVKNIAIPGFRKGKVPRVIFEKRFGVEALY
TIG_BACLD       ------MSVKWEKQEGNEGVLTVEVDADTFNKALDDAFKKVVKQVSIPGFRKGKVPRGLFEQRFGVEALY
TIG_BACCQ       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGVESLY
TIG_BACC7       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGVESLY
TIG_NOCFA       ------VKSTVEQLSPTRVRINVEVPFEELKPDFDRAYKALAKQVRIPGFRPGKAPAKLLEARLGRGAIL
TIG_BACC1       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGVESLY
TIG_ALKMQ       --------------EDNKITLKIVVGADQFEVAINKAYNKMKSSFNIPGFRKGKVPRKLVEQRYGVEVFF
TIG_RHOE4       ------MKSTVEQLSPTRVRINVEVPFAELKSDFDKAYKALAQQIRLPGFRPGKAPARLLEARVGRGAVL
TIG_BACHK       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACCZ       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACC3       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACC0       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACAN       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACAH       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACAC       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACAA       ---------KWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_PELTS       ------MKANAERIEKNTVLLEIEVDAEQLSQAMERAYRKLVKSVSVPGFRRGKTPRPIFERYVGKSALY
TIG_NATTJ       -----------EKIDKNKIKLSVEVDENRVEDALEQAYKKVVKQVEIPGFRKGKVPRKILENRFGPEVLY
TIG_STRP7       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_DESRM       ------MKATAERIEKNTVLLEIEVEQERVDQALNQAYKKVVKQVNVPGFRKGKAPRKMVERFVGTETLF
TIG_STRR6       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDQKFGEEALY
TIG_STRP2       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDQKFGEEALY
TIG_ALKOO       -----------EVIKRENVEVTVVVEAAKFEEAINKAYNKMKSRFNIQGFRKGKAPRKIVEKFYGVEVFY
TIG_CLOPH       ---------KVEDLGKNMVKLTIEATAEDFDKAIEQAYQKNKGKMNVQGFRKGKAPRAIIEKMYGVGVFY
TIG_BACWK       ------MSTKWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_MYCVP       ------MKSTVEKLSPTRVRINVEVPFTELEPDIDRAFKQLAKQIRLPGFRPGKAPRKLLEARVGRGAVL
TIG_EXISA       ---------KWEKTSGSQGVLTYEAPAEAFDKAVDAAFKTVVKDLNVPGFRKGKLPRPMFNKMYGEEALY
TIG_MACCJ       ------MSVKWEKQEGNEGVLTVTVPAEEVNAGLDKAFKKVVKQVNVPGFRKGKMPRPMFEQRFGVEALY
TIG_BACHD       ---------KWEKLEGNEGVLTVDVESAKVDEALDKAFXXXXXXXXXPGFRKGKVPRKIFERQFGVEALY
TIG_GEOKA       ------MSVKWEKLEGNEGVLTVEVDAEKVNKGLDAAFKKVVKNITLPGFRKGKVPRVLFEKRFGVEALY
TIG_CORA7       ------MKTTVDKLSDTRVKLTVNVPFAELDKEIDQAYAAIAQQVSIPGFRKGKAPRQLIDARFGRGPIL
TIG_MYCPA       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARFGREAML
TIG_MYCA1       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARFGREAML
TIG_BACA2       ------MSVKWEKQEGNEGVLTVEVDADTFKTALDDAFKKVVKQVSIPGFRKGKVPRGLFEQRFGVEALY
TIG_MYCA9       ------MKSTVEKLSPTRVRINVEVPFAELEPDFSKAYKELAQQVRLPGFRPGKAPAKLLEARVGRAAVL
TIG_ANATD       ---------------------------------LQKSYLKNAKYFKIPGFRPGKAPRSLIERAYGEEVFY
TIG_MYCMM       ------MKSSVEQLSPTRVRIKVEVPFAELEPDFQRAYKELAKQVRLPGFRPGRAPVKLLEARFGREAML
TIG_GEOSF       ------MQISVESLSSVKKKINFEIPAARVASEVEKVYDEIRKHAAIKGFRKGKVPKDIIKKHY-HEKMA
TIG_LACS1       ----------------NEGKLTFEIAPEKIKEGLNSAFNRVKKSLNVPGFRKGKVPRQIFNKMYGEEALY
TIG_GEOSL       ----------VESLSSVKKKISFEIPADRVTSEIDKVFEKIRKRAAIKGFRKGKAPQSLIEKHY-ADVME
TIG_FINM2       --------------ENNQAVFTCEIPAEDFNNAIEESYKKNRSRFSLKGFRKGKVPRKMLERAYGEGLFY
TIG_CLOB8       ------MKAKVEKIETNVIKLEIRVEAEKFDAALTKAYNKNKGRYNIPGFRKGKVPMAMVKKFYGVEVFY
TIG_BACP2       ------MSVKWEKQEGNEGVLTVEVDAETFNKALDDAFKKVVKQVSIPGFRKGKVPRGLFEQRFGVESLY
TIG_CLOBB       ------MEAKVEKIETNVVKLEIKVEAEKFDAALTKAYNKNKGKYNVPGFRKGKVPMAILKKMYGIEIFY
TIG_GEOTN       ------MSVKWEKLEGNEGVLTVEVDAEQVNKGLDAAFKKVVKNVSLPGFRKGKVPRVLFEKRFGVEALY
TIG_MYCUA       ------MKSSVEQLSPTRVRIKVEVPFAELEPDFQRAYKELAKQVRLPGFRPGRAPVKLLEARFGREAML
TIG_CLOPS       ------MEAKMNKIDTNVVELEIKVDAKDFNEALXXXXXXXXXXFNIPGFRKGKVPMNMVKKFYGVEVLF
TIG_MYCBT       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGREAML
TIG_MYCBP       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGREAML
TIG_MYCBO       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGREAML
TIG_SYMTH       -----------DKLENNWMQFEVEVDASEFSKSVEAAFRKMNRQVTIPGFRRGKAPRAVFERVYGKEALV
TIG_STRZT       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_STRZP       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_STRZJ       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDQKFGEESLY
TIG_STRPS       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_STRPJ       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_STRPI       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_STRP4       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDKKFGEESLY
TIG_CARHZ       -----------ETLEKSRVELTIEVEAEEVSKAYEKAYKKIAQKVVIPGFRKGKAPRVLVERHVGKEYIL
TIG_STRPN       -----------ENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFRKGHLPRPIFDQKFGEEALY
TIG_EUBR3       ------MSVQVENLEHNMAKLTIEVAAEELEKALDSAYQKQKKQISVPGFRKGKVPRAMIEKMYGAGVFY
TIG_CLONN       ------MNTKIERVENNVVKLEITVEKEKFNEAIKKAYKKNVKRFNVPGFRKGKAPMNIITRYYGEGVFY
TIG_DESVM       ------MEYTVEDLSPVKKKVNISVPVEEVEAALSAAIAMYRTNMSLDGFRKGKVPSNLVESRFRKE-IY
TIG_BACSU       ------MSVKWEKQEGNEGVLTVEVDAETFKTALDDAFKKVVKQVSIPGFRKGKIPRGLFEQRFGVEALY
TIG_MYCTU       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGREAML
TIG_MYCTA       ------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGREAML
TIG_DESAP       ------MKASAEKIDKNRVELQVEVEPERLDEVLNQAYRKLVRKANIPGFRPGKAPRPVFERFYGKQSLY
TIG_OCEIH       ---------KWEKQEGNKGVLTFEVSAEEFEQALDQAFKKVSKDVQIPGFRKGKIPRGIFEKRFGVEALY
TIG_CORDI       ------MKSSVEKLSETRVKLNVEVPFEELKPEIDQAYKALAQQITIPGFRRGKAPRQLIDARIGRGAVL
TIG_STRS7       ------MSTSFENKATNRGVITFTISQDKIKPALDQAFNKIKKDLNAPGFRKGHMPRPVFNQRFGEEVLY
TIG_STRGC       -----------EKKETNRGVLTFTISQEQIKPELDRVFNSVKKTINVPGFRKGHLPRPVFNQKFGEEALY
TIG_CORGL       ------MKSSVEKLSDTRSKITVEVPFSELKPEIDQAYAALAQQVQIPGFRKGKAPRQLIDARFGRGAVL
TIG_CORGB       ------MKSSVEKLSDTRSKITVEVPFSELKPEIDQAYAALAQQVQIPGFRKGKAPRQLIDARFGRGAVL
TIG_COREF       ------MKSSVEQLSDTRVKITVEVPFEELKPELDQAYAALAQQVQIPGFRKGKAPRQLIDARFGRGPVL
TIG_BIFLO       ------MKISVRNLEPTKVKLTVTVEPEELNPYLDAARKEIAKQVNVPGFRKGHVPGKIIDQRIGFAAVA
TIG_BIFLD       ------MKISVRNLEPTKVKLTVTVEPEELNPYLDAARKEIAKQVNVPGFRKGHVPGKIIDQRIGFAAVA
TIG_RHOSR       ------MKSTVEQLSPTRVRINVEVPFEELKPDFDKAYKALAQQIRLPGFRPGKAPAKLLEARVGRGAVL
TIG_LEIXX       ------MKTTVEKLSPTRTKLTISVTPEELQPSIKHAYEHIAGQVNIPGFRKGKVPPAIIDQRVGKEAVL
TIG_BIFLI       ------MKISVRNLEPTKVKLTVTVEPEELNPYLDAARKEIAKQVNVPGFRKGHVPGKIIDQRIGFAAVA
TIG_ANOFW       ------MSAKWEKLEGNQGVLTVEVDAEKVNEGLDEAFKKVVKKVQIPGFRKGKIPRSLFEKRFGVESLY
TIG_STREM       ------MSTSFENKATNRGVITFTISQDKIKPALDQAFNKIKKDLNAPGFRKGHMPRPVFNQRFGEEVLY
TIG_CLOTE       ------MKVSMEKIENNVVKLEVTVEAKKFNEAMKKSYAKNVKKFNVPGFRKGKAPMSIIKRYYGETVFY
TIG_BDEBA       ------MKSNVEKVSNLSRKLNIEVPAAAVQTAFQKIFNGIQKEVTIKGFRKGKAPLATVKSLYG-DRVK
TIG_RHOOB       ------MKSTVEQLSPTRVRINVEVPFEELKPDFDKAYKALAQQIRLPGFRPGKAPAKLLEARVGRGAVL
TIG_PELCD       ------MNVKVEDISSIKKKLSFEISVEAVDTEFSNEYKKLSKTAKIPGFRKGKVPRSVLERQYAGH-VE
TIG_STRGG       ------MKSAVETLNPTRVRLSIEVPFEELKDSLDAAYKKINQQVTVKGFRKGKIPARVIDQRFGRGAVL
TIG_SALAI       ------MKSTVETLSPTRVRLAIEVPFVELEPSLKKAYREIGQQVQVPGFRRGKVPAVVIDQRVG----R
TIG_GEOSM       ------MQISVESVNSIKKKLNFEIPADKVSAEVDKAYAEIRKHAAIKGFRKGKVPMSLIEKHYG-EKMA
TIG_BACCR       ------MSTKWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACC4       ------MSTKWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_BACC2       ------MSTKWEKLEGNVGVLTIEVDAKEVNNSIDAAFKKVVKTINVPGFRKGKMPRPLFEQRFGIESLY
TIG_FRASC       -----------ETLSPTRVKLTVEVPFDELKPSLEATYRKLARQVRVSGFRPGKVPPRILDQRLGRGVIL
TIG_STRE4       ------MSTSFENKATNRGVITFTISQDKIKPALDQAFNKIKKDLNAPGFRKGHMPRPVFDQRFGEEVLY
TIG_CLOBA       ------MEAKVEKIETNVVKLEIKVEAEKFDAALTKAYNKNKGKYNVPGFRKGKVPMAILKKMYGIEIFY
TIG_CALS8       ------MEFKVEKKGTNKAXXXXXXXXXXXXXGLQKSYLKNAKYFKIPGFRPGKAPRSLIERAYGEEVFY
TIG_STRPC       LRRNDLMSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_CLOBL       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_CLOBK       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_CLOBH       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_CLOB6       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_CLOB1       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_FUSNN       ---------EVKKLEKSAVEVKLHLTAEEVKPIVDKVLAHVGEHAEVAGFRKGHAPKEVLMTNY-KDHIE
TIG_FRAAA       -----------ETLSPTRVKLTVEVPFDELKPSLDATYRKLARQVRVSGFRPGKVPPRILDQRLGRGVIL
TIG_LACPL       ---------KWEKKEGNQGELTFEIGADKISEGIDKAFQRTKKNLNVPGFRKGKVPRQIFNQMYGEEALY
TIG_MYXXD       ------MKVQVEELSPIEKKLSIEVDNARVAEELSRAYSNLGRQVRLPGFRQGKVPRRILEQRF-RDQVE
TIG_CLOBM       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_SACEN       ------MKSTVEHLSPTRVRINVEVPFDELKPNFDRAYKALAQQVRIPGFRPGKVPARVLESRIG----R
TIG_KOCRD       ------MKSAVEKLNPTEAKITIDIAYTDLKPFVQETYKELANQIQIPGFRKGKVPSKLIDQRVGFDFVV
TIG_CLOTH       ---------KVEKKDKNIVELEIEVEAAKFEEAVQKSYLKNSKKFTVPGFRKGKAPRSIIERYYGKEVFY
TIG_CLOBJ       ----------------------ITVDSEKFNEAVKKSFKKNAKRFNVPGFRKGKAPLNIIKKYYGEGVLF
TIG_DESAA       ------MQVTVEDLSSVKKVLHIEAPAEDVKKALDSAYAELKKQAKVKGFRPGKAPRSVLERLYKSD-VE
TIG_CLOPE       ------MEAKMNKIDTNVVELEIKVDAKDFNEALXXXXXXXXXXFNIPGFRKGKVPMNMVKKFYGVEVLF
TIG_CLOP1       ------MEAKMNKIDTNVVELEIKVDAKDFNEALXXXXXXXXXXFNIPGFRKGKVPMNMVKKFYGVEVLF
TIG2_DESHY      ----------LENIENSEARFRFTIDYKVFADALEKTYRKNKKNYQVAGFRKGNVPRSVIESQYGPTVFY
TIG_LISIN       ------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALY
TIG_STRPD       LRRNDLMSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRPM       LRRNDLMSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRPF       LRRNDLMSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_DESDG       ------MEYNVEDLSPVKKKITITVPVEEVNAALAATIAVYQTSVNLSGFRKGKVPASIIEGRFRKE-VY
TIG_STRPZ       ------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRPG       ------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRP8       ------MSTSFENKATNRGVITFTISQDKIKLALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRP6       ------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_STRP3       ------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_LISMH       ------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALY
TIG_DEHE1       -------------IEGCQASITVEMDPAEVEAGLSKTYRRLVKKVEIPGFRKGKTPRDVFEKYLGREKML
TIG_PEDPA       ---------KWEKTGTNEGKLTFEVGTDKIKEGVDKAFDRTKKQLNVPGFRKGHVPRQIFNKMYGEEALY
TIG_LISMO       ------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALF
TIG_LISMF       ------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALF
TIG_LISMC       ------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALF
TIG_AERHH       ------MQVSVETTQGLERRLTITVPAATVDAAVRKELNGLAKTRRIDGFRPGKAPVAIIKKMFGAMA-H
TIG_STRP1       ------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLY
TIG_CLOCE       -------------------QLEIEVDTAKFEEGMQQSYLKNVKKFNVPGFRKGKAPRNIIERYYGEQALY
TIG_STRAW       ------MKSAVETLNPTRVRLTVEVPFEELKDSLDAAYKKINQQVTVKGFRKGKIPARVIDQRFGRGAVL
TIG_STRA1       ------MSTSFENKATNRGIITFTISQDEIKPALDQAFNKVKKDLNVPGFRKGHMPRTVFNQKFGEEALY
TIG_LISW6       ------MSVKWEKQEGNVGKLTFDIEQEKVKEGLDRAFVKVRKTLNVPGFRKGKVPRQIFNQRFGEEALY
TIG_STRA5       ------MSTSFENKATNRGIITFTISQDEIKPALDQAFNKVKKDLNVPGFRKGHMPRTVFNQKFGEEALY
TIG_STRSV       -----------ENKETNRGLLTFSISQEKIKPALDRVFNSVKKDIAVPGFRKGRLPRAIFNQRFGEEALY
TIG_BIFA0       ------MKISVRNLEPTKAKLTITVDQDEFDPYLEDARKEIAEQITVPGFRKGHVPGKLVDQRVGFGAVA
TIG_PROAC       --------SSLEKLSTNRVKLTIEMPFDELKPSLDKAYKDIANQVNVPGFRKGKVPAPVIDQRFGRGVVL
TIG_DEIDV       --------------EGNKVEFKVAVPAAEVNRAYEQVWAGLARDVRVPGFRPGKAPRKVIEGRVGKGYVE
TIG_AERS4       ------MQVSVETTQGLERRLTITVPAATVDAAVRKELNGLAKTRRIDGFRPGKAPVAIIKKMFGAMA-H
TIG_STRU0       ------MSTSFENKATNRGVITFTIGQDKIKPALDQAFNKIKKDLNVPGFRKGHLPRPIFNQKFGEEVLY
TIG_STRA3       ------MSTSFENKATNRGIITFTISQDEIKPALDQAFNKVKKDLNVPGFRKGHMPRTVFNQKFGEEALY
TIG_GEOBB       ------MQISVESVNSIKKKLNFEIPADKVSAEVDKAYAEIRKHAAIKGFRKGKVPMSLIEKHYG-EKMA
TIG_GEOMG       ----------VESLSSVKKKISFEIPAERVSAEIEKVFGQIQKRAAIKGFRKGKVPRSLVEQNY-RSMME
TIG_ENTFA       ------MSAKWEKKGTNDGVLTFSIEQAVIEKGLTQAFNKVKKNLNVPGFRKGKVSRTVFNRMYGEEALY
TIG_DEHSB       -------------IEGCQASITVEMDSTEVEEGLSKTYRRLVKKVEIPGFRKGKAPRDVFEKYVSREKML
TIG_CORK4       ------MKSSVEQQSATRVKLTVEVPFDELQPEIDQAYRSLAQQVTLPGFRKGKVPPRVLEARLGRGAIL
TIG_DEHSC       -------------IEGCQASITVEMDSTEVEEGLSKTYRRLVKKVEIPGFRKGKAPRDVFEKYVSREKML
TIG_RUBXD       ----------VTKLEDNKVRLDVEVPPEAVREGVEAKLRELRKQVRVPGFRPGKAPRRVLETHLGRDYIY
TIG_GEOUR       ----------VESLSSIKKKINFEIPSERVASEVEKAYGEIRKHAAIKGFRKGKVPKDLLVKHF-SDKMA
TIG_STRCO       ------MKSAVETLNPTRVRLTVEVPFEELKDSLDAAYKKINQQVTVKGFRKGKIPARVIDQRFGRGAVL
TIG_BIFAA       ------MKISVRNLEPTKVKLTVTVDPEEFNPYLDEARKEIAKQVNVPGFRKGHVPGKIIDQRIGFGAVA
TIG_FRASN       -----------ETLSPTRVKLTVEVPFDELKPSVDATYRKLARQVRVSGFRPGKVPPRILDQRLGRGVIL
TIG_CLOD6       --------------EGNKVTLKITVDNNKFEAAVNKAYNKSRNKYNIPGFRKGKAPRIVIETQYGKGIFY
TIG_ACIC1       ------MKSAVETLSPTRVKFTVEVGFDELQPTVAAAYRKVAEQVRVPGFRPGKVPPPIIDRRIGRGVVL
TIG_THETN       ----------LKKIEKSVATLELTIPKEKFEEGLDYAFKKNASKFNVPGFRKGKAPRFLVERYYGEGVLY
TIG_MYCLE       ------MKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVPARLLEARFGRETLL
TIG_MYCLB       ------MKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARHVQLPGFRPGKVPARLLEARFGRETLL
TIG_ERYLH       ------MQTKETTNEGLKRAYKLTLTAKEIDAKIDAEVKKVAPQVRMPGFRPGKVPANLVRKMHG-EQMH
TIG_THEFY       ------MKTAVEELSPTRVKLTIEVPFEELDHAFDVTYKSLAKQVRIKGFRPGKAPAKLIDRYVGRGAVL
TIG_GEOLS       ------MQVKIEEISSVKRRISVEVPAERVNTEIEKSFAGIQKKATLAGFRKGKAPLQMVK-----KFYR
TIG_STRMU       ------MSTSFENKATNRGVVTFTISQDKIKPALDQAFNKVKKDLTAPGFRKGHMPRTVFNQKFGEEALY
TIG_CLOK5       ------MNVKMEKIEENVVKLEITVEADKFNESMXXXXXXXXXXXXIPGFRKGKAPMNIIKKYYGEGVFY
TIG_CLOK1       ------MNVKMEKIEENVVKLEITVEADKFNESMXXXXXXXXXXXXIPGFRKGKAPMNIIKKYYGEGVFY
TIG_DESPS       ------MDIKVEEVSKLTRKVIVTLPAGDVQPKIEAAYNKLKKEVKIKGFRRGKVPSAIIVKNY-KDQVE
TIG_ONYPE       ---------EIKKINDQKVQYFFEVSSKELETQLASAYEKIKPKVEIKGFRKGHVPRKIFENRFGKDNLY
TIG_THERP       ----------VEHLPQSTVRLDIAADPEEFDAALERAFRRISQQVQVPGFRPGRAPRALVERRVGRELIV
TIG_SYNS9       -MSAATLKVSTESRPSSRLAVTVTVPGERCTASYEEAIKSLSRSINLPGFRKGKVPRSVLVQQLGGVRIK
TIG_LACBA       ---------KWEKKDNNQGELTFEIAPDKIKEGLDKAFQRTKKNLAVPGFRKGRVPRQIFNQMYGEEALY
TIG_HERAR       --------TAVETLDKLERRITITVPVAEVQTEVEKRLKVRARTVKAPGFRAGKVPMKMVAQQYGYQ-IE
TIG_EXIS2       --------------------LTYEAPAEAFDKAVDQAFKKVVKTLNTPGFRKGKMPRAMFNKMYGEEALY
TIG_CHRSD       ------MQVSVESTSQIERRVTVQVPAAEVDQAVATRLQETAKNVRLNGFRRGKIPLTVVRQRFGRE-VR
TIG_THEPX       ----------LKKLEKSVATIELTIPSEKFEEGLNFAFKKNASKFNVPGFRRGKAPRVIVERYYGEGVLY
TIG_THEP3       ----------LKKLEKSVATIELTIPSEKFEEGLNFAFKKNASKFNVPGFRRGKAPRVIVERYYGEGVLY
TIG_ALHEH       ------MQVSVETTEGLGRRMTVQVPAEQVEEKVDQRLRSLRGNVRMDGFRPGKVPLKVVRKRYGPQ-VR
TIG_KINRD       ------MKSDVETLNPTRVKFTVEVGYDELKPSLDKAYKTIAGQVQVPGFRKGKVPPRVIDQRFGRAAVL
TIG_VIBCM       ------MQVTVETLEGLQRRLNITVPAANIEDAVAAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_VIBCH       ------MQVTVETLEGLQRRLNITVPAANIEDAVAAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_VIBC3       ------MQVTVETLEGLQRRLNITVPAANIEDAVAAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_SYNFM       ------MNVSVVDLSENQKKLQVEIPPEKVRQEIEGKYREMSRRIKIKGFRPGKVPRSIIKSYYG-KTIE
TIG_SACD2       ------MQVSLETTTGLERKLTVGIPASVVDQEVAKRLKEAAKTVRINGFRKGKVPMSVVQQRYGA-GVR
TIG_RHOPT       ------MQVKETVADGLKREFQVNVPAADIDAKIDEKLADLKDKVRLNGFRPGKVPTAHLKRVYG-RSVA
TIG_DESVV       ------------------------------DAALGAAIAMYRTSVNLDGFRKGKVPASIVENRFRKE-IY
TIG_ANAVT       ----------------------------------QKTYKNLSRTVNIPGFRKGKVPRQVLLQRLGKTHIK
TIG_TREDE       -------EKNVTLKEKSHAELSVKIKKSDVQESYKKLLNKYSKELQIPGFRKGKVPVSVLETKYG-DAIK
TIG_LACSS       ------MSAKWEKKGANDGELTFEIDLDKISEGLDVAFKRVRKNINTPGFRKGKMPRQIFNKMYGEEALY
TIG_LACCB       ------MSAKWEKKGTNDGELTFEIDLPQIQQGLDQAFQRVRKNLTVPGFRKGKVSRTVFKRMYGDAALY
TIG_LACC3       ------MSAKWEKKGTNDGELTFEIDLPQIQQGLDQAFQRVRKNLTVPGFRKGKVSRTVFKRMYGDAALY
TIG_THICR       -------------------KINVTLPAGDLDSKVEQRLAQMRRTVKMDGFRPGKVPMSVVKKRYGGQ-VR
TIG_PSEHT       ------MQVSVETTQGLERRLTITVPAENVENEVKKRLQQLSKTQRIDGFRAGKVPASVINKRFGP-AVR
TIG_MARAV       ------MQVSVETTSNIERRMTIGVPAQEIDQAVQKRLQETARTVRLNGFRPGKVPMSVVKRRFG-DSIR
TIG_AZOC5       -------ETQAEGL---KRAYTVVLPAAELDAKAQDRLVELKDKVRINGFRPGKVPLSHLKSLYG-KSVM
TIG_ANASP       ----------------------------------QKTYKNLSRTVNIPGFRKGKVPRQVLLQRLGKTHIK
TIG_DESVH       ------------------------------DAALGAAIAMYRTSVNLDGFRKGKVPASIVENRFRKE-IY
TIG_DESDA       ------MEYSAEDISPVRKKVVITTEPQEVEASIMGTIALYKTSVQVDGFRKGKVPASVIEQRF-RDKIY
TIG_ZYMMO       ------VETLNEGLKRN---YTLTITADEIRKRIDQEVAEAAPRVNLPGFRPGKVPAKLVNKMYGASLAQ
TIG_PELPD       ------MQVNVETISPVSKKVSIEIPADQVNSEIEKTYATIQKRAKIQGFRPGKAPLQLIKRTY-ADSMR
TIG_ALCBS       ------MQVSVETTSGLERRVTVGVPAEKVDVAVEGKLQEAQKTIRLDGFRPGKVPMREVKRRFGG-AVR
TIG_RHOPB       ------MQVKETVADGLKREFEVTLQAADIGAKVAARLDDMKDKVRLNGFRPGKVPKRIYGRSVTAETVE
TIG_NOVAD       ------VETTNEGL---KRAYTVTIPAADIAARVEGEIKKIAPQVRMPGFRPGKVPANLVRKALHQEALQ
TIG_THISH       ------MQVSVETVSNLQRRMTVQVPSERIEQEVDRRLKSLARRVKIDGFRPGKVPLKVVQQRYGA-GVF
TIG_SYNJA       ----------------SRVGLKIVVEADQVKRSYEKTLRQLERNIQIPGFRKGKAPRNLVIRQVGRERVM
TIG_VIBSL       ------MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_SYNSC       -MSAAALKVTTEARPSSRLAVTVTVPGE----RCKTSYEDLSRSINLPGFRKGKVPRTVLVQQLGGVRIK
TIG_ROSS1       -------------------ELTVELDKQQIEKALDRAARRMSQKYNIPGFRKGKAPRFIVENYFGREALL
TIG_SYNJB       ----------------SRVGLKIVVEADRVKRSYEKTLRQLEQNIQIPGFRKGKAPRNLVVRQVGRERIL
TIG_RENSM       ------MKSAVENLSPTRVKLDVEVPFEELQPSIAEAYKTIAEQVQIPGFRKGKFPNRLIDQRVGRGYVL
TIG_LARHH       ------MQVQLETLGNLERRLDIALPLTDIDAEVQKRLARVARTAKIAGFRPGKAPLKMVERNYGA-SVR
TIG_DICNV       ------MESSIEKLEGLAHKLTVEIPAGDIDQAVTQRLKSLRPRLRIDGFRPGKVPPHIIKQRYGISA-R
TIG_THEYD       ----------IEEISATKKRLKIEIPADIVEGEIQKALKEIQKKAKIPGFRPGKAPISIIEKKFGKEA-E
TIG_CHRVO       ------MQVQLETLSNLERRMNIALPMAAIETQVAERLKRVARGAKIQGFRPGKAPLKIVEMNYGAQVRE
TIG_STRSY       -----------EAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGFRKGHLPRAVFNQKFGEEALY
TIG_STRS2       -----------EAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGFRKGHLPRAVFNQKFGEEALY
TIG_JANMA       --------TAVETLDKLERRITITVPLADVQAEVEKRLKVRARTVKAPGFRTGKVPMKMVAQQYGYQ-VE
TIG_DESOH       -------------------EIPVEVVSRELNAQIRKTAK-------IKGFRPGKAPMSMLKR-LYKDQVH
TIG_PSEU5       ------MQVSVESTSALERRMTIGVPVERIETEVNKRLQQTASRAKIPGFRPGKVPMSVIRQRY-EEAAR
TIG_NITOC       ------MQVTVEATGELERRLTITLPGSDFESKVQERLRSMVPRIKMDGFRPGKVPYKVVERRYGS-AVR
TIG_LACAC       -------------------ELTFDISKDEIKLGLDQAFKRIKKNLRVPGFRKGHVSRVIFDQYYGEEALY
TIG_IDILO       ------MQVSVETTQGLERRVTVTVPADTIDSEVKRLLKEEYRHRRVNGFRKGKIPPNVLQKLFGREA-R
TIG_CLAMS       ------MKTTVEKLSPTRVKLAISATPEDLKPHIDHAYGHIAEQVAIPGFRKGKVPPPIIDQRVGREAVL
TIG_BEUC1       ------MKSAVENLEPTRVKLTVEVAFDELKASLDHAYQHIAQQVNVPGFRKGKVPPRVIDQRVGRAAVV
TIG_PSEPF       ------MQVSVENTTALERRMSITVPAERIETQVNKRLQQTAQKAKIAGFRPGKVPMSEIKRRFGADA-R
TIG_LACLS       -----------EKTSDTKGTLSFSIDQETIKTGLDKAFNKVKANISVPGFRKGKISRQMFNKMYGEEALF
TIG_THET2       -------------------KVRVEVPADRVKASYEALLKDLASRVRVPGFRPGKAPLKVVEARLGREALL
TIG_MAGSM       --------------------ITITVAAEKVDALLSQEMTKTAAQVRLPGFRAGKVPTKMIEQRFGA-SIR
TIG_LACLM       -----------EKTSDTKGTLSFSIDQETIKTGLDKAFNKVKANISVPGFRKGKISRQMFNKMYGEEALF
TIG_ECOSE       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO24       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_CLAM3       ------MKTTVEKLSPTRVKLAISATPEDLKPHIDHAYGHIAEQVAIPGFRKGKVPPPIIDQRVGREAVL
TIG_VIBVU       ------MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_RHOCS       -------ETSADGL---RREFKVTVPADEIETRVANRLSEIGKTIKIPGFRPGKVPMALLKQRYG-QSVM
TIG_COXB2       --------SSIEKLGGLKQRLTITVPAEEVDKAYKSRLLKVARTAKIPKFRPGKASPAVVEKLYG-KAIL
TIG_COXB1       --------SSIEKLGGLKQRLTITVSAEEVDKAYKSRLLKVARTAKIPKFRPGKASPAVVEKLYG-KAIL
TIG_SHISS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SHIFL       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SHIF8       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SHIDS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_NOSP7       ----------------------------------KQTYKNLASTANIPGFRRGKVPRPILLQRLGTTRIK
TIG_MANSM       --------TTIETTQGLERRVSITVPAETVTTAVRDELKRVAKNARVDGFRKGKVPAQIIEKRFGASVRQ
TIG_LACLA       -----------EKTSDTKGTLSFSIDQETIKTGLDKAFNKVKANISVPGFRKGKISRQMFNKMYGEEALF
TIG_LACF3       --------------------LTFDIDTETIQKGIDHAFTRTQKRISVPGFRKGHVPRTIFNQMYGEESLY
TIG_ECOUT       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOSM       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOLU       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOLI       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOLC       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOK1       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOHS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECODH       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOBW       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO8A       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO81       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO7I       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO5E       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO57       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO55       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO45       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECO27       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_DELAS       ----------VETLEKLERKITLSLPLNSIQSEVENRLKQVARTVKMDGFRPGKVPMSVVAQRYG-YSVQ
TIG_CELJU       ------MQVSLETTSGLERRLTVGVPAEQVENEVENRLKQAARNVTIKGFRKGKVPLSVVKQRFGA-GIR
TIG_BORPD       ----------VETLSGLERRVDLAVSVADVEKEVQAQLKRVARTAKVPGFRPGKAPLAMLERSHG-PGIR
TIG_ACIAC       ----------VETLEKLERKITLSLPLTAIQSEVDSRLKRLARTVKMDGFRPGKVPMNVVAQRYGY-SVQ
TIG_NEIG1       ----------VEILENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_PELUB       ------MKVTVENKKGLNKDIKVFIDKETMNSYMDEKYEEIKKTVNLKGFRPGKVPKEVLKRQFG-QAIF
TIG_HALHL       ------MQVSVETTEGLGRRMTVQVPAERVENEVERRLKDLSGRVKMDGFXXXXXXXXXXXXQYGAQ-VR
TIG_DESAD       ------MDFNIEEVSAVEREIKVSVPAEEVGAALDATVALYKVQTPVKGFRKGKVPASVIQSKYKKQIIN
TIG_BORA1       ----------VETLSGLERRVDLAISVADVEKEVQAQLKRVARTAKVPGFRPGKAPMAMLERSHG-PSVR
TIG_SHEAM       ------MQVSVETTQGLERRLTISVPAEQIEKLVNESLKREAKRARIPGFRPGKVPMSVVSKRYGA-AIR
TIG_SALPC       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALCH       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_RHOPA       ------MQVKETVADGLKREFQVNVPAADIDAKIDEKLADLKDKVRLNGFRPGKVPTAHLKRVYG-RSVA
TIG_PSEF5       ------MQVSVENTSALERRMSITVPAERIESQVNKRLQQTAQKAKIPGFRPGKVPMSVIRQRYEADA-R
TIG_DESAH       ------MQLNIEEKSSVKKVLHIEIPKEDVAKELDTAYNELKKTATVKGFRKGKIPRKILETRFSKD-VH
TIG_MESSB       -----------------KREIKITVPAEDMEARLMARLEDAKNKVRLKGFRPGKVPLQHLRRMYG-KSFM
TIG_FRATN       ------MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_ECOL6       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ECOL5       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_COXBU       --------SSIEKLGGLKQRLTITVPAEEVDKAYKSRLLKVARTAKIPKFRPGKASPAVVEKLYG-KAIL
TIG_SHIBS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SHELP       ------MQVSVETTQGLERRLTISVPAEQIEKAVSDSLKNEAKRARIPGFRPGKVPVSVINKRYG-KAIR
TIG_SHIB3       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_RHOP5       ------MQVKETVTDGLKREFQVTLAVSDIGSQVDARLDELKDKVRLNGFRPGKVPLSHLKRTYG-RSVT
TIG_NEIG2       ----------VEILENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_MICAN       -----------EKLPASQIGLEIEIPAETTKNTHEQVVKNLAKSVNIPGFRPGKVPRQILLQRLGTKAVK
TIG_HAEDU       ----------IETLEGLQRRVTLTVNANKIEAAYKEQLKDYAKNAHVDGFRKGKVPRSIIEQRFGL-AAR
TIG_ESCF3       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_CYAP8       -----------EKLPDSQIGLEIEISAEASKKAYETKVNTLARTANIPGFRKGKVPRQILLQRIGTEYIK
TIG_ACTP2       ----------IETLEGLQRRVTITVAADKIEAAYKEQLKGYAKNARVDGFRKGKVPHAIIEQRFGLAARQ
TIG_VEREI       ----------VETLDKLERKMTLSLPVTLIQSEVDMRLRRMARTVKMDGFRPGKVPMAVVARRYG-DAVQ
TIG_SYNE7       ------IKVTQEKLPASRVGLQIEVSGEQSRQVYERTLTRLSREVRFPGFRPGKVPRPVLIQRLGETALK
TIG_RHOFD       ----------VETLEKLERKMTLTLPVGIVESEVQSRLKKLARTIKMDGFRPGKVPMNVVSQRYG-YSVH
TIG_OPITP       ------MNVQLNSLSDTRKSLVVSLEASEVDAAHQEVVAEFARQARIPGFRPGKAPAAII-----AKRFA
TIG_LACGA       -------------------ELTFEISQEEVKKGLDQAFKRVKKNLRVPGFRKGHVSRVVFDQFYGEEALY
TIG_ACTSZ       ----------IETTQGLERRVSITIPADEVETAVREQLKGFAKNARVDGFRKGKVPHHIIAQRFGSSARS
TIG_ENT38       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_AZOBR       -------ETSADGL---KREYKVVISAQDIEQKVQGRLEELRRTVQLPGFRPGKVPVAVIKQRYGG-SVL
TIG_SYNP6       ------IKVTQEKLPASRVGLQIEVSGEQSRQVYERTLTRLSREVRFPGFRPGKVPRPVLIQRLGETALK
TIG_SHEHH       ------MQVSVETTQGLERRLTISVPAEQIENTVKEALKSEAKRARIPGFRPGKVPVSVINKRYG-NAIR
TIG_SALTY       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALTI       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALNS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALHS       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ROSDO       ----------------------IKVTAAELDAKVNEKLAEAQPEVEMKGFRKGKVPMALLKKQFG-QKVM
TIG_CITK8       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_ANADE       ------MKIQVETVSPVERKVTIEVDPDRVAKELDRAYASLSRRVKLRGFRPGKAPRKVLERQFKAE-VE
TIG_SALSV       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALPK       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALPB       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALPA       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALG2       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALEP       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALDC       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_SALA4       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_PECCP       ------MQVSVETTQGLGRRVTITVAADIIESAVKSELVNAAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_NEIMB       ----------VETLENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_BURVG       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURCM       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYSGQVEA
TIG_ARTAT       ------MKSAVENLTATRVKLNVEVPFEELKPSIDAAYKTVASQIQVPGFRKGKVPSKLIDQRVGRGYVL
TIG_SERP5       ------MQVSVETTQGLGRRLSITVPADTIKQAIKKELINAAKSVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_SALAR       ------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_ENTS8       ------MQVSVETTQGLGRRVTITIAADSIENAVKSELVNVAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_VIBHB       ------MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGFRKGKVPLKMVAKMYG-KAVR
TIG_SILST       ----------------------ITIPATELEEKVNAKLAEAQPEIEMKGFRKGKVPMPLLKKQFGARLM-
TIG_PSYWF       MAKDLQVTTS--KVNDNQTQLTVKVPVEQIQNKVEGRIRNVAKTAKIDGFRKGKVPVSHIRAQYGA-GIQ
TIG_DESMR       ------MEYTVNQLSPVKTQVTVXXXXXXXXXXXXXXXXMFRSRTDLKGFRKGKVPSSVVEQRFKKEIV-
TIG_BURCC       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKTVRIPGFRPGKVPLKMVAQQYAGQ-VE
TIG_ACTPJ       ----------IETLEGLQRRVTITVAADKIEAAYKEQLKGYAKNARVDGFRKGKVPHAIIEQRFGLAARQ
TIG_ACTP7       ----------IETLEGLQRRVTITVAADKIEAAYKEQLKGYAKNARVDGFRKGKVPHAIIEQRFGLAARQ
TIG_SYNPX       -MSAAALKVTTESRPGSRLAVTVTVPAE----RTKTSYEDAINSLNLPGFRKGKVPRTVVIQQLGAVRIK
TIG_SPHAL       ------VETLNEGL---KREYRVTITAKDIDARVDEEVKSIAPTVRMPGFRPGKVPPNLIRKMHGAALSA
TIG_PSEAE       ------MQVSVESTSALERRMTVGVPAERIETEVNKRLQQTARRAKIPGFRPGKVPMSVIRQRYEASA-R
TIG_PSEAB       ------MQVSVESTSALERRMTVGVPAERIETEVNKRLQQTARRAKIPGFRPGKVPMSVIRQRYEASA-R
TIG_PSEA8       ------MQVSVESTSALERRMTVGVPAERIETEVNKRLQQTARRAKIPGFRPGKVPMSVIRQRYEASA-R
TIG_NITMU       ------MQTNVENLGALERRLNVSVPQEKIETEVESRLKRLARTAKFHGFRPGKVPLKIVAQQYGPQ-VR
TIG_NITHX       -------ETLAEGL---RHEFQISIPAAEITAKADARLVDLKDKVKLDGFRPGKVPVSHLKKMYGRSVMI
TIG_LACH4       -------------------ELTFDISKDEIKLGLDQAFRRVKKNLHVPGFRKGHVSRVIFDQYYGEEALY
TIG_FRAP2       ------MQVTVEKKEGIHCSLLIEVPANEVDSIVTKEINKTAKTIKMDGFRPGKVPAGMVEKKYG-EQIR
TIG_BURCH       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKTVRMPGFRPGKVPLKMVAQQYAGQ-VE
TIG_BURCA       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKTVRMPGFRPGKVPLKMVAQQYAGQ-VE
TIG_BURA4       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYSGQVEA
TIG_VIBVY       ------MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-KAVR
TIG_MAGSA       --------TEINA-EGLKREFKVVVPAQQLETRMQDKLAEIARTVAMPGFRPGKVPMTIVRKKYGG-AVM
TIG_HAES2       ----------IETTQGLERRVNITVPSEAVEQAVREELKRVAKNARIDGFRKGKVPAQMIEKRFGA-SVR
TIG_HAES1       ----------IETTQGLERRVNITVPSEAVEQAVREELKRVAKNARIDGFRKGKVPAQMIEKRFGA-SVR
TIG_PSE14       ------MQVSVENTSALERRMTIGVPAERIETEVNKRLQQTARKAKIPGFRPGKVPMSVIRQRY-EDGAR
TIG_NITSB       ------MEINAQKLNEANATVEAKIAKQDVXXXXXXXXXXXXXTMNIPGFRKGKVPPAVIKKRYG-DKLA
TIG_NEIMA       ----------VETLENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_NEIM0       ----------VETLENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_TERTT       ------MQVSIETTSGLERRLTVGIPAEIIDQEVEKRLKQAAKTVRINGFRKGKVPFKVVKQRFG-EGVR
TIG_SHESW       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_SHESR       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_SHESM       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_SHEPC       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_PSEU2       ------MQVSVENTSALERRMTIGVPAERIETEVNKRLQQTARKAKIPGFRPGKVPMSVIRQRY-EDGAR
TIG_PSEA7       ------MQVSVESTSALERRMTVGVPAERIETEVNKRLQQTARRAKIPGFRPGKVPMSVIRQRYEASA-R
TIG_ERWT9       ------MQVSVETTQGLGRRVTITVDKDVIENAVKSELVSVAKKVRIDGFRKGKVPMTVVAQRYGA-SVR
TIG_BORBU       ----------IKLLPGSKVEVVIRVSKNVIQEKYNSLLQDYSSRLKIQGFRIGKVPINVIENKY-SEGLK
TIG_BARBK       --------------EGLKREIQVMVPMKDLEAKLNERLDDTKGKIKLNGFRPGKVPSSYLRKMYG-KSFM
TIG_AZOSB       MQTTQEIQTSQNPLE---RRIDMSLAVADIDKAVEARLKQMARSVKMPGFRPGKVPLKIVEQTYGPQA-R
TIG_ARTCA       ------MKSAVENLTPTRVKLNVEVPFEELKPSIDSAYKTVASQIQVPGFRKGKVPAKLIDQRVGRGYVL
TIG_PSESM       ------MQVSVENTSALERRMTIGVPAERIETEVNKRLQQTARKAKIPGFRPGKVPMSVIRQRY-EDGAR
TIG_PASMU       ----------IETTQGLERRVQITVPADTVEGAVREELKRVAKTARVDGFRKGKVPPHIIEKRFGA-SVR
TIG_KLEP3       ------MQVSVETTQGLGRRVTITIAADSIENAVKSELVNVAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_HAHCH       ------MQVSLESTSSIERRMTIGVPATQVNSEVEKRLQKTARTVRMNGFRPGKVPMSVVKKRYG-EGVR
TIG_HAEPS       ----------IETLEGLQRRVTVTVAADKIEAGYKEQLKGYAKNARVDGFRKGKVPHSIIEQRYGLAARQ
TIG_AKKM8       ------MEINVDIQPDCTATLKASIPAETTAARRASIVDSYAAKAKLPGFRPGKTPKSIIEKRFKKE-ME
TIG_ACIBL       --------------------VTVEIPSDVVDAERNKHVQQYAKLARVPGFRKGKVPPSVIRTRF-AQDIN
TIG_STRT2       ----------------NRGVVTFTIGQDKIQPALDQAFNKIKKNLNVPGFRKGHIPRAVFNQKFGEEALY
TIG_STRT1       ----------------NRGVVTFTIGQDKIQPALDQAFNKIKKNLNVPGFRKGHIPRAVFNQKFGEEALY
TIG_SHESH       ------MQVSVETTQGLERRLTISVPAEQIEKAVTDSLKNEAKRARIPGFRPGKVPVSVINKRYG-KAIR
TIG_RHOPS       ------MQVKETVADGLKREFEVNVPAADIDAQVDARLVDLKDKVKLNGFRPGKVPVSHLKRVYG-RSVA
TIG_POLNA       ----------VENLEKLERKMTLTLPLNTIQSEVATRLKKLARTVKMDGFRPGKVPMSVVSQRY-AYSVH
TIG_METFK       ------MQATVETISNLERRMTVSVPVQPLESEVNERINRLARTVKMPGFRPGKVPLNIVRQQYGAQ-VR
TIG_HERA2       ------MKVTTEQLPKRIVALEIEPDAATIEKELNKAAQRIASKVAIPGFRKGKAPRFIVENYYGKAAIL
TIG_FRATT       ------MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_FRAT1       ------MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_VIBPA       ------MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGFRKGKVPLKMVAKMYG-KAVR
TIG_STRTD       ----------------NRGVVTFTIGQDKIQPALDQAFNKVKKNLNVPGFRKGHIPRAVFNQKFGEEALY
TIG_SHESA       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_SHEPA       ------MQVSVETTQGLERRLTISVPAEQIENTVKEALKSEAKRARIPGFRPGKVPVSVINKRYGS-AIR
TIG_SHEB9       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPITVINKRYGA-AIR
TIG_SHEB8       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPITVINKRYGA-AIR
TIG_SHEB5       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPITVINKRYGA-AIR
TIG_SHEB2       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPITVINKRYGA-AIR
TIG_RICBR       --------------------IKISTPLSEIDNDIQKELVDLTKKVKIAGFRAGKVPIAIVEKKYGA-SVR
TIG_RICB8       --------------------IKISTPLSEIDNDIQKELVDLTKKVKIAGFRAGKVPIAIVEKKYGA-SVR
TIG_POLSJ       ----------VETLEKLERKMTLTLPLNTIQSEVDTRLKRLARTVKMDGFRPGKVPMNVVAQRYG-YSVH
TIG_METS4       -------ETKSEGL---KREFQVVLAAAELEDRLTTELAGMKDKVQLKGFRPGKVPVAHLRRVYG-RSIM
TIG_DIAST       ----------VETLEKLERKITLSLPLTTIQTEVDARLKRLARTVKMDGFRPGKVPMSVVAQRYG-YSVQ
TIG_CUPTR       ----------IENLGKLDRKVTLAIPKAEVEKEKQERLVRLSKTVKMSGFRPGKVPMKMVEKQYGQQVEF
TIG_BURCJ       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYSGQVEA
TIG_ACISJ       ----------VETLEKLERKITLSLPLTTIQTEVDARLKRLARTVKMDGFRPGKVPMSVVAQRYG-YSVQ
TIG_THET8       -------------------KVRVEVPADRVKASYEALLKDLASRVRVPGFRPGKAPLKVVEARLGREALL
TIG_KLEP7       ------MQVSVETTQGLGRRVTITIAADSIENAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA-SVR
TIG_HYPNA       -------QTKAEGLSRTAVKVPVSELQAKLDARIEEIRPQMRLK----GFRPGKVPAAHVRKMYGRDLM-
TIG_FRATW       ------MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_SOLUE       -------------VEGCKHSLEISIPAAEVETETNRVVLDVQKRAKLPGFRPGKSPASIIRKQFAGD-IR
TIG_SHEWM       ------MQVSVETTQGLERRLTISVPAEQIEKAVNDSLKNEAKRARIPGFRPGKVPVSVINKRYG-KAIR
TIG_NEIMF       ----------VETLENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGFRPGKAPLKMIAQMYGASAQN
TIG_HAEI8       ----------IETTQGLERRVAITVPTEIVSKAVREEFKRAAKNVRVDGFRKGHVPAHIIEQRFGA-SIR
TIG_ERWCT       ------MQVSVETTQGLGRRVTITVAADIIESAVKSELVNAAKKVRIDGFRKGKVPMNVVAQRYGA-SVR
TIG_BURM1       ----------VENLGKLERRVTISLPKETVQKEIDARIQKLAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_METPP       ----------VETLEKLERRITLILSADTIKNEVEMRLKRLAKTVKADGFRPGKVPMSVVAQRYGY-SVQ
TIG_HAEIN       ----------IETTQGLERRVAITVPTEIVSKAVREEFKRAAKNVRVDGFRKGHVPAHIIEQRFGA-SIR
TIG_HAEIE       ----------IETTQGLERRVAITVPTEIVSKAVREEFKRAAKNVRVDGFRKGHVPAHIIEQRFGA-SIR
TIG_FRATM       ------MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_AGRRK       ------IETLAEGL---KREIKVVISAKDMEGRMNERLAEVKDKVRINGFRPGKVPVSHLKKVYG-KSIM
TIG_XANP2       ------------------------------------------------GFRPGKVPVAHLKRVYG-KSVM
TIG_HAEIG       ----------IETTQGLERRVAITVPTEIVSKAIHEEFKRAAKNVRVDGFRKGHVPAHIIEQRFGA-SIR
TIG_FRATH       ------MQVTLEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_BORPA       ----------VETLSGLERRVDLAVSVAEVEKEVQAQLKRVGRTAKVAGFRPGKAPLAMLERSHGP-GIR
TIG_BORBR       ----------VETLSGLERRVDLAVSVAEVEKEVQAQLKRVGRTAKVAGFRPGKAPLAMLERSHGP-GIR
TIG_ANADF       ------MKIQVENVSPVERKVSIEVDPDRVAQELERAYAGLGRRVKLRGFRPGKAPRKVLERQFRAE-VE
TIG_RHIEC       ------IETLAEGL---KREIKVVIPAKDMEDKMNERLADVKDKIRINGFRPGKVPAAHLKKVYG-KSIM
TIG_PSEMY       ------MQVSVESTSALERRMTVGVPVERIETEVNKRLQQTARRAKVPGFRPGKVPMSVIRQRY-EDAAR
TIG_BURS3       ----------VENLGKLERRVTISLPKKEIDARIQK----LAKTVRMPGFRPGKVPVKMVAQQYAGQVEA
TIG_PSEE4       ------MQVSVENTTALERRMTIAVPAERVEKEVEKRLQQTARRAKVAGFRPGKVPMSVIRQRFEGDA-R
TIG_PHOPR       ------MQVTVETTEGLERHLTITVPAANIENAVTAELKKIAKNRRFDGFRPGKAPMKMVARMFGG-SVR
TIG_SHEON       ------MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA-AIR
TIG_PSEPW       ------MQVSVENTSALERRMTIAVPAERVENEVNKRLQQTAKRAKVAGFRPGKVPMSVIRQRFEADA-R
TIG_PSEPG       ------MQVSVENTSALERRMTIAVPAERVENEVNKRLQQTAKRAKIAGFRPGKVPMNVIRQRFEADA-R
TIG_PROMH       ------MQVSVETTQGLGRRVTITVPAADIQKAVDSELKKAAKTVRIDGFRKGHVPMSMVKQRYGM-SVL
TIG_PARDP       -----------------------TLPAADLAAQVDAKLKEAQPEVEMKGFRKGKVPMALLKKQFG-QRIM
TIG_BRASO       ------------------------------------------------GFRPGKVPKKIYGKSVMAETID
TIG_BORPE       ----------VETLSGLERRVDLAVSVAEVEKEVQAQLKRVGRTAKVAGFRPGKAPLAMLERSHGP-GIR
TIG_TOLAT       ------MQVSVETTQGLERRLTITVPADKIEKEYNSRLNQVAKTRRIDGFRPGKAPKALIQKMYG-ESIV
TIG_SILPO       ----------------------IVVSAAELDAKVNEKLVEAQPEIEMKGFRKGKVPMALLKKQFGGEAMQ
TIG_PSEFS       ------MQVSVENTTALERRLSITVPAERIETAVNKRLQQTAQKAKIAGFRPGKVPMSEIKRRFGADA-R
TIG_LEUCK       --------------QKNQGTLEFEISRAQVEEGLEKAFQRNKNQVSIPGFRKGKVTKALFFSKFGEEALY
TIG_FRATO       ------MQVTLEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_FRATF       ------MQVTLEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYG-EQIR
TIG_CAUCR       ----------------------VTVPASELATRLEARIAEVAPQMNVKGFRPGKVPTAHVRRLYG-KALM
TIG_CAUCN       ----------------------VTVPASELATRLEARIAEVAPQMNVKGFRPGKVPTAHVRRLYG-KALM
TIG_BURPS       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURP6       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURP1       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURP0       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURMS       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURMA       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURM9       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_BURM7       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_VIBFM       ------MQVTVETKEGLERVLTITVPAANIEDAVSAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-QAVR
TIG_PSYCK       ------LQVTTNKLSNKETQLTVKVPVEKIQNKVEGRIRQVAKTAKIDGFRKGNVPMSHIRSQYGA-GIQ
TIG_PSYA2       ------LQVTTNKLSNKETQLTVKVPVEKIQNKVEGRIRQVAKTAKIDGFRKGNVPMSHIRSQYGA-GIQ
TIG_PSEPK       ------MQVSVENTSALERRMTIAVPAERVENEVNKRLQQTAKRAKIAGFRPGKVPMTVIRQRFEADA-R
TIG_PSEP1       ------MQVSVENTSALERRMTIAVPAERVENEVNKRLQQTAKRAKIAGFRPGKVPMTVIRQRFEADA-R
TIG_BORAP       ----------IRLLPGSKVEAVIRVSKNIIQEKYNSLLQDYSSRLKIQGFRIGKVPISIIEKKY-SEGLR
TIG_VIBF1       ------MQVTVETKEGLERVLTITVPAANIEDAVSAELRNIAKNRRFDGFRKGKVPMKMVAKMYG-QAVR
TIG_RHIE6       ------IETLAEGL---KREIKVVIPAKDMEDKMNERLADVKDKIRINGFRPGKVPAAHLKKVYG-KSIM
TIG_RALEH       ----------IENLGKLDRKVTLAIPKAEVEKEKQERLVRLSKTVKMSGFRPGKVPMKMVEKQYGQQVEF
TIG_PARL1       -----------------KRELKVQVPSQELEAKLGAKLDEMKNQVRLKGFRPGKVPVSHLRKTFGKQ-VM
TIG_METSB       ----------------------VVLPATDLATRLDSQLAEMRAKARINGFRPGKVPVAHLKRLYG-RSIM
TIG_COLP3       ------MQVSVETTQGLERRLTISVPAEKVDVEVKNRLRQISKTQRINGFRPGKVPPSVVQKRFG-KSVR
TIG_BART1       --------------EGLKREIKIVVPAKDLEEKLNERLDDTKGKVRLNGFRPGKVPGGHLRKMYG-KSFM
TIG_BARQU       --------------EGLKREIKIVVPAKALEEKLNEWLDDTKDKIKLNGFRPGKVPAEYLRKMYG-KSFM
TIG_SHEDO       ------MQVSVETTEGLGRRLTISVPAEQIEKMVKDGITREAKRARLPGFRPGKVPLSEINKRYG-QAIR
TIG_PSYIN       ------MQVSVESTQGLERKLTVTIAAEAFDKEYNSRVHHLAKTQRVDGFRPGKVPTSVVTKRFGA-GIF
TIG_BURP8       ----------VENLGKLERRVTISLPKDAVQKEVDSRIRQLAKNVRMPGFRPGKVPLKMVTQQYAGQVEA
TIG_AZOVD       ------MQVSVESTSALERRLTIGVPAERIETEVNKRLQQTARRAKIPGFRPGKVPMSVIRQRY-EESAR
TIG_SODGM       ------MQVSVETTEGLGRRVNITVAADTIEQAVKSELVNVAKKVCIDGFRKGKVPMNIVAQRYGA-SVR
TIG_PROMM       -MSATALQVKTTQKPNSRLAVEVAVPAERCQANYEAAVTRLSRTTNLPGFRKGKVPRAVLLQQIGPVRIR
TIG_NITWN       -------ETLAEGL---RHEFQVSIPAAEIAAKADERLDDLKDKVKINGFRPGKVPVSHLKKLYGRSVMV
TIG_ARTS2       ------MKSAVENLTPTRVKLNVEVPFEELKPSIDEAYKTVASQIQVPGFRKGKVPAKLIDQRVGRGYVL
TIG_RHOS4       -------ETQKEGL---KRAYTITVTAAELDAKVQEKLVEAQPDIEMKGFRKGKVPLAMLKKQFGPRLL-
TIG_RHOS1       -------ETQKEGL---KRAYTITVTAAELDAKVQEKLVEAQPDIEMKGFRKGKVPLAMLKKQFGPRLL-
TIG_BORGA       ----------IKLLPGSKVEVLIRVSKNIIQEKYKSLLQDYSSRLKIQGFRIGKVPINIIENKY-SEGLK
TIG_VARPS       ----------VETLEKLERKITLTLPVGTIQSEVDSRLKKLARTVKMDGFRPGKVPMNVVAQRYG-YSVH
TIG_RHIL3       ------IETLAEGL---KREIKVVIPAKDMQDKMNERLADVKDKVRINGFRPGKVPAAHLKKVYG-KSIM
TIG_PROM9       ---------KTTPLPQSRISFELEIPSETCKTCVNETISTISRSAKIPGFRLGKIPKQVLIQRIGITQLH
TIG_METEP       -------ETTSEGL---KREFQVLLPANELEDRLNTELSNIKGKVQIKGFRPGKVPVAHLRKVYG-KSVM
TIG_METC4       -------ETTSEGL---KREFQVLLPANELEDRLNTELSNIKGKVQIKGFRPGKVPVAHLRKVYG-KSVM
TIG_JANSC       -------ETLAEGL---KREYTITVPASDLEARVNTKLEEARPEVEMKGFRKGKVPMALLKKQFGGEAMQ
TIG_GLOVI       -----------EKLPRSQMGLNVEVEGEKSKQAYEKLVRDTMRTARIPGFRPGKAPRQLVLQFYGKERLR
TIG_OLICO       ----------------------ISIPAAEIDAKVNERLAGMKDKVRLNGFRPGKVPKKVYGKSVAAETLE
TIG_LEPBL       --------------------IKLTFEASDLEKAFDKTYAEKQKNIKIPGFRPGKAPLNMVKRHLGDTVAS
TIG_LEPBJ       --------------------IKLTFEASDLEKAFDKTYAEKQKNIKIPGFRPGKAPLNMVKRHLGDTVAS
TIG_DEIGD       --------------EGNKVSFRVAVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVLESRVGKGYVE
TIG_BARHE       --------------EGLKREIKIVVPARNLEEKLNERLDNTKDKIKLNGFRPGKVPAGYLRKMYG-KSFM
TIG_PSEA6       ------MQVSVETTQGLERRLTITVPAESIDSQVKSRLQQLAKTQRINGFRPGKVPVSVIKKRYG-QAVR
TIG_METPB       -------ETTSEGL---KREFQVLLPANELEDRLNTELSNIKGKVQIKGFRPGKVPVAHLRKVYG-KSVM
TIG_PROMP       ---------KTTALPQSRIALELEIPSNTCKSCVNETINSISRSAKIPGFRLGKIPKQVLIQRIGITQLH
TIG_METNO       -------ETKSEGL---MREFQVVLAAAELEDRLATELAGLKDKVQLKGFRPGKVPVAHLRRVYG-RSIM
TIG_ACICJ       -------ETLTEGLKRG---FTVVVPGSDLSEKREKRLAELSKTMQMPGFRPGKVPLSMVRKRFG-DAVA
TIG_YERPY       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPS       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPP       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPN       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPG       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPE       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPB       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERPA       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_YERP3       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_BURTA       ----------VENLGKLERRVTISVVQKEIDARIQK----LAKNVRMPGFRPGKVPLKMVAQQYAGQVEA
TIG_PROM2       ---------KTTPLPQSRISFELEIPSETCKTCLNETISSISRSAKIPGFRVGKIPKQVLIQRIGITQLH
TIG_LEPIN       --------------------IKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGDSVAS
TIG_LEPIC       --------------------IKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGDSVAS
TIG_AYWBP       ---------KIKKINNQKVQYFFKVSSKELETQLSSAYEKIKSKVEIKGFRKGHVPRKIFENHFGKNNLY
TIG_AGRT5       ----------IETLADGKRELKIVIPAADMKARLDERLVDAKDKVRINGFRPGKVPMGHLKKMYG-KSIM
TIG_PROMS       MAKDALI-VKTTPLPQSRISFELEIPSETCKTCVNETINSISRSAKIPGFRLGKIPKQVLIQRIGITQLH
TIG_PROM3       -MSATALQVKTTQKPNSRLALEVAVPAERCQANYEAAVTRLSRTINLPGFRKGKVPRAVLLQQIGLVRIR
TIG_PROM0       MAKDALI-VKTTPLPQSRISFELEIPSETCKTCVNETISTISRSAKIPGFRLGKIPKQVLIQRIGITQLH
TIG_EDWI9       ------MQVSVETTEGLGRRVNITVTADSIEKAVESELRNVAKKARIDGFRKGKVPMNIVAQRYGA-SVR
TIG_TRIEI       ----------------------------------KNAYEQIIKKYNIPGFRKGKVPRNILIQRLGKNYIK
TIG_THEEB       -----------EPRSNSQLLATIEVSGTHSQQVYNQVVNDLLRHTQVPGFRKGKAPRQLVLQQLGRERLR
TIG_LEPCP       ----------VETLDKLERRITLTLSADELKNEVESRLKKLARTTKADGFRPGKVPMSVVAQRYG-YSVQ
TIG_LEGPH       ------MQVSVETLEGLERKVTVSVPTEKVEEEVSSRLRNLARKVKIDGFRPGKVPFNVVKSRF-SDSVR
TIG_LEGPC       ------MQVSVETLEGLERKVTVSVPTEKVEEEVSSRLRNLARKVKIDGFRPGKVPFNVVKSRF-SDSVR
TIG_LEGPA       ------MQVSVETLEGLERKVTVSVPTEKVEEEVSSRLRNLARKVKIDGFRPGKVPFNVVKSRF-SDSVR
TIG_YERE8       ------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKNVRIDGFRKGHVPMNIVEQRYGA-SVR
TIG_RHILW       ------IETLAEGL---KREIKVVIPAKDMQDKMNERLADVKDKVRINGFRPGKVPAAHLKKVYG-KSIM
TIG_OENOB       -----------KAGKGNKGTLSFEIPAKQISSGIDQAFNKQKDKINIPGFRKGHVSKELFLARFGEEALY
TIG_GLUOX       ---------------------TVVVPSXXXXXXXXXXXXEVAKTIKLPGFRPGKVPASLVKQRYG-ESVN
TIG_AZOSE       -------------------RIDMSVPMAEIDKEVDSRLKRMARTVKMPGFRPGKVPMKIVAQTYGSQA-R
TIG_SYNAS       -MDENTVAVKVEEISPVKKKLLFDVPWEDVKRERDTIYRNFSRTAKIKGFRKGKIPRKILELHYKKHAEE
TIG_SHEFN       ------MQVSVETTQGLERRLTISVPAEQIEKLVKDNVLREAKRARLPGFRPGKVPIGEINKRYG-KAIR
TIG_RALEJ       ----------IENLGKLDRKVTLAIPKAEVEKEKQDRLVRLSKTVKMSGFRPGKVPMKMVEKQYGQQVEF
TIG_GLUDA       ---------------------TVTVPAGELESKRTARLKELGQSMNLPGFRPGKVPLSIVKQRYG-DAVQ
TIG_SYNR3       ------LKVKTSSLPGSRLALEVGVPADRCKASYEAAVERLSRSVRLPGFRKGRVPKPVLLQQIGPLRVK
TIG_BEII9       ----------------------VVLPAADIASRLDEQLQEMKAKVRINGFRPGKVPVAHLKRLYG-RSVM
TIG_RHOCA       ---------------------TITLTGAELDAKVTEKLIEVQPEVEIKGFRKGKVPMAMLRKNFG-DRVL
TIG_RHILO       -----------------KREIKITVPAGDMEAKLMARLSDARNKVRINGFRPGKVPRKVYGKSFMAEVVN
TIG_LACRJ       --------------------LTFEIDVDTINKGIDEAFVETRKKITVPGFRKGRVPRQIFNQMYGEESLY
TIG_LACRD       --------------------LTFEIDVDTINKGIDEAFVETRKKITVPGFRKGRVPRQIFNQMYGEESLY
TIG_VESOH       ------MKTSLETLKGLSRSLTIDLPIDIFNQKMDKILQKMALEVNIDGFRKGKVPISIVRKRFGNNA-N
TIG_STRMK       ------MQASIESTGNLERRLSFSLPEDRLQSHIVGRLGEIARTTRIKGFRPGKVPAKVIEQRFGAQ-VR
TIG_LACDB       -------------------ELSFEISQDEIKKSLDKAFGRVKKSLRVPGFRKGHVSRVIFNQYYGEEALY
TIG_LACDA       -------------------ELSFEISQDEIKKSLDKAFGRVKKSLRVPGFRKGHVSRVIFNQYYGEEALY
TIG_RALME       ----------IENLGKLDRKVTLAIPKAEVQKETQERLARLSKTVKMSGFRPGKVPMKMVEKQYGQQVEF
TIG_PHOLL       ------MQVSVETTQGLGRRVTITVPAADVEKAVSSELVNVAKKVRIDGFRKGKVPMNVVKQRYGASVIQ
TIG_BRASB       ------------------------------------------------GFRPGKVPKKIYGKSVMAETID
TIG_SINMW       ------IETLAQGL---KRELKVVIPADEMEARMNERLVEVKDRVRINGFRPGKVPVAHLKKVYG-KSIM
TIG_ALISL       ------MQVTVETKEGLERVLTITVPAANIEDAVNAELRNIAKNRRFDGFRKGKVPMKMVAKMYGS-AVR
TIG_SYNY3       -----------EKLPDSQVGLEIEIPATASKKVYENVVKKLTRTVNIPGFRRGKVPRAIVIQRLGQSYIK
TIG_RHISN       ------IETLAEGL---KRELKVVIPADEMQTRMNERLADVKDRVRINGFRPGKVPVAHLKKVYG-KSIM
TIG_METRJ       ----------------------VLLAAQELEERLTNELSGMKDKVQLKGFRPGKVPVAHLRKVYG-RSVM
TIG_DINSH       ---------------------SITVTAAELDAKVNEKLSEAQPEIEMKGFRKGKVPMAXXXXXXXXXXXX
TIG_RUTMC       ------MKASLEILKGLDRSLTVDLPIDIFNQKTDKILQKIASQVNFDGFRKGKVPVAVVRKRFG-NNVN
TIG_STRM5       ------MQASIESTGNLERRLSFSLPEDRLQSHIVGRLGEIARTTRIKGFRPGKVPAKVIEQRFGAQ-VR
TIG_RHIME       ------IETLAQGL---KRELKVVIPADEMQARMNERLVEVKDRVRINGFRPGKVPVAHLKKVYG-KSIM
TIG_HELPS       ---------EVKKIDTANARLSAKLSVENLEKRYDKIAQKIAPKVKIDGFRRGKVPLSLVKTRYQADAQE
TIG_DECAR       --------TTAQANELER-RVDLSIAIADVEKEMEQRLKRMGKNMKVPGFRPGKVPFNIVKQQYGDQA-R
TIG_ACIBY       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_ACIBT       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_ACIBS       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_ACIBC       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_ACIB5       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_ACIB3       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFRPGKVPANVVRREYGA-SIY
TIG_SYNP2       -----------EKLPASQVGLEIEVPADVTQKAYDDTVRKLARTVNLPGFRKGKVPKQILIQRLGPNRIK
TIG_RHOBA       -------------------EVVVTIPRGEVDRYMKDAYDELVPEAQVPGFRAGRAPRKLVEKQF-KDRIE
TIG_RALSO       ------MSTVIENLGKLDRKVTLAVPKAEVEQEKQSRLARLSKTVKMSGFRPGKVPMKMVEKQYGQQVEM
TIG_XANCP       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_RHOSK       -------ETQKEGL---KRAYTITVTAAELDAKVQEKLVEAQPDIEMKGFRKGKVPLAMLKKQFGPRLL-
TIG_RHOP2       ------MQVKETVADGLKREFEVNVPAADIDAQVDARLVDLKDKVKLNGFRPGKVPVSHLKRVYG-RSVA
TIG_DEIRA       --------------EGNKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVE
TIG_XANCB       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_XANC8       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_RICRS       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIPGFRAGKVPVSIVKKKYGT-SVR
TIG_RICRO       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIPGFRAGKVPVSIVKKKYGT-SVR
TIG_PROMA       -MSNSQLKIKTKALPNSRIAIEFEVPAQQCKTSFEDALTTLCKSANLPGFRKGKVPKSVILQQIGSKRIQ
TIG_BRUO2       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_BRUME       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_BRUAB       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_BRUA2       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_BRUA1       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_SYNPW       ----------------SRLAVEVAVPAERSQASYEEAITRLSRSVNLPGFRKGKVPRTVLVQQLGALRIR
TIG_RICAH       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRAGKVPVSIVKQKYGT-SVR
TIG_NITEU       ------MQTQGEASNPLERNIELSVSREKVEAEVGVRLKRLAPKVKVQGFRPGKVPLKIVAQQYGHQ-VE
TIG_LAWIP       ------MEFVLESISPTKKKLTISLTPDEVNTALDSVIAQYKKDLSLPGFRKGKVPNSVVFKKFSEE---
TIG_BRAJA       ----------------------ISVPASDLDAKAGAKLVDLKDKVRINGFRPGKVPVAHLKKVYG-RSVM
TIG_AGRVS       ------IETLAEGL---KRELKVIIPAADMEAQMNERLADVKDKVRINGFRPGKVPAGHLKKMYG-KSVM
TIG_RICFE       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRAGKVPVSIVKKKYGT-SVR
TIG_RHOS5       ---------------------TITVTAAELDAKVQEKLVEAQPDIEMKGFRKGKVPLAMLRKQFGPRLL-
TIG_PROM5       ---------KTTALPQSRIALELEIPSNTCKSFVSETINSISRSAKIPGFRLGKIPKQVLIQRIGINQLY
TIG_BURXL       ----------VENLGKLERRVTISLPKDAVQKEVDSRIRQLAKNVRMPGFRPGKVPLKMVTQQYSGQVEA
TIG_BRUSU       --------------EGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYG-KSFM
TIG_RICCN       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRAGKVPVSIVKKKYGT-SVR
TIG_BORDL       --------SNVKLMPGSKVEAVIQISKEFVKAKYNEILKDYSSRLKVKGFRTGRVPFSIIEGKY-SDNIR
TIG_BORRA       --------SNVKLMPGSKVEAVIQISKEFVKAKYNEILKDYSSRLKVKGFRTGRVPFSIIEGKY-SDNIR
TIG_ACIAD       ------MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTAKINGFRPGKVPLSRVRSDFGP-GIY
TIG_THIDA       ------MQGNLEVLEGLARRLDISVPVDQLETEVQSRLKRLARSVKMHGFRPGKAPLSAVARQHGA-GVR
TIG_RICPU       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRAGKVPVSIVKKKYGT-SVR
TIG_RHORT       --------------ESLKREYKIVIPAADIAERSARRLEELKGQMRLPGFRPGKVPMSMLRQRFG-KSVL
TIG_PROMT       -MSAAKLNVKTSAKPNSRIAVEVEVPANRCKNSYDEALSKLSRSISIPGFRKGKVPKTVVIQQLGVKRIQ
TIG_PROM4       -MSNSTLKVKTKSMPDSRLAVELEISAKQCKESYQQALSKLSKTANLPGFRKGKVPQAVLLQQVGAKRIQ
TIG_MARMS       ------MQVSVETTSPIERVLTISVPAARVDEKVNSEVAKTAKTIRIDGFRKGKVPVSVVKKRYG-QGIR
TIG_SPHWW       ------VETLNEGL---KRAYTVTIPANDVAQRVEAEIKSIAPQVRMPGFRPGKVPANLIKKMHGPAIEQ
TIG_OCHA4       --------------EGLKREIKVVVPAKDLEAKLAERLETARDRAKINGFRPGKVPAAHLRKMYG-KSFM
TIG_TREPS       ------LQKKFTALAQSQVELEVVVAREDAQRHYQRFVEEYLERARLPGFRKGKVPLAVLERKYGS-AIR
TIG_TREPA       ------LQKKFTALAQSQVELEVVVAREDAQRHYQRFVEEYLERARLPGFRKGKVPLAVLERKYGS-AIR
TIG_RICCK       ----------------------ISTPLSEIDDDMQKELLDLTKKVKIAGFRAGKVPVSIVKKKYGT-SIR
TIG_HAMD5       ------MQVLVETTEDLKKRATITLFSDDIEXXXXXXXXXXXXXXXMDGFRKGKVPINLIEQRYG-ESIQ
TIG_BURPP       ----------VENLGKLERRVTISLPKDAVQKEVDSRIRQLAKNVRMPGFRPGKVPLKMVTQQYSGQVEA
TIG_RICM5       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRAGKVPVSIVKKKYGT-SVR
TIG_LEGPL       ------MQVSVETLEGLERKVTVSVPTEKVEEEVSSRLRNLARKVKIDGFRPGKVPFNVVKSRF-SDSVR
TIG_NITEC       ------MQTQEEASNPLERNIELSVSREKVEAEVGQRLKRLAPKIKIQGFRPGKVPMKIVAQQYGHQ-IE
TIG_SULDN       ------MKIKTNKINSANAQIEAEIPRTTIDANIEKIAKNLTKTASVQGFRKGKVPVTVIKKQYGERLIQ
TIG_RICAE       ----------------------ISTPLSEIDDDIQKELLDLTKKVKIAGFRVGKVPVSIVKKKYGT-SVR
TIG_POLNS       ---------QIENLGSLDRKMTLEFARADLEARLAKVGKSM----KMAGFRPGKVPKNLVEKQHGMQVDF
TIG_OENOE       -----------KAGKGNKGTLSFEIPAKQISSGIDQAFNKQKDKINIPGFRKGHVSKELFLARFGEEALY
TIG_WOLPP       ----TYKELSVDKL---KYEYEITVSSDYIEQKINSRLQEIAKNAKFPGFRSGKMPYDLVITNYKNEALE
TIG_POLSQ       ---------QIENLGSVDRKTTLEFARADLEARLAKVGKTM----KVAGFRPGKVPKSMVEKQYGMQVDF
TIG_RICPR       ----------------------ISTPLSEIDDDIQKELLDLTKKVKVAGFRAGKVPVSIVKKKYGT-SVR
TIG_MESFL       --------TELKIIEQGQGKWTVTIDGTEWTETLKKAKNRVLANLEVPGFRKGKIP--------AAQAEK
TIG_LEUMM       --------------EKNQGTLEFEIARAQVEEGLEQAFQRNKNEVSIPGFRKGKVTKQLFFQKFGEEALY
TIG_PROM1       -MSAAKLNVKTSSKPNSRIAVEVEVPANRCKNSYDEALSKLSRSISIPGFRKGKVPKTVVIQQLGVKRIQ
TIG_ANAPZ       -----------------------------IEEKVTEKLQGIAATARMDGFRKGKVSPEFVRRMYG-ESIA
TIG_BORHD       ----------VKLIPGSKVEAVIKISKEFVKGKYNEILQDYSSRLKIKGFRIGKVPFSIIEGKY-SDNIR
TIG_RICTY       ----------------------ISTPLSEIDYDIQKELLDLTKKVKVAGFRVGKVPISIVKKKYGI-SIR
TIG_WOLTR       ----TYKELSIDKLKH---EYEITVGSNYIEQKVNSRLQEIAKNAKLPGFRSGKMPYDLVVTNYKNEAL-
TIG_ARCB4       ------MEFNANRVDEANAVITATLTKDSIENNLEKVAKQAAKTMNVQGFRKGKVPVAVVKDKLREDAEA
TIG_MYCMS       -------------VDQGQGKWTVTIQDDQWTEFLKKAKNRLKTNLVVPGFRKGKAPE--------SETAK
TIG_CHLPB       ------MQKNINNVSDTEQKLEITLSAEEFTPEIDLEVENARKTIQIKGFRKGHVPAGMIKKVMG-PAIE
TIG_BORT9       ----------VKLIPGSKVEAVIRISKKFVKSKYNEILQDYSSRLKVKGFRIGKVPFSIIEGKY-SDNIR
TIG_MARMM       ----------------------IVIPADDLQARLAAKIEEIRPEVRLKGFRPGKVPTSHIRKMFG-ESIM
TIG_PARUW       -----------------QVKFDITVKPEAVVAAYQKALKTINKEINIPGFRKGKAPQQLILEKYGSN-VQ
TIG_MYCMO       ---------------------------------------NLAKTLKIKGFRPGKASVEAAKKHLNPEQIQ
TIG_CHLAB       -----------------------------------------------PGFRKGKAPDGIIVSRYPSQ-VT
TIG_XYLFM       ----------IESIGNLERRLTFSVPEDRLESHVDERLREIARTARINGFRAGKVPAKVIGQRFG-EKVR
TIG_MYCPU       --------------ENSEIHVKTPVESTLWKQSQKKAFNKLKSKINIPGFRKNSSS-PQFDKIARAKISK
TIG_CAMC1       ------MEIKIKALNSVNTLASTTISADAIKSSVEKLAKKAAKTMKVDGFRQGHVPVAVVLKRYEKELTN
TIG_XANC5       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_HELPH       ---------EVKKIDTANARLSAKLSIENLEKRYDXXXXXXXXXXXXDGFRRGKVPLSLVKTRYQAQAQE
TIG_XANAC       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_EHRRG       -----------EILNDNKLKYEFTIDNKYFFSQLDAKLLEIAKNVKIPGFRAGKASIDLIKNTLIRKIVE
TIG_UREU1       ----------------------------------EKVAKKTASKLKIPGFRPGNVPVEEAKKHVNEIEVF
TIG_SYNS3       ----------------SRLAVEVAIPAERSQASYEAAISQLSRSVNLPGFRKGKVPRSVLVQQLGGLRIR
TIG_CAMC5       ------MEINAKPIDSVNVEVSAKVKSDEIKASVEKLAKKAAKTMKVDGFRQGHVPVAIVEKELTSDA-E
TIG_HELPY       ---------EVKKIDTANARLSAKLSIENLEKRYDXXXXXXXXXXXXDGFRRGKVPLSLVKTRYQAQAQE
TIG_HELPG       ---------EVKKIDTANARLSAKPSVEDLEKRYDXXXXXXXXXXXXDGFRRGKVPLSLVKTRYQADAQE
TIG_EHRRW       -----------EILNDNKLKYEFTIDNKYFFSQLDAKLLEIAKNVKIPGFRAGKASIDLIKNTLIRKIVE
TIG_XANOR       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_XANOP       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_XANOM       ------MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFG-QQVR
TIG_EHRCJ       ---------------------------------------EIAKNVKVPGFRVGKASIDLVKNDVMTDVVR
TIG_CAMFF       ------------------------VKASELNAKVENLXXXXXXNIKIDGFRKGKVPVAQVLKRYGKDLAK
TIG_HELP2       ------------------------------------------------GFRRGKVPLSLVKTRYQAQAQE
TIG_MYCGE       ---------------DKSLCLEVEIDPNYWQATQKKLVGEMAKSIKIKGFRPGKIPPNLASQSINKAELM
TIG_CAMLR       ------MEVTAKLIDFANANATVKIAQGAIKAEVEKLAKKASKTMKMDGFRAGKVPVAAILKRYEKELTR
TIG_AQUAE       --------------------LTVEIQGDSVKEKIDEMYKQLQKTVQIQGFRKGKAPLWIV-RAKYKDYVE
TIG_XYLFT       ----------IESIGNLERRLTFSVPEDRLESHVDXXXXXXXXXXXXNGFRAGKVPAKVIEQRFG-EKVR
TIG_XYLF2       ----------IESIGNLERRLTFSVPEDRLESHVDXXXXXXXXXXXXNGFRAGKVPAKVIEQRFG-EKVR
TIG_UREPA       --------------------------------------KKTASKLKIPGFRPGKVPVEEAKKHVNEIEVF
TIG_UREP2       --------------------------------------KKTASKLKIPGFRPGKVPVEEAKKHVNEIEVF
TIG_HELAH       ------------------------IDTANSHLSAKPSIEDLKKRYDXXGFRRGKVPLSLVKTRYQAQAQE
TIG_ANAMM       -----------EVLSDKLKRVEFTVGNEYLEQQVDDRLREIAANVRMDGFRKGK---------VSLDLVR
TIG_MYCGA       ---------------DHKVKYIVDVNEKNWNEAYQKKLNAAVKNVKIQGFRKGHVPKHIDQIGLFDRAVN
TIG_HELHP       ------------------------------------------------GFRKGKVPTQVIKTRY-KEXXX
TIG_EHRCR       -MLNSYVVREVSN-DKLKWEYEFAVDKKYFLDQLDSKLSEIAMNVKVPGFRVGKASIDLVRKEYLNEAIE
TIG_MYCPN       ----------------------------------QKQTQDLTKNMKIKGFRKGKVPPTLAKDYLDRAELL
TIG_CHLL2       ------MQKNITKISDTEQELEIILSAEEFGTEYNQELEEAKRTVQIKGFRKGHVPAGMIKKLVG-PAIE
TIG_CHLT3       ------MESKFKQLSDTEQELEISFSPDEFQPELDKQYKLAQAKAHLKGFRKGKAPLQMIKKMLGRD-IQ
TIG_XYLFA       ----------IESIGNLERRLTFSVPEDRLESHVDERLREIARTARINGFRAGKVPAKVIEQRFG-EKVR
TIG_WOLPM       ----TYKELSIDKL---KYEYEITVGSDYIKQKVNSRLQEIAENAKSPGFRAGKMPYDLVVANYKNEAL-
TIG_PROA2       ----------IKNVSETEQQLEIILSAEEFNPEVELEIQDAKKNIQIKGFRKGHVPVGLIKKLMG-PAIE
TIG_MYCCT       -----------------------------------------------PGFRKGKAPE--------SETAK
TIG_SULNB       ------MKVEVKKIDDANVAVQGNIENKVVEANVDKLAREAGKQMKVDGFRKGKVP-PHVVKKLHGDKLQ
TIG_HELPJ       ------------------------IDTANARLSAKPSIEDLEKRYDXXGFRRGKVPLSLVKTRYQAQAQE
TIG_MYCPE       ---------KITSVKNEKELVSFEIDLSELDKEILKASKNL----KMPGYRPGKVPLEIAKKNINMSSAR
TIG_CHLPN       -----------------------------------------------PGFRKGKAPDDVIASRYPTN-VR
TIG_CHLPD       ------MQKNITKVSDTEQELEIILTAEEYGTEYNQELDEAKRTIQVKGFRKGHVPTGLI-KKLAGPAIE
TIG_BAUCH       -----------------RRSVTMKIASHIIEETISKKLLELAKTVVIDGFRKGKAPIHIV-----AKRYH
TIG_MYCHJ       --------------ESAELKIKLTADSKKWAEFYQKAEQKQAAKVSLRGFRKGKVPRAYLNPQAVFELAL
TIG_MYCH7       --------------ESAELKIKLTADSKKWAEFYQKAEQKQAAKVSLRGFRKGKVPRAYLNPQAVFELAL
TIG_MYCH2       --------------ESAELKIKLTADSKKWAEFYQKAEQKQAAKVSLRGFRKGKVPRAYLNPQAVFELAL
TIG_KOSOT       ------MEKNVVKAEKNVEIVEFTFGPDEIAEAENEIVRYVNKNYTIPGFRKGKAPKRIIETFFG-ENFR
TIG_CAMJR       ------MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFRPGKVPVSAVERELTQDAEQ
TIG_CAMJE       ------MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFRPGKVPVSAVERELTQDAEQ
TIG_CAMJ8       ------MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFRPGKVPVSAVERELTQDAEQ
TIG_GRABC       ---------------------TVQVPATDIXXXXXXXXXXXXXXXKLPGFRPGKVPMTLVRQRYGRSXXX
TIG_CAMHC       ------------------------IPTASINEKVNELAKQTAKKVRIDGFRPGKAPVAAV-----LKRYK
TIG_PELPB       ------MQKNIKNVSETEQELEIILSAEEFGTEYNQELEEAKRNIQIKGFRKGHAPASLI-KKLAGPSIE
TIG_MYCS5       --------------------VSLFVSKEQVDKEYQKLETEALKKIKVNGYRAGKAPKEALRARLNSDRVL
TIG_CAMJJ       ------MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFRPGKVPVSAVERELTQDAEQ
TIG_CHLP8       ------MQKNITNVSDTEQQLEIILTAEEYQPEYDQQLEEARRSIKIKGFRQGHVPVGMLKKMIG-PSLE
TITIN_DROME     ------------ATKTTDAEFTVQLSQPDVEVTWCKKGKPIKPNQKHEVFVEGTVRRLVIHDASDEDAGE


                         .         .         *         .         .         .         .:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEISSYEPVEIELPAEGT
TIG_BACSK       QDAIDILLPEAYANAVEETGIYPVDRPEID-VESIGKNEPLIVKATVTVKPEVKLGDYKGLEVEVPSTDV
TIG_SYNWW       QDALEYIVPEAYDKALEELNIKPIAQPEFDIND-PESGQPFKFNARVPVKPEVKLGEIEGIEVEIPDFQV
TIG_BACCN       QDALDIILPKAYSEAIDETGIFPVAHPEID-IEKFEKNENLVFTAKVTVKPEVKLGEYKGLAVEKIDTTV
TIG_NOCSJ       DQAINDVVPQKYVEALQANSLQPLAQPEIEVTKF-EDNQALEFTAEVDIRPEIALPDYDGVEAQVDDIEL
TIG_LYSSC       QDALEIIVPDSYAKAIDEAGIMPVDYPEIAGTENFVHGQDFSFTAQVTVKPEPKLGDYKGLEVKLPVE-V
TIG_STAAR       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAE       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAB       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAS1       QDAVDILLPEAYGEAIDETGIKPVDQPEINVTS-IEKGKEMTFEANVVVEPEVQLGDYKGLEVEKQDVEL
TIG_STAAW       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAT       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAS       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAN       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAM       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAAC       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAA9       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAA8       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAA3       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAA2       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_STAA1       QDAIDILLPDAYGEAIDETDIKPVAQPEVSVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETEL
TIG_HALOH       RDAFDILVPPAYQEAVQAAEIEPIDRPEITDF-YIEENKPATFSAVVEVKPEVELGEYKGLGIEKDEVEV
TIG_STAES       QDAVDILLPEAYGEAIEETEINPVAQPEVNVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETDL
TIG_STAEQ       QDAVDILLPEAYGEAIEETEINPVAQPEVNVTQ-IEKGKDFIFEATVTVEPEVKLGDYKGLEIEKQETDL
TIG_STACT       QDAVDILLPEAYGEAIEETGIKPVDQPEI-EVNQIEKGKDLKFDATVTVQPEVKLGEYKGLEIEKQNADL
TIG_BREBN       QDALDILLPTAYGQAVREAGIEPVDRPEVDVTQM-EQGKNLIFKATVTVKPEVKLGDYKGLSIEEKDFSV
TIG_CORJK       DQVINEMLPSRYSQAVEENDVKALGQPEIEIAEL-EDGKHITFTAEVDVRPEIEVPDFSAISVEVAPLKA
TIG_STAHJ       QDAVDILLPEAYGEAIDETGINPVAQPEINVTQ-IEKGKDFEFEATVTVEPEVQLGDYKGLEIEKQDSEL
TIG_MYCS2       EQVVNDALPSRYSEAVSTSDLKPLGQPEIEITKL-EDNEELVFTAEVDIRPEITLPELESLKITVDPIEV
TIG1_DESHY      NDAVDDILGVEYMKAVNEAGIEPVDRPDVDLIQM-EDGKELVFKAKVTVKPEVELGSYKGLEVEKTAAVV
TIG_MYCSS       DQVVGEAVPGRYTEAVTSSDVQPLGQPEIEITK-KEYGEDLVFTAEVDVRPEITLPDLSALEITVDPIEI
TIG_MYCSK       DQVVGEAVPGRYTEAVTSSDVQPLGQPEIEITK-KEYGEDLVFTAEVDVRPEITLPDLSALEITVDPIEI
TIG_MYCSJ       DQVVGEAVPGRYTEAVTSSDVQPLGQPEIEITK-KEYGEDLVFTAEVDVRPEITLPDLSALEITVDPIEI
TIG_CLOAB       EDAINFCIDDTYPEVIKENDIHPVAYPEIDIVTL-EEGKDFVYTAKVTVKPEVELGEYKGVEVTKVEYPV
TIG_MYCGI       EQVVNDALPTRYSQAVTSESLQPIGQPEIEVTKL-EDNEELVFTAEVDVRPEIDLPDLSTLTITVDPVSV
TIG_MOOTA       NEAAEIVIPPAYEEAVAEHQLEPIDRPEV-EIVKVEDGEPLVFKARVEVKPEVQLGPYTGLEVERQEVEV
TIG_GEOSW       QDALDILLPEAYAKAVEEAGIEPVDVPKID-IEQMEKGKSLIFTAKVTVKPEVKLGQYKGLEVEKMXXXX
TIG_BACLD       QDALDILLPVEYPKAVEEAGIEPVDRPEID-VEKIEKGENLIFTAKVTVKPEVKLGEYKGLGIEKDDTAV
TIG_BACCQ       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACC7       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_NOCFA       EQVVNDVLPARYSEAVTTSEVKVIGQPDIEITK-IEDGQEFAFSAEVDVRPEIALPDYADLEVTVDAFTI
TIG_BACC1       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_ALKMQ       EDAMNIVLPDAYEGALQELNIDPIDRPEFDFGE-IKKGEDVEFTAEVQVMPEFTVEGYKGIEVEKNEYNV
TIG_RHOE4       EQVVNDALPSRYSEAVTSAGVKAIGQPEIEVTK-IEDGELLEFTAEVDVRPEIELPDFSSINVEVDPIEI
TIG_BACHK       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACCZ       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACC3       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACC0       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACAN       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACAH       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACAC       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACAA       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_PELTS       EEAMDYLVPVAYFKAVEDTGI-XXXXXXXXXXXXXXXXXXXLFKATVQVKPEVKLGQYKELELTRPSTEV
TIG_NATTJ       EDAIEILVPEAYQEALEEHEIEPVDQPEID-IDQMEKGQPLKFNATVEVKPEVELGTYXXXXXXXXXXXX
TIG_STRP7       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_DESRM       GEAVEIIIPDAYMEALKETATEPIDQPKIDIVQ-GEAGKALIFKATVEVKPEVTLGEYKGLEVTKASSEV
TIG_STRR6       QDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRP2       QDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_ALKOO       EEAFNIVFPEVYEAALDEHNIDPVDHPKVDLEDIV-AGQDVVFTAVVEVMPEFEVADYVGIEVEKKEYNV
TIG_CLOPH       EDAANFIIPEAYEQAIEESKLDVVARPEIDVVQ-VEKGQPFIFTAEVAVKPEVTLGAYKGVEVSKSEIEV
TIG_BACWK       QDALDIILPKAYGEAIDEAGIFPVAHPEID-IEKFEKGQNLIFTAKVTVKPEVKLGDYKGLAXXXXXXXX
TIG_MYCVP       EQVVNDALPARYSEAVTAESLQPIGQPEIEVTKL-EDNEELVFTAEVDVRPDIDLPDLGALKITVDPISV
TIG_EXISA       QDALDILYRDTIQGAVEEAGFEPIALENIDVDGTLEKGKPVAFKVTFVVEPEAELGEYKGLEYEAVSTEV
TIG_MACCJ       QDALDFILPDAYAAAVEEAGINPVDRPEID-IEQMEKGKELIFTAKVTVEPEVELGDYKGXXXXXXXXXX
TIG_BACHD       QDALDILLPEAYAAAIDETGIEPVDRPEID-IEQMEQGNNLIFKATVTVKPEVQLGDYKGLEFEEKDTTV
TIG_GEOKA       QDALDILLPEAYAKAVEEAGIEPVSMPEID-IEQMEKGKSLIFKAKVTVKPEVKLGQYKGLEVEKMDTTV
TIG_CORA7       EQVVNDMLPSRYEQAVTENDLKVIGQPEIDIAKL-EDNDFVEFTAEVDIRPEFEVPDFSKISVKVPALET
TIG_MYCPA       DQVVTEALPARYGQAVAESEVHPLGQPEIEVTK-KEYGQELAFTAEVDVRPELNLPDPGALKISVDPIEV
TIG_MYCA1       DQVVTEALPARYGQAVAESEVHPLGQPEIEVTK-KEYGQELAFTAEVDVRPELNLPDPGALKISVDPIEV
TIG_BACA2       QDALDILLPVEYPKAVEEAGIEPVDRPEID-VEKIEKGESLIFTAKVTVKPEVKLGDYKGLGIEKDDTAV
TIG_MYCA9       EQVVNAALPARYSEAVTASDVKPLGQPEIEVTK-IEDGQELTFTAEVDVRPEIELPDLSGVAVTVKPVTV
TIG_ANATD       DDAIDYVLNETYPKVIEESKLEVVSRPEVDIVQ-VGKGKSFIYKAEVYVKPEFELGQYKGVEIEYPXXXX
TIG_MYCMM       DQIVNDAVPSRYGQALAESEIQPLGRPDIEVTQ-KEYGQDLAFTAEVDVRPEIALPDLTGLSVSVDAIEA
TIG_GEOSF       DDVLKNIVNDTYFKALTDEKIYPVSYPVID-SDELKVGENFKYSATVEVFPDVEVKDYDGLEVKKEKFVL
TIG_LACS1       QEALNDLLPEAYSNAVKEADINPVDQPQID-VESMESDAAWVLTAKVTVEPEVELGQYKDLEVTKHPTRV
TIG_GEOSL       GDVLKNLFEETYFKALAEHKIFPVSHPVID-SDEIKRGTPFTYSATVEVLPEIDVKDYNGLEVAKETFTP
TIG_FINM2       EDAVNLLLPGIYEKAIEELELEPVSQPDIDLDDITE-NNDVKVKFTVDLKPEFELGDYSKLSAEIEEFKV
TIG_CLOB8       DDAVNFAIDESYPEALNAENIKPVDYPQVDIVELGE-GKELVYTATVTTYPEVELGEYKGLDIKKPIYEV
TIG_BACP2       QDALDILLPVEYPKAIDEAGIDPVDRPEID-VEKIEKGESLIFTAKVTVKPEVKLGDYKGLNVEKDDATV
TIG_CLOBB       DDAVNIAIDESYNEALKAEDIRPVDYPKVDIVEIGE-GKELVYTATVTTYPEVEIGEYKGLDIXXXXXXX
TIG_GEOTN       QDALDILLPEAYAKAVEEAGIEPVSMPEID-IEQMEKGKSLIFKAKVTVKPEVKLGQYKGLEVEKIDTTV
TIG_MYCUA       DQIVNDAVPSRYGQALAESEIQPLGRPDIEVTQ-KEYGQDLAFTAEVDVRPEIALPDLTGLSVSVDAIEA
TIG_CLOPS       DDAINACIDKTYGVALEENNVRPVDYPQIEVVEVGE-GKDLVYKAKVTTYPEVTLGDYKGLEVEEVSYEV
TIG_MYCBT       DQIVNDALPSRYGQAVAESDVQPLGRPNIEVTK-KEYGQDLQFTAEVDIRPKISLPDLSALTVSVDPIEI
TIG_MYCBP       DQIVNDALPSRYGQAVAESDVQPLGRPNIEVTK-KEYGQDLQFTAEVDIRPKISLPDLSALTVSVDPIEI
TIG_MYCBO       DQIVNDALPSRYGQAVAESDVQPLGRPNIEVTK-KEYGQDLQFTAEVDIRPKISLPDLSALTVSVDPIEI
TIG_SYMTH       QEAVDQILPRAYSEALEQGQIEPISQPEI-EVVQAEDGKPLIFKGKVQVTPEVTLGRLSGFGIEKQVPEV
TIG_STRZT       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVIAAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRZP       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVIAAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRZJ       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRPS       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVIAAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRPJ       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVIAAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRPI       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_STRP4       QDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVIAAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_CARHZ       EEALDELLPESYVKAVNEAGIEPVDKP---EVSLVSYGEPLVYKAVVDVKPEVELGQYTGLEVTKMPXXX
TIG_STRPN       QDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSM-EKGQDWVITAEVVTKPEVKLGDYKNLEVSVDVEEV
TIG_EUBR3       EDAANILMQQTYAGAVDESGVDIVSRPTVEVTQ-IEKGQPFIYTAEVAVRPEVTLGKYMGVTVTKIDTSV
TIG_CLONN       EDAINTCCEEAYPMAVEEHNLQPVDYPKIDIVE-IGSGKDFVFTAEVVTRPEVKLENYKGVEAKKNTYEV
TIG_DESVM       GEATQDLVNVHINEVMTALDANPISRIDFDGGQL-ERGTPFEYSISFEVLPEFDLPDYDGFAVEQEKAVV
TIG_BACSU       QDALDILLPVEYPKAVEEAGIEPVDRPEID-VEKIEKGESLIFTAKVTVKPEVKLGEYKGLGIEKXXXXX
TIG_MYCTU       DQIVNDALPSRYGQAVAESDVQPLGRPNIEVTK-KEYGQDLQFTAEVDIRPKISPPDLSALTVSVDPIEI
TIG_MYCTA       DQIVNDALPSRYGQAVAESDVQPLGRPNIEVTK-KEYGQDLQFTAEVDIRPKISPPDLSALTVSVDPIEI
TIG_DESAP       EEAMEQLIPRAYLEAVADTGIQPVSQPEVDVVQL-EEGKPVILKIQVDVKPEVVLGEYKNLKVERQVAXX
TIG_OCEIH       QDAVDIVLPSAYTKAVEEADIFPIAQPSVD-IDQIERGKELIFTAEVEVKPEVKLGEYKGLXXXXXXXXX
TIG_CORDI       EQVINDMLPTRYQQXXXXXXXXXXGQPHIDITKL-EDNEVVEFTAEVDVRPEITVPDFSAFAVEVPALKS
TIG_STRS7       EEALNIVLPAAYEGAVAELELDVVAQPKIDVVSM-EKGQEWTLTAEVVTKPEVKLGDYKDLTVEVEAKEV
TIG_STRGC       QDALNNLLPNAYEAAVKEAGIEVVAQPKIDVVSM-EKGQDWTISAEVVTKPEVKLGAYKDLEVSVESKEV
TIG_CORGL       EQVVNDMLPNRYAQAIEAEGIKAIGQPNVEVTK-IEDNELVEFVAEVDVRPEFELPKFEDITVEVPXXXX
TIG_CORGB       EQVVNDMLPNRYAQAIEAEGIKAIGQPNVEVTK-IEDNELVEFVAEVDVRPEFELPKFEDITVEVPXXXX
TIG_COREF       EQVVNDMLPTRYGQAIEENDIKAIGQPDVEITK-IEDNEVVEFTAEVDVRPEITLPDFSAINXXXXXXXX
TIG_BIFLO       GEAVNDAVPELYSKALEEKKIRPMAQPEFDVQDVPQSANDETFTATVERRPDIELPEIDGLEIAISKPEV
TIG_BIFLD       GEAVNDAVPELYSKALDEKKIRPMAQPEFDVQDVPQSANDETFTATVERRPDIELPEIDGLEIAISKPEV
TIG_RHOSR       EQVVNDALPSRYSEAVTSASVKAIGQPEIEITK-IEDGELLEFTAEVDVRPEITLPDYSELSVTVDPIEI
TIG_LEIXX       EHAVNEGLDGFYRLAVEENEVRPLGRPEADISEWKDFSGDLLLTIEVDVRPEITLPAFDGITLTVEAAQV
TIG_BIFLI       GEAVNDAVPELYSKALDEKKIRPMAQPEFDVQDVPQSANDETFTATVERRPDIELPEIDGLEIAISKPEV
TIG_ANOFW       ADALDILLPEAYAKAVEETGIEPVDRPEID-VEQMEKGKSLIFTAKVTVKPEVTLGEYKGLXXXXXXXXX
TIG_STREM       EEALNIVLPAAYEGAVAELELDVVAQPKIDVVSM-EKGQEWTLTAEVVTKPEVKLGDYKDLTVEVEAKEV
TIG_CLOTE       EDAINICCDDTYPKALEEKEIKPVDYPQIDIVEIGE-GKDFVYTAQVTVMPEVELGEYKGLEAKKVSYDV
TIG_BDEBA       QDVVQDLIQKHYAEALNEHKLEPISYPEFEFADPTE-NKDFSFSAAFDVRPEITLKKYEGLEVEKEKAEF
TIG_RHOOB       EQVVNDALPSRYSEAVTSASVKAIGQPEIEITK-IEDGELLEFTAEVDVRPEITLPDYSELSVTVDPIEI
TIG_PELCD       GQVFERLVNETFFKALVDEKINAVSAPEVVDNGPLKPGQAFTYEAEVEVRPDVEAKDYIGLDLKKENFAV
TIG_STRGG       EEAVNDALPKFYTEAVNEGELNVLGQPEVDITELKD-GELLAFTAEVDVRPEIEIPDYSGIEVTVDALEV
TIG_SALAI       GTVLNEAVQEAIPAAVREHDLKTLGRPEVEITEFTD-GDSLNFTAEVDVRPELTLPDLSTVEVTVDELKI
TIG_GEOSM       EDVVKNLVQESYFSAVSEQGLNPVGYPAI-ESDQLKKGEPFKYSATVEVFPEVEVKDYTGLEVVKEKLEV
TIG_BACCR       QDALDIILPKAYGEAIEEAGIFPVDHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACC4       QDALDIILPKAYGEAIEEAGIFPVDHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_BACC2       QDALDIILPKAYGEAIEEAGIFPVDHPEID-IEKFEKNANLIFTAKVTVKPEVKLGEYKGLAXXXXXXXX
TIG_FRASC       DEAVQEALPQLYSEAVQAEEVDVLSRPEVDITEFADGGQ-LVFTAEVDVRPEVTLPEFSELEITVDAVEV
TIG_STRE4       EEALNIVLPAAYEGAVAELELDVVAQPKIDVVSM-EKCQEWTLTAEVVTKPEVKLGDYKDLTVEVEAKEV
TIG_CLOBA       DDAVNIAIDESYNEALKAEDIRPVDYPKVDIVEIGE-GKELVYTATVTTYPEVEIGEYKGLDIXXXXXXX
TIG_CALS8       DDAIDYVLNETYPKVIEESKLEVVSRPEVDIVQ-VGKGKSFIYKAEVYIKPEFGLGEYKGVEIEYPXXXX
TIG_STRPC       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_CLOBL       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_CLOBK       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_CLOBH       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_CLOB6       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_CLOB1       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_FUSNN       SDVANDAINANFPEIVDKEKLEPVSYVRLKEINLKD---DLNLTFDIDVYPQFELGNYKGLEAEKKSFEM
TIG_FRAAA       DEAVQEALPQLYSEAVQAEEVDVLSRPEVDITEFADGGQ-LVFTAEVDVRPEVALPEFADLSVTVDAVEV
TIG_LACPL       QDALNIVLPEAYEEAIKETEIEPVDQPQID-VDSMEKGKPWVLKAVVTVKPEVKLGQYKELSVTRQNTRV
TIG_MYXXD       DEVIQRVVQSAYVEAIREHNVEVVATPQVTNSGL-KPNTPFTFEARVEVKPKVEAKDYVELPLTKSDTAV
TIG_CLOBM       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPEVKLGEYKGVEVKKVSYEV
TIG_SACEN       GPVLDEVVNESVPAAVNSSEVRTLGRPDIEVTK-IEDGDVIEFKAEVDVRPEITVPAFGELKXXXXXXXX
TIG_KOCRD       ENALNEGLNAFYQQALTENELTPLSQPQVEVLSKPEENADTKVEISVAIRPEIELPDYKGLEIQVEAREA
TIG_CLOTH       EDAINIVCADAYDKAIEENDIFPVDRPTISIKKIGE-GENLVFTASVTVKPXXXXXXXXXXXXXXXXXXX
TIG_CLOBJ       EDAINFCCEDTYPKAIEENNIKPVDYPQIDVVQIGE-GKDFIYTAEVTTVPKVKLGEYKGVEVKKVSYEV
TIG_DESAA       SDVAGEIISDAFRDAIMETKLKIVGPPEIEPPAIV-SDEPYKFDATVEIFPELSDLNLKEIELSKNMYKA
TIG_CLOPE       DDAINACIDKTYGVALEENNVRPVDYPQIEVVEVGE-GKDLVYKAKVTTYPEVTLGDYKGLXXXXXXXXX
TIG_CLOP1       DDAINACIDKTYGVALEENNVRPVDYPQIEVVEVGE-GKDLVYKAKVTTYPEVTLGDYKGLXXXXXXXXX
TIG2_DESHY      QEALDLIMTEEYKKAVESLALNTIGDPDI-EVGEIEKGQELSVKASVPVVPEVTLGQLEGIEVVMPAREV
TIG_LISIN       QDALDILLPEVYSQAIDEAGIDPVDTPQVN-IESMEKGETWVLTADVTVKPEVKLGDYKGXXXXXXXXXX
TIG_STRPD       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRPM       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRPF       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_DESDG       NEATQDLVNVHINEVVGSLDTQPASRIDFDGGQL-ERDKEFVYTISFEVMPVFEMPDYDGMEVEQEKPEV
TIG_STRPZ       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRPG       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRP8       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRP6       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_STRP3       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_LISMH       QDALDILLPEVYSAAIDEAGIDPVDTPQVN-IESMEKGETWVLTAEVTVKPEVKLGDYKGXXXXXXXXXX
TIG_DEHE1       DEVVDDIVPEACQQAIDDEEIKPFAAPKI----AMVTTEPFVFSARIPLPPVVELGDYKTIRAAKEKVEI
TIG_PEDPA       QDALNIVLPEAYEAAIKEAGIEPVDQPQVD-VESMEKGEAWVLSAIVTVKPEVKLGEYKGVKVIKQSTRV
TIG_LISMO       QDALDILLPEVYSAAIDEAGIDPVDTPQVN-IESMEKGETWVLTAEVTVKPEVKLGDYKGXXXXXXXXXX
TIG_LISMF       QDALDILLPEVYSAAIDEAGIDPVDTPQVN-IESMEKGETWVLTAEVTVKPEVKLGDYKGXXXXXXXXXX
TIG_LISMC       QDALDILLPEVYSAAIDEAGIDPVDTPQVN-IESMEKGETWVLTAEVTVKPEVKLGDYKGXXXXXXXXXX
TIG_AERHH       ARVADEMMQSNFIKAIIENKLSPAGAPTMDPKEIQE-GQDFEFTATFEVYPEFEVAGLETIKVEKPVATV
TIG_STRP1       EDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSM-EKGKEWTLSAEVVTKPEVKLGDYKNLVVEVDAKEV
TIG_CLOCE       DDAINIVCSEAYDNAIEENNINPVDRPEI---DIVQIGKNQNLIFTVTVKPEVELGAYMGVEAKKAEANV
TIG_STRAW       EEAVNDALPKFYTEAVNEAELNPLGQPEVDITELKD-GETLNFTAEVDVRPTIEIPDYSGIXXXXXXXXX
TIG_STRA1       ENALNLVLPKAYEAAVAELGLDVVAQPKIDVVSM-EKGQDWKLTAEVVTKPEVKLGDYKDLSVEVDAKEV
TIG_LISW6       QDALDILLPEVYSQAIDEAGIDPVDTPQVN-IESMEKGETWVLTAEVTVKPEVKLGDYKGXXXXXXXXXX
TIG_STRA5       ENALNLVLPKAYEAAVAELGLDVVAQPKIDVVSM-EKGQDWKLTAEVVTKPEVKLGDYKDLSVEVDAKEV
TIG_STRSV       QDALNALLPEAYEAAVKEAGIEVVAQPQFD-VESMEKGQDWVIKAEVVTKPEVKLGAYKDLEVTVEAKEV
TIG_BIFA0       GEAVNKALPDMYAKALDEKDIRPMDQPQIEVVEMPQSAADDTFTATVERRPEFELPNLEGLEIAVDKAEV
TIG_PROAC       QEAINDALPAAYGKAIEENTVVPLGQPEIEVTKL-EDGEVVEFTAEVDVRPDFDLPDVSAISXXXXXXXX
TIG_DEIDV       QEVRDRLLQVHYPQAARELKL-SLVDATIDPQDL-NNGKDFTFNVRGETYPEVTLGDWSDLKLEATSPEI
TIG_AERS4       ARVADEMMQNNFIKAIIENKLSPAGAPTMDPKEIQE-GQDFEFTATFEVYPEFEVAGLETIKVEKPVATV
TIG_STRU0       EDALNIXXXXXXXXXXXXXXXXXXXQPKIDVVSM-EKGKDWEISAEVVTKPEVKLGEYKDLAVEVEAKEV
TIG_STRA3       ENALNLVLPKAYEAAVAELGLDVVAQPKIDVVSM-EKGQDWKLTAEVVTKPEVKLGDYKDLSVEVDASKE
TIG_GEOBB       EDVVKNLVQESYFSAVSEQGLNPVGYPAIESNPL-KKGESFKYSATVEVFPEVEVKDYTGLAVVKEKLEI
TIG_GEOMG       SDVLKNLFDETYFKALADHKIFPVSHPHI-ESDEVKRGEALKYSATVEVFPEIDVKDYKGLEVKRERFVS
TIG_ENTFA       EDALNAVLPEAYEAAVLEAGIEPVAQPKID-VESMNKGEDWVITAEVTVKPEVKLGEYKNLTVSKQDREV
TIG_DEHSB       DELVDDIVPEACQKAIQDEEIKPFATPKV----AMVTTDPFVFSARIPLPPVVELGDYKTIRATKETVEI
TIG_CORK4       DQAINNMLPSRYSQAVEEHDLKVLTQPTIDITRL-EDNELVEFTAEADVRPEIDLPDFSTIXXXXXXXXX
TIG_DEHSC       DELVDDIVPEACQKAIQDEEIKPFATPKV----AMVTTDPFVFSARIPLPPVVELGDYKTIRATKETVEI
TIG_RUBXD       MEALQESLPAWYSRAVIDADIRPIDRPEIHFDDPLDEKKGFRFSATVEVRPEARLGEYKGLEVPKXXXXX
TIG_GEOUR       DDVLKNIINDTYFKALMDENIYPVSHPVI-ESDELKVGESFKYSATVEIFPDVVVKDYTGLEVKKEKYVF
TIG_STRCO       EEAVNDALPKFYTDAVNEAELNPLGQPEVDITELKD-GETLNFTAEVDIRPSIEIPDYSGIXXXXXXXXX
TIG_BIFAA       GEAVNNGVPELYSKALETKKIHPMAQPEIDVQDVPESAKDETFVATVERRPDIELPALDGMEIEVAKAEV
TIG_FRASN       DEAIQEALPRLYSEAVQAEEVDVLSRPEVDITEFAD-GAQLVFTAEMDVRPEVTLPEFGELELVVEPATV
TIG_CLOD6       NDAIEILFPEVYPEAI-KXXXXXXXXXXXXXXXXXSKDNGLVMVLNVEVKPEFELGNYKGIEIAKVENTV
TIG_ACIC1       EQALNDAIPQFYGQAVDEAAVAVISQPEIEVTNFAD-GEGLTFTAEVDVRPTIELPDPESITVTVDPVTV
TIG_THETN       EDAIEYVFHEAYQEALKTFNLEPVDYPDINILQ-IGKGKDLVLEATVAVMPEVELXXXXXXXXXXXXXDV
TIG_MYCLE       DQVVNEAMPSRYGQALAESEVQPIGQPEI-EVIRKEYGQDLAFTVEVEVRPKIALPDFSTLKVVVPVEVS
TIG_MYCLB       DQVVNEAMPSRYGQALAESEVQPIGQPEI-EVIRKEYGQDLAFTVEVEVRPKIALPDFSTLKVVVPVEVS
TIG_ERYLH       AQVINDSIRDSVDALIKEKELRPAMQPKIDLNEDYEQGKDAVVSVSLEILPKVEAPSIDDLKLERLTVPV
TIG_THEFY       TQAVNHAVPELYSEAVSKXXXXXXXXXXXXITRL-EDGKELAFTAEVDVRPKFEVTDYEGIXXXXXXXXX
TIG_GEOLS       NAMQDEVMRRLYEQALDEHKLEPVDAPMIDDIALVEEGTPFKYSALIEIMPQILLGEYKGLQVKKERYVA
TIG_STRMU       EEALNSIXXXXXXXXXXXXXXXXXTQPKVDVKSM-EKGKDWEITAEVVTKPEVKLGDYKNLEVSVESKEV
TIG_CLOK5       EDAMSFCCESTYPDALKENNVNPVDYPKIEVVQIGE-GKEFIYTAEVTVFPEVKLGEYKGVEVKKNTYDV
TIG_CLOK1       EDAMSFCCESTYPDALKENNVNPVDYPKIEVVQIGE-GKEFIYTAEVTVFPEVKLGEYKGVEVKKNTYDV
TIG_DESPS       AELSEKLVQENYFNAVEKEGLDPVTHPEIQVVKYNEDGS-FTFEAHVDVRPDFELGNYKGLEIEKPXXXX
TIG_ONYPE       SDALENIVQTKYQEVLQKKDFESMGMPQVIDLDKLKDNQNFTFGLEFIVKPKVTLKKYLGLEITKDDLEV
TIG_THERP       AEAQRELMDRLYREALQQHRLTPVAEPEVE----IYQDEPLAFRVEVQVYPQVDLDGYRDXXXXXXXXXX
TIG_SYNS9       ATALEKLIDSAWRDAIKQESLEPISQPDLSSDGLLESGDELTFTLEADVAPTPKLKSTKGLKAEYEAVVY
TIG_LACBA       QDALNIVLPEAYDAAIKEAGIEPVDQPQVD-VESMDKDQPWVLKAVVTVKPDVKLGEYKGLSVTKQNTRV
TIG_HERAR       NEVLNDKVGQAFGEATSENKLRVAGYPKIEAKNDDVAEGTLAFNATFEIYPEIKVGDLASAEVEKTIVEV
TIG_EXIS2       QDALDILYQDTIEGAVVESGIEPIALDNID-VETLEKGKPVEFKITFVIEPDATLGEYKGLEYXXXXXXX
TIG_CHRSD       NEVVGEMMRQHYVQAITQESLNPAGSPQVEPT-VDEDGKDLEFVATLEVYPEFELNSIENTEIERPQAEV
TIG_THEPX       EDAVEYVFDEAYKEALKTFNLEPVDYPDINILQ-IGKGKDLILEATVPVMPEVELXXXXXXXXXXXXXNV
TIG_THEP3       EDAVEYVFDEAYKEALKTFNLEPVDYPDINILQ-IGKGKDLILEATVPVMPEVELXXXXXXXXXXXXXNV
TIG_ALHEH       GEVLSELVQSTYSEALREKELRPAGNPEI-EPKQTEEGKDLEYQATFEVLPSFEVTGLDQIKVERPQVEI
TIG_KINRD       EEAVNDALPKFYQQAVEASDFLPLGQPTVDVSQAPDPGGDLKFSVEVDVRPVLELPDLESIAVTVDDLQV
TIG_VIBCM       QDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVEIGE-GKDLVFTATFEVYPEVELKGLENIAVEKPAAEV
TIG_VIBCH       QDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVEIGE-GKDLVFTATFEVYPEVELKGLENIAVEKPAAEV
TIG_VIBC3       QDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVEIGE-GKDLVFTATFEVYPEVELKGLENIAVEKPAAEV
TIG_SYNFM       QEVSSQFIQETFPEALKETDLKPLVEADVSETHFNDSGS-FSYTAIVDVCPPFELEGYRGLEIRKPSIDV
TIG_SACD2       QEVLGDAINRSFYDAVRKESLRPAGQPAIEPKQL-EPGKDIEFVATFEVYPEIEVSGLESIEVTRYNAEV
TIG_RHOPT       AETIDKLVRDTFRLATEPKITMPQDQKEIE--DILEGKSDLTYTVAIEVVPAIELADFKSFSVEKPXXXX
TIG_DESVV       AEATQDLVNVHINEIVTSLEVSPLSRIDFDGGEL-ERGKEFSYTISFEVMPQFDLPDYEGFXXXXXXXXX
TIG_ANAVT       AAALEELLQDGIEQAIKQESIAAIGQPRLRSSDLIEPGQPLTFTAAVDVEPEINLVQYTGLEAKAEEIKY
TIG_TREDE       GDLAGDLIEESLKEIFESLDEYPYSYPELNEKPELKVEEDFSFTVHYDVFPKVEIKKTEGFTIEVPEASV
TIG_LACSS       EDALNAVLPEAYEAAVAEAGIDPVDQPQIN-VEKMEKGEAWVLTAQVTVKPEVKLGDYKGLEVPKQSRRI
TIG_LACCB       EDALNILLPDAYEAAVKESGIDPVDQPQIN-VDSMDEGKPWVIKATVTVKPEVTLGQYKGLEVPKQNVEV
TIG_LACC3       EDALNILLPDAYEAAVKESGIDPVDQPQIN-VDSMDEGKPWVIKATVTVKPEVTLGQYKGLEVPKQNVEV
TIG_THICR       QEMMGETVQQSFYDAVAKESLNIAGYPQFQELD--EKDGHIVYSATFEVFPEVELPKFSSLKVETVTSEV
TIG_PSEHT       QEVAGEVMQRNFYEAIVSEKINPAGAPTFAPKAL-EAGKDLEFSATFEVYPEVEVQGLDKITVEKPAVTV
TIG_MARAV       QEVVGEAMRDNYIKALQEQDINPAGWPKL-EPKTMEEGKDLEFVATFEVLPEIELGDLSKINVEKPVSEV
TIG_AZOC5       AEVIEQAVTEANGKIVEDNGLRLALPPEDEVKSVIEGQADLKYTVELEVLPKIELGNFKDIAIEKPVAIV
TIG_ANASP       AAALEELLQDGIEQAIKQESIAAIGQPRLRSSDLIEPGQPLTFTAAVDVEPEINLVQYTGLEAKAEEIKY
TIG_DESVH       AEATQDLVNVHINEIVTSLAVSPLSRIDFDGGEL-ERGKEFSYTISFEVMPQFDLPDYEGFXXXXXXXXX
TIG_DESDA       EEARQDLINVHINDVMQKLDVMPLAGLDVDTPDAFERGKGFAYTIEFEVLPTFDLPPYEGMXXXXXXXXX
TIG_ZYMMO       DALNKALQDGVQKL-LSDKGEKPAMQPEIELTEGYELGKDAELKVKFEILPEVPEISFDDLKLERLTVEA
TIG_PELPD       DEVMRRFYETTLFKTLAEHKIEPIDAPTV-ECDILEEGTPFKYSALVEVMPEVLLTQYTGLEITKERYVF
TIG_ALCBS       NEVLADVMREAFIEAVEQEKLQPAGMPGFEATTN-EAGKDLEFVATFEVYPQVELAAFDSIEVEKPQSEV
TIG_RHOPB       KLITNDQIERGFRLATEPKITMPSKENEVEE---ILAGKSLNYTVAVEVVPTIELADFKSFSVEKPVAEV
TIG_NOVAD       TTIRE-----AMDKLVADNKLRPAMQPAVSLGEGYDEGKDAELTVELEVLPQIEAPSLDGLKLEKLVVPV
TIG_THISH       QEVVGEVLQSSYQEALLQEKLEPAGSPSIEPKPL-EPGKGLEYTATFDVFPKVEIADLSDVAVERPRVEV
TIG_SYNJA       ASAVDDLINEAIQQALKDTQLHPISRFELDDEQLLDRFNPFSFSGYVEVYPEARVGQYKGLTVTATRVTV
TIG_VIBSL       QDVMGEVMQRHFIEAIVKEKINPAGAPTFAPVENNE-GADLVFNATFEVYPEVELKGLENITVEKPAVEV
TIG_SYNSC       ATALEKLIDNAWRDAIQQESLEPISQPDLSSLESFEPGKELTFTLEADVAXXXXXXXXXXXXAEFETVAY
TIG_ROSS1       EEASDDLIQKAFQDALKQEGIEPYAQAHLTDVNLTEA--PYRFTVEVPVAPTVVLPDYRAIHVPLEIEEV
TIG_SYNJB       ASAVDDLINEAIQQAFKEAQLTPISRFELDDEQLLAQFNPFSFSGYVEVYPEARVGQYKGLTVTATRVDV
TIG_RENSM       ETAINEGLNGWYQNAVAETGLRPLSRPEVEITEVPDPAAELKFKVEVDVRPEVELPDYAGITVEVAPAEQ
TIG_LARHH       EDVLGEQVQLGFSKAVAEQKLRVAGYPRFEPADNDPAAGEFKFSATFEVYPELTLGSLDGKEVEKAVCEV
TIG_DICNV       QDVLGDEIDRSYREIISKSDYAPVAPPQIELISGFKEGEALKFEAIFEVMPEVVVNGLDALDITLPDAQL
TIG_THEYD       ADVLEKLVSESYQKAVKETKIKPLLPPMAEDAIDIKRNEPLSFELVVEVRPDIENLNYDNXXXXXXXXXX
TIG_CHRVO       EVMGEQVQQGFYK-AVTEQSLRVAGYPRFEPVAAGDDKESFKFAATFEIYPEVKVGELAGKEIEKPNTVV
TIG_STRSY       QDVVNXXXXXXXXXXXXXXXXXXXXQPKIDVVSM-EKGQDWTITAEVVTKPEVKLGDYKNLAVSVEAKEV
TIG_STRS2       QDVVNXXXXXXXXXXXXXXXXXXXXQPKIDVVSM-EKGQDWTITAEVVTKPEVKLGDYKNLAVSVEAKEV
TIG_JANMA       NEVLNDKVGRAFNEAASENNLRVAGFPKIEKTDDAAAEGTIVFNATFEVYPEVKLGDLAAADVEKTTVEV
TIG_DESOH       ADVSIQLIQSSLPNAIREKALNIIGDPQINPSVLSEEG-PFTYSATIEIKPEIDDIDFKGLTLKKPLYAC
TIG_PSEU5       QEALGDLIQSTFYEAIVAEKLNPAGAPSV-EPKVFEKGKDLEYVATFEVFPEFEVAGFEAIEIERLQAEV
TIG_NITOC       QEVSDEFVRDSFRDAIKQESLRPAGMPQIEPPQL-EAGESFAYTVTFEVLPEIESVKLEGIKIKQPRAEV
TIG_LACAC       EDALNIVLPNAYAAAVKEAGINAVGQPQIVPVSM-DKDKDWTMKATVTVQPEVELGEYKGIEVPKQNTRV
TIG_IDILO       SRAASSIMQSKYFEAVMQEKLNPAGAPAI-EPKVNEPGKDLEFTATFEVYPEVEVQNLDKVKVEKPAVEV
TIG_CLAMS       EHAVNDGMDGFYQAAVKETDIRPLGRPEADVKEW--PGKDLTLEIEVDVRPEFDLPAYEGLXXXXXXXXX
TIG_BEUC1       EHAVNDALPDFYRQAVTESELKVLGQPEVEVTGVPDTSGELTFTAEVDVRPDFTLPXXXXXXXXXXXXXX
TIG_PSEPF       QEAIGDVIQSSFYEAVVEQKLNPAGSPSIEPKSL-EAGKDLEYVAVFEVFPEFTVAGFEGITVERLSADV
TIG_LACLS       EEALNAVLPTAYDAAVKEAAIEPVAQPKIDVAKM-EKGSDWELTAEVVVKPTITLGDYKDLTVEVDAKEV
TIG_THET2       QDLKERLVEETYPEAVRELGLSPVA-ARVVEQDLSE-GEGFRYVAEVENYPEVRLPDWRSFALEVSPPEV
TIG_MAGSM       AEVAEQLFRDSYPTALMEKGLRPVGQPELDLVEL-EKGKPFTYTAKIQIFPVIEPKDYTGMSLTKPVVTI
TIG_LACLM       EEALNAVLPTAYDAAVKEAAIEPVAQPKIDVAKM-EKGSDWELTAEVVVKPTITLGDYKDLTVEVDAKEV
TIG_ECOSE       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO24       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_CLAM3       EHAVNDGMDGFYQAAVKETDIRPLGRPEADVKEW--PGKDLTLEIEVDVRPEFDLPAYEGLXXXXXXXXX
TIG_VIBVU       QDILGEVMQRHFIEAIIKEKINPAGAPTFAPVENKE-GSDLVFNATFEVYPEVELKGLENITVEKPAVEV
TIG_RHOCS       GEVLEQAVNDGSAKAVEEHKLRPALQPKVEVTKF-EAGSDLEFSMAVELLPDFEPADMAAIAVEKPVVEV
TIG_COXB2       QEVGSELIQSSLREAVEEHQLQVAGAPDI-KMDKILRGEPFKYVVNFEVYPEITLESLAGETIERTQVEI
TIG_COXB1       QEVGSELIQSSLREAVEEHQLRVAGAPDI-KMDKILRGEPFKYVVNFEVYPEITLESLAGETIERTQVEI
TIG_SHISS       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_SHIFL       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_SHIF8       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_SHIDS       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_NOSP7       AAALEELIQDGIEQAVKQEAIPAIGQPQLRSSDLIEPGKPLTILAAVDVEPEVNLVQYTDLLFQAEEVKY
TIG_MANSM       DVLNDLLPRHFFDLAFKE-KVNLAGRPTF-AVENYEEGKDLQFTATFEVYPEIQLQGLENIKVEKPVVEI
TIG_LACLA       EEALNAVLPTAYDAAVKEAGIEPVAQPKIDVAKM-EKGSDWELTAEVVVKPTVSLGDYKDLTVEVEAKEV
TIG_LACF3       QDALNDVLPDAYEAAIKEAGIEPVDQPQVN-VESMEKGQPWTLTATVAVKPEVTLGDYKGMEVPEQDTSV
TIG_ECOUT       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOSM       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOLU       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOLI       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOLC       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOK1       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOHS       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECODH       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOBW       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO8A       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO81       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO7I       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO5E       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO57       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO55       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO45       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECO27       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_DELAS       YEVLNDKVGEAFAQAVNEAKLRVAGQPRISEKEGAPEGEA-QFEAIFEVMPEVKIGDLTSAEVEKLTAEV
TIG_CELJU       QEVVGDVINRSFYAAVQKENLKPAGQPSIQPKQL-SAGQDLEYIAVFEVYPSVELSDLSVFEITRHKAEV
TIG_BORPD       YDVINGQVGRAFEQAVDGAKLRVAGSPTLEPKTEGVADDTLAFTATFEVYPEVAVPDLSALSVTRYETAV
TIG_ACIAC       YEVLNDKVGEAFAQAANEANLRVAGQPRITEKEGAPEGQ-VTFDAVFEVFPEVKIGDLSTADVEKISADV
TIG_NEIG1       DVINELVQRRFYDVAVAQ-ELKVAGYPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_PELUB       SEVLDKVLKDTSVKALEDNKIKPAGQPKLDLKTYGE-DKDLEYVMSITELPKVELKSVENIKFDEYSVKI
TIG_HALHL       SEVLSEVVQQTYSEALEQESLRPAGNPHIEPKRTGE-GEDLEYEASFDVLPEIEVAGLDQIQVERPQVEI
TIG_DESAD       EATTD-LINYQINDILNGQSLVPVSKIDVDAKELVR-GEDFSYVIKFEIVPEFDTPGYLGLPVXXXXXXX
TIG_BORA1       YDVINSQVARAFEQAVEAAQLRVAGSPSLEPKTEGVDENTLAFSATFEVYPEVAVPDLSDLAVTRYETEV
TIG_SHEAM       QDVTGEIMQRNFVEAIIAEKLNPAGAPTF-MPGASDADK-FEFVATFEVYPEVELKGLDAIEVEQPKADV
TIG_SALPC       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALCH       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_RHOPA       AETIDKLVRDTFRLATEPKITMPQDQKEIE--DILEGKSDLTYTVAIEVVPAIELADFKSFSVEKPXXXX
TIG_PSEF5       QEAVGDVIQASFYEAVVEQKLNPAGAPSV-EPKVLEKGKDLEYVATFEVFPEFTVAGFENIAVERLSADV
TIG_DESAH       ADLVPHLVQNAFSEALDEHKFNLVGGPQVDPPELTP-GEALSFDISIEVMPELEAVDFKGIELKKTMYEA
TIG_MESSB       AEVVNEILNDSSRTIISDRGEKPAMQPEISMTEVLAGAADFEFSLSYEVIPPIEIKDLAGIKITRPVYDV
TIG_FRATN       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_ECOL6       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_ECOL5       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_COXBU       QEVGSELIQSSLREAVEEHQLRVAGAPDI-KMDKILRGEPFKYVVNFEVYPEITLESLAGETIERTQVEI
TIG_SHIBS       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_SHELP       QEITGEVMQRNFIEAIIAEKLNPAGAPTFGETD----AENFQFVATFEIYPEVELKGLDAIEVEQPTAEV
TIG_SHIB3       QDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEV
TIG_RHOP5       AEVLEKLIRETFRLATEPKITMPTEAKEVE--DVLAGNADLNYTVAVEVVPEIQLVDFKTISVEKPVVEV
TIG_NEIG2       DVINELVQRRFYDVAVAQ-ELKVAGYPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_MICAN       AAVIEELIENCLESALKQEGIESLGNPQLDLIAAYEPGKALTFSVSLDVAPTIILGDYE--NLSVTAEET
TIG_HAEDU       QEVLSEEMQRTFFDAVISEKINLAGRPTFTPNN-YQLGQDFSFTATFEVFPEVELKGLENIEVEKPVVEI
TIG_ESCF3       QDVLGDLMSRHFIDAIIKEKINPAGAPNYVPGEY-KPGEDFTYAVEFEVYPEIELKDLETIEVEKPIVEV
TIG_CYAP8       ATTLQELIEDSLKAAIKQESLESIGKSKFDEVQQFKPGEPLTFSAAIDVPPTVTLGDYQSLSVKAEETVY
TIG_ACTP2       DVLSDEMQRAFFDAVIAE-KINLAGRPTFTPNN-YQPGQEFSFTATFEVFPEVELKGLENIEVEKPVVEI
TIG_VEREI       YEVLTNKVGEAFTVAANEANLRVAGRPRITETQGTAEGH-VTFDAIFEVFPEVRIADLANVEIEKLSTEV
TIG_SYNE7       ANAIEDLVQQSLESAIAQESIPAIGNYQLDFETLVAAGESFSFEASVDVQPTATLAQYTGLTVEV-AEVP
TIG_RHOFD       YEVMNDKVGEAFFNAANEAKLRVAGQPRISESEASPEGE-MAFDAVFEVYPDVKIGDLSTAEVEKISAEV
TIG_OPITP       KDITDEVVTKAYGLEKQKLDVLTVVNVEPGE---VAQGKPASVTITVDVRPDFKLPDYVGLPTSVAPSEA
TIG_LACGA       EDALNIVLPEAYAAAVKEAGIDPVGQPQITPVSM-DKNKPWEMKATVSVKPEVKLGDYKGIEVPKQSTRV
TIG_ACTSZ       EALNDLLPRHFFDLAFKE-KLNLAGRPTF-AVENAESGKDVVFTATFEVYPEVELKGLENIKVEKPVVEI
TIG_ENT38       QDVLGELMSRNFIDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKGLETIEVEKPVVEV
TIG_AZOBR       AEALEDAIADSSRQALNERGLRIAMQPKIN-VEKYEDGGDLSYTMGVELLPDIEPGDLSGLELEKPVATV
TIG_SYNP6       ANAIEDLVQQSLESAIAQESIPAIGNYQLDFETLVAAGKSFSFEASVDVQPTATLAQYTGLTVEV-AEVP
TIG_SHEHH       QDITGEVMQRNFIEAIIAEKLNPAGAPTF--TPGSTEGENFEFVATFEIYPEVELKGLESITVEQPTAEV
TIG_SALTY       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALTI       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALNS       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALHS       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_ROSDO       GEAMQESIDGAMNDHFTSSGDRPAMQPEVKMTENWKEGDDIEVSMSYEALPDIPDVDFSAIELERMTVKA
TIG_CITK8       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KLGEDFTYAVEFEVYPEVELTGLESIEVEKPVVEV
TIG_ANADE       GEVAERIVTETFTEAVRVESLPVVAPPSVSITDGVAEGKPMRYSARVEVKPKLEPKDYKGLEVTRKPPEV
TIG_SALSV       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALPK       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALPB       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALPA       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALG2       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALEP       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALDC       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_SALA4       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_PECCP       QDVLGDLMQRNFVDAIIKEKINPVGAPNYIPGEYAVGGD-FTYSVEFEVYPEVELKGLDAIEVEKPVVEV
TIG_NEIMB       DVINELVQRRFYDVAVAQ-ELKVAGFPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_BURVG       EVLSDKIGQEFFTISRAE-NLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_BURCM       EVLSDKIGQEFFTISRAE-NLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_ARTAT       ETAINDGLNGWYQAAVQETGVRPLSRPEVEITEVPDPSAELKFQVEIDVRPEIELPDYAGIXXXXXXXXX
TIG_SERP5       QDVLGDAMQRSFVDAIIKEKINPAGAPNYVPGEYKE-GEDFTFAVEFEVYPEVELKGLDGIEVEKPVVEV
TIG_SALAR       QDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEY-KVGEDFTYSVEFEVYPEVELTGLESIEVEKPVVEV
TIG_ENTS8       QDVLGDLMSRHFVDAIIKEKINPAGAPNYVPGEY-KLGEDFTYAVEFEVYPEVELKGLESIEVEKPVVEV
TIG_VIBHB       QDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVENNE-GADLVFTATFEVYPEVELKGLDSITVEKPTTEV
TIG_SILST       GEVMQEAVDGAMNKHFEESGDRPALQPDWKEGDDVNVEMSYE---ALPAIPEVDVSGVELEKLVVKAE--
TIG_PSYWF       QEVINDVIRDTVFEAIKAEDVRAVGMPNIDDVKLED--EFLVYQATVEIFPEIKVEGMSDIEVERHTATI
TIG_DESMR       SEATTDLINVHINEIMGELKLSPLSGLDVSEAALTK-GEPLEYTFSFEHAPAFDLPEYKGQXXXXXXXXX
TIG_BURCC       AEVLSDKIGQEFFTVSRAENLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_ACTPJ       DVLSDEMQRAFFDAVIAE-KINLAGRPTFTPNN-YQPSQEFSFTATFEVFPEVELKGLENIEVEKPVVEI
TIG_ACTP7       DVLSDEMQRAFFDAVIAE-KINLAGRPTFTPNN-YQPSQEFSFTATFEVFPEVELKGLENIEVEKPVVEI
TIG_SYNPX       ASALETMVDGAWRDAIQQESLEPISQPELSGLDSFTPGEAVTITLEADVAPTPKLKSTKGLKASFEPVAY
TIG_SPHAL       DALNKAIDAGVRDLMAKE-KLRPALQPAVTLADGYEAGKDAELTVALEVLPEIETPSIDGLKLERLTVPA
TIG_PSEAE       QEAMGDLIQETFYEAVVEQKLNPAGSPSVEPKSF-EKGKDLEYIATFEVFPEFTVSGLEDIKVERLQAEV
TIG_PSEAB       QEAMGDLIQETFYEAVVEQKLNPAGSPSVEPKSF-EKGKDLEYIATFEVFPEFTVSGLEDIKVERLQAEV
TIG_PSEA8       QEAMGDLIQETFYEAVVEQKLNPAGSPSVEPKSF-EKGKDLEYIATFEVFPEFTVSGLEDIKVERLQAEV
TIG_NITMU       QEVMEDVLKKNFSEAVRENNLYPRFEPKLAESDTAQV----EFSATFEVYPDITLGDLGGAHIERPVVEV
TIG_NITHX       ETIEDTIRDTNMQIATDRAGNPKVTMPEVKEIEDILAGKDLSYSVAIEVVPAIELADFKTFSLEKPXXXX
TIG_LACH4       EDALNIVLPNAYSAAVKEAGIAAVGQPQIVPVSM-DKDKDWTMKATVTVEPEVKLGDYKGIEVPKQNTRV
TIG_FRAP2       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKEN-KKGEPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_BURCH       AEVLSDKIGQEFFTVSRAENLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_BURCA       AEVLSDKIGQEFFTVSRAENLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_BURA4       EVLSDKIGQEFFTISRAE-NLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_VIBVY       QDILGEVMQRHFIEAIIKEKINPAGAPTFAPVENKE-GSDLVFNATFEVYPEVELKGLENITVEKPAVEV
TIG_MAGSA       GEILENAVNDGAGKAITDGGLRPAMQPKIEITK-YEENSDLEFTVAVEVLPEIKTMDFGTINLVRDKAVV
TIG_HAES2       QDVLGDLLQKHFFNVMLENKVNLAGRPEFT-VEQFEAGKELKFTATFEVYPEVQLQGLDKIKVEKPVVEI
TIG_HAES1       QDVLGDLLQKHFFNVMLENKVNLAGRPEFT-VEQFEAGKELKFTATFEVYPEVQLQGLDKIKVEKPVVEI
TIG_PSE14       QEALGDLIQATFYEAVVEQKLNPAGAPAV-EPKSFEKGKDLEYVATFEVFPEFTVAGFDTIAVERLSADV
TIG_NITSB       QDAEAELVREALDQALEELGIEKLGEPRFAKYEKGE--EVIEMVLEIGVRPNIDITGYEEVIPEYEEPQV
TIG_NEIMA       DVINELVQRRFHDVAVAQ-ELKVAGFPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_NEIM0       DVINELVQRRFHDVAVAQ-ELKVAGFPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_TERTT       QEVLGDTIQRSFYDAVRQESVRPAGQPSIEPKQMDE-GKDVEYIATFEVYPEVELKELDNIEITRYDAEI
TIG_SHESW       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----SEKFEFVATFEIYPEVELKGLDAIEVEQPKASV
TIG_SHESR       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGATD----GEKFEFVATFEIYPEVELKGLDAIEVEQPKASV
TIG_SHESM       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGATD----GEKFEFVATFEIYPEVELKGLDAIEVEQPKASV
TIG_SHEPC       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----SEKFEFVATFEIYPEVELKGLDAIEVEQPKASV
TIG_PSEU2       QEALGDLIQATFYEAVVEQKLNPAGAPAV-EPKSFEKGKDLEYVATFEVFPEFTVAGFDSISVERLSADV
TIG_PSEA7       QEAMGDLIQETFYEAVVEQKLNPAGSPSVEPKSF-EKGKDLEYIATFEVFPEFTVSGLEGIKIERLQAEV
TIG_ERWT9       QDVLGDLMQRNFVDAIIKEKINPAGSPQYVPGEY-KIGEDFTFSAEFEVYPEVELQGLDAIEVEKPVVEV
TIG_BORBU       ATVLEEVINNSFKEFFKEESKIPLATPTVKEXXXXXXXXXFEFTFTYETYPEFKIPSFDEIDIEIPEVFI
TIG_BARBK       AEVLNEIINDAPRSILVDRNERSAVQPQIDDQKVLDGEADFIFNLKYEVLPEFEIKDFKDIEITREIADV
TIG_AZOSB       SEAIGAAVERAFGEKVREQNLRVAGYPRIEPKEAGSEGA-LEFSAVFEVYPEVVVGDLSAQSIEQPTLVV
TIG_ARTCA       ETAINDGLNGWYQAAVQESGIRPLSRPEVEITEVPDPSATLKFAAEVDVRPEIELPDYAGIXXXXXXXXX
TIG_PSESM       QEALGDLIQATFYEAVVEQKLNPAGAPAV-EPKSFEKGKDLEYVATFEVFPEFTVAGFDTIAVERLSADV
TIG_PASMU       HDVLGDVLQSHFFNVVMEQKVNLAGRPAF-AVEQFEAGKDLVFTATFEVYPEVALQGLDQIKVEKPVVEI
TIG_KLEP3       QDVLGDLMSRHFVDAIIKEKINPAGAPNYVPGEY-KLGEDFTYAVEFEVYPEVELQGLDAIEVEKPVVEV
TIG_HAHCH       QEVIGEMMRDAYVEALQKEDLNPAGYPKF-EPKKIEDGEDLEFIATFEIYPEVSIGDLSSISVEKEDFEI
TIG_HAEPS       DVLSEEMQRAFFDVVIAE-KINLAGRPTFTPNN-YQPGQDFSFVATFEVFPEVELKGLENIEVEKPVVEI
TIG_AKKM8       EELLDTLFETACSTALEENPKLKVLSFGKPEQSLDDQGN-YTATSTMTVVPEFELPEYKGIEVKVPSSEV
TIG_ACIBL       EEIVRTLIPHYFREETGKQNLQPVSQPQVTDLHLHD-GEPLKFTAEFEILPEIPTTGYENIKVEHPPVEV
TIG_STRT2       DDXXXXXXXXXXXXXXXXXXXDVVAQPKID-VKSIGKGQDWTLTAEVVTKPEVKLGAYKDLEVSVESKEV
TIG_STRT1       DDXXXXXXXXXXXXXXXXXXXDVVAQPKID-VKSIGKGQDWTLTAEVVTKPEVKLGAYKDLEVSVESKEV
TIG_SHESH       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGDTDT----ENFNFVATFEIYPEVELTGLDAITVEQPTSEV
TIG_RHOPS       AETIDKLVRETNDGIFAERGFRLATEPKIQDQKVVEAGKSLNYTVAIEVVPTIELADFKSFSVEKPVVDV
TIG_POLNA       YEVMNDKVGEAFAVAANEAKLRVAGQPRISEKEDAPEGE-LAFDAIFEVYPDVKIADLANAEVEKLSAEV
TIG_METFK       NEVLSNAVERSFSDAVEQNKLRVAGYPHIEHKPYAENDPQIEYVATFEVFPEVNIGDLSKAKIERPVLEV
TIG_HERA2       EEATDEIINVAFRAALEQENIKPVAQASLEKLE----PEPFRFRILVPVEPEVILPDYKAITVDLTEEPV
TIG_FRATT       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_FRAT1       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_VIBPA       QDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVENKE-GADLVFTATFEVYPEVELKGLENITVEKPLTEV
TIG_STRTD       DDXXXXXXXXXXXXXXXXXXXDVVAQPKID-VKSIGKGQDWTLTAEVVTKPEVKLGAYKDLEVSVESKEV
TIG_SHESA       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGATD----GEKFEFVATFEIYPEVELKGLDAIEVEQPKASV
TIG_SHEPA       QDIMGEVMQRNFVEAIIAEKLNPAGAPTL--TPGSTEGENFEFVATFEIYPEVELKGLESITVEQPTAEV
TIG_SHEB9       QDIMGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----GEKFEFIATFEIYPEVELKGLDAIEVEQPKAEV
TIG_SHEB8       QDIMGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----GEKFEFIATFEIYPEVELKGLDAIEVEQPKAEV
TIG_SHEB5       QDIMGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----GEKFEFIATFEIYPEVELKGLDAIEVEQPKAEV
TIG_SHEB2       QDIMGEVMQRNFIEAIIAEKLNPAGAPTFGSTD----GEKFEFIATFEIYPEVELKGLDAIEVEQPKAEV
TIG_RICBR       NDIIEKRINDSVNHVIKEHNLNIIGRPKIDDLQ-NEPNKPLEFTIKMELLPKIDIPDLKKISINRPKLEV
TIG_RICB8       NDIIEKRINDSVNHVIKEHNLNIIGRPKIDDLQ-NEPNKPLEFTIKMELLPKIDIPDLKKISINRPKLEV
TIG_POLSJ       YEVMNDKVGEAFAVAANEAKLRVAGQPRISEKEGAPEGE-LVFDAVFEVYPDVKIADLTQAEVEKVSAEV
TIG_METS4       ADVVQNAVNEANQKILEENKLKLALEPQIDKAEILDAKADLAFQVALEVMPTFELQDHSDITVTKPVATV
TIG_DIAST       YEVLNDKVGEAFAQAANEANLRVAGQPRITEKDGAPEGE-VTFDAVFEVFPEVKIGDLSTAEVEKLSAEV
TIG_CUPTR       EVRFDKAARKFFDITKEQ-DVKVAGQPKFEIKNEGVGEDEVAFDATFEVYPEVTIGDLSAAEVTRTSTEI
TIG_BURCJ       EVLSDKIGQEFFTISRAE-NLRVAGQPSF-EPKQEQAEDAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_ACISJ       YEVLNDKVGEAFAQAANEANLRVAGQPRITEKDGAPEGE-VTFDAVFEVFPEVKIGDLSTAEVEKLSAEV
TIG_THET8       QDLKERLVEETYPEAVRELGLSPVA-ARVVEQDLSE-GEGFRYVAEVENYPEVRLPDWRSFALEVSPPEV
TIG_KLEP7       QDVLGDLMSRHFVDAIIKEKINPAGAPNYVPGEY-KLGEDFTYAVEFEVYPEVELQGLDAIEVEKPVVEV
TIG_HYPNA       GEVIDKLVNETNQKALEENSLRPAGTPNVDDIEKVVTGKELSYQMHVDVMPEFTPVDVSTLTIVRPVAEI
TIG_FRATW       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_SOLUE       QQVLESLIPTHLQKQLEAENLNVVGTPDISDVHFHD-NEPLRFKATFEVVPEIELGEYTNIEVPYQDPEV
TIG_SHEWM       QDITGEVMQRNFVEAIIAEKLNPAGAPTFGESD----AENFQFVATFEIYPEVELKGLEDIAVEQPTSDV
TIG_NEIMF       DVINELVQRRFHDVAVAQ-ELKVAGFPRFEGVEEQDDKESFKVAAIFEVFPEVVIGDLSAQEVEKVTASV
TIG_HAEI8       QDVLNDLLPRHFFDAVIAEKINIAGRPTF-AIETFEEGKDLVFTATFEVYPEVKLQGLENIKVEKPTVEI
TIG_ERWCT       QDVLGDLMQRNFVDAIIKEKINPVGAPNYTPGEYAVGGD-FTYTVEFDVYPEVELKGLEAIEVEKPVVEV
TIG_BURM1       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKQ-EQSDDAYAFDATFEVYPEVKIGDLSTAEVERSTTTI
TIG_METPP       YEVMNDKVGEAFSKAANEAQLRVAGAPRISEKEGAPEGE-LAFDATFEVYPDVKIGDLSATEIDRVSTEV
TIG_HAEIN       QDVLNDLLPRHFFNAVIAEKINIAGRPTF-AIETFEEGKDLVFTATFEVYPEVKLQGLENIKVEKPTVEI
TIG_HAEIE       QDVLNDLLPRHFFDAVIAEKINIAGRPTF-AIETFEEGKDLVFTATFEVYPEVKLQGLENIKVEKPTVEI
TIG_FRATM       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_AGRRK       ADLVNEIVRDQPPAILTERGEKSATQPEVAMTEILAAEADFEFTLSYEVIPAIELKSVKGVKVTREVAEI
TIG_XANP2       SEVIEQTVNETNGKIVEELALQPKVKPEEDPQGLLEGGKDLAYDLEIEILPKIELGNFKDISVEKLVVEV
TIG_HAEIG       QDVLNDLLPRHFFDAVIAEKINIAGRPTF-AIETFEEGKDLVFTATFEVYPEVKLQGLENIKVEKPTVEI
TIG_FRATH       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_BORPA       YDVINSLVGRAFEQAVDGAKLRVAGSPTLTPKTEGVADDTLAFTATFEVYPEVTVPDLSALAVTRYDTPV
TIG_BORBR       YDVINSLVGRAFEQAVDGAKLRVAGSPTLTPKTEGVADDTLAFTATFEVYPEVTVPDLSALAVTRYDTPV
TIG_ANADF       SEVLEKIVQQTFAEAVKVESLPLVAPPHVSVSEGVADGKPIRYTARVEVKPAIAPKDYRGLEVTRKAPEV
TIG_RHIEC       ADLVNEIVREQPAAILSSRGEKSATQPEIDEADILTAQQDFEFTLSYEVLPPIELKSVKGIKVTREVIDI
TIG_PSEMY       QEALGDLIQATFYEAVVEQKLNPAGAPAVEPKSF-EKGKDLEYVATFEVFPEFEVTGFDSIAIERLQADV
TIG_BURS3       EVLSDKIGQEFFTISRAE-NLRVAGQPSF-EPKQEQAEGAYAFDATFEVYPEVKIGDLATAEVERSTTSI
TIG_PSEE4       QEVFGDLVQASFYEAVVEQKLNPAGAPAVEPKSF-EKGKDLEFVAIFEVFPEFTVAGFESINVERLSAEV
TIG_PHOPR       QDILGEVMQRHFIEAIVKEKINPAGAPTFTPVDIAE-GKDLVFKASFEVFPEIVLAGLDQIAVEKPAVEV
TIG_SHEON       QDITGEVMQRNFIEAIIAEKLNPAGAPTFGATD----GEKFEFVATFEIYPEVELKGLDAIVVEQPKASV
TIG_PSEPW       QEAFGDLVQASFYEAIVEQKLNPAGAPAVEPKSF-EKGKDLEFVAIFEVFPEFAVAGLESISVERLSAEV
TIG_PSEPG       QEAFGDLVQASFYEAIVEQKLNPAGAPAVEPKSF-EKGKDLEFVAIFEVFPEFTVSGLESINVERLSAEV
TIG_PROMH       NDVLGDLMQRNFINAIIENKVNPVGAPDY-KPEQYKEGEDFVYSVEFEVFPEIELKDLESIEVVKPIVTV
TIG_PARDP       GDAMQEAIDKALRDHLEKSGDRPALQPKIEMVETWKEGDDVVVTVAYEALPAIPEADLSGVELERLVVEA
TIG_BRASO       QTIRDTFTERGFRLATEPKVTMPTEEAEVEK--ILAGQSDLTYSVAIEVVPAITLADFKTFAVEKPVADI
TIG_BORPE       YDVINSLVGRAFEQAVDGAKLRVAGSPTLTPKTEGVAEDTLAFTATFEVYPEVTVPDLSALAVTRYDTPV
TIG_TOLAT       ADVADAVMQRHFVEALVAEKLNPVGAPTLEPNQLVP-GSDFTFTVSFEVYPEFKVQNLDAIKVEKPVATV
TIG_SILPO       ETI-DGAMNKHFEDSGDRPALQPEVKEDWKEGDDVEVAMSYE---ALPAIPEVDMSDIALEKLVVKAD--
TIG_PSEFS       QEAVGDVIQASFYEAVVEQKLNPAGSPSIEPKSL-EAGKDLXXXXXXXXXXXXXXXXXDGIAIERLSAEV
TIG_LEUCK       QEAMDIVLPAAYEAAVEEAGITPVGRPNIEPVSM-NKGEAWTLKAEVTTAPAIKLGEYLNLEVAAEDTAV
TIG_FRATO       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_FRATF       MEVISDLIPQKYSKAIQDEKL-AVAGIEVELKENKE-GQPLKFVANLELFPEFEVTGFEKIEVQKPVVEL
TIG_CAUCR       GEVIEQALNETTTKVLEDNKLRPAGQPELDMDKVIAGGEDLSFDLAVEVMPEFEPIDPTSIELVKPVYKV
TIG_CAUCN       GEVIEQALNETTTKVLEDNKLRPAGQPELDMDKVIAGGEDLSFDLAVEVMPEFEPIDPTSIELVKPVYKV
TIG_BURPS       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESTYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURP6       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESTYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURP1       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESTYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURP0       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURMS       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURMA       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURM9       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_BURM7       EVLSDKIGQEFFTISRAE-NLRVAGQPSFAPKEDTQQESAYAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_VIBFM       NDVMGEVMQRHFIEAIVKEKINPAGAPTFTPVEFAE-GKDLVFSASFEVYPEVALQGLXXXXXXXXXXXX
TIG_PSYCK       QEVINDVIRDTVFEAIKSEDIRAVGMPNIDDVKLEDDFLVY--QATVEIFPEVDVQGINEIEVERHTAKV
TIG_PSYA2       QEVINDVIRDTVFEAIKSEDIRAVGMPNIDDVKLEDDFLVY--QATVEIFPEIDIQGIDEIEVERHTATV
TIG_PSEPK       QEAFGDLVQASFYEAIVEQKLNPAGAPAV-EPKSFEKGKDLEFVAIFEVFPEFTVAGLESIKVERLSAEV
TIG_PSEP1       QEAFGDLVQASFYEAIVEQKLNPAGAPAV-EPKSFEKGKDLEFVAIFEVFPEFTVAGLESIKVERLSAEV
TIG_BORAP       ATVLEEVINNSLKEFFKEEPKRPLASPTIKEENLLNLDKDFEFTFVYETYPEFKVPNIDDIDIEVPEVFI
TIG_VIBF1       NDVMGEVMQRHFIEAIVKEKINPAGAPTFTPVEFAE-GKDLVFTASFEVYPEVALQGLXXXXXXXXXXXX
TIG_RHIE6       AELVNEIVREQPTAILSSRGEKSATQPEIDEADILSAQQDFEFTLSYEVLPPIELKSVKGIKVTREVIDI
TIG_RALEH       EVRFDKAARKFFDITKEQ-DVKVAGQPKFEIKNEGVGEDEVAFDATFEVYPEVTIGDLSAAEVTRTGTEI
TIG_PARL1       GDVIQETVGESSQQALQDESLRPAFQPSIDLEDVLDGKADLTFKMSFEVIPAFELSDFSKVSLERLTAEV
TIG_METSB       AEVVQEAVNEAHRKIIEDNALRPASQPKIDXXXXXXXXXXXXXTVALEVLPKIEIGSFEGVEIERLVAAV
TIG_COLP3       QEVAGEIMQRNFVDAIVAEKINPAGRPSFVAKSN-EDGKALEFEATFEIYPVVELKDLEKIAIERPEVDV
TIG_BART1       AEILNEILNDAPRSILADRNERPAMQPXXXXXXXLDGKADFTFSLKYEVLPKIEIKAFEHIEVIREIAAI
TIG_BARQU       AEILNEIISDAPRSILADRNERPAMQPQIDDEKILDGRADFVFSLKYEVLPKFEIKDFDHIEIIREIAAV
TIG_SHEDO       QDVMGEVMQRNFIEAIIAEKLNPAGAPTFMPGKSV--GESFEFVATFEIYPEITLTGLDTIAVEQPKAEV
TIG_PSYIN       QEVAGELMQRNFSEAVMAEKLNLAARPNF-EPQAREKGQDFTFTATFEVYPEVTLSPLEALSIEKDSAEV
TIG_BURP8       EVLSDKVGKQFFDISRAE-NLRVAGQPSFPKADAVEGD--YAFDATFEVYPEVKLGDVATAEIERTKTTI
TIG_AZOVD       QEALGELIQASFYEAVVEQKLKPAGAPSV-EPKVFEKGKDLEYVATFEVYPEFEITGLESIAVERLQAEV
TIG_SODGM       QDVLGDLMQRNFVDAIIQEKINPVGAPNYVPGEY-KTGEDFSYAVEFEVYPEVELMGLDTIEVEKPRVEV
TIG_PROMM       ATALESLVDAVWREVLEQESIEPLCEPEFDA--LLESFQPLTLTLETDVTPTPKLKATKGLQAEAEVVTF
TIG_NITWN       ETI-EDTIRDTNMQIVNDRGLKLAGNPKVEIEDILAGNSDLSYSVAIEVVPPIELADFKSFTIEKPXXXX
TIG_ARTS2       ETAINEGLNGWYQEAVQETGIRPLSRPEVEITEVPDTDGELKFHAEVDVRPEIELPDYSGIXXXXXXXXX
TIG_RHOS4       GDAMQDAIDGAMRDHLETSGDRPAMQPEVRMVDTWKEGTDVVVEMKYEALPEIPEIETSKVSLERLVVKA
TIG_RHOS1       GDAMQDAIDGAMRDHLETSGDRPAMQPEVRMVDTWKEGTDVVVEMKYEALPEIPEIETSKVSLERLVVKA
TIG_BORGA       ATVLEEVINGSFKEFFKEEPKRPLAPTIXXXXXXXXXXXXFEFTFTYETYPEFEIPSVDSIDIEVPEVFI
TIG_VARPS       YEVMNDKVGEAFSQAANEAKLRVAGQPRITEKEESPEGQ-LAFDAVFEVFPEVKINDLSNAEVELSAEVG
TIG_RHIL3       ADLVNEIVREQPAAILSSRGEKSATQPEIDEADILAAEQDFEFTLSYEVLPPIELKSVKGIKVTREVIDI
TIG_PROM9       ASALEKIIDKSWQEALKIKSIEPLSEPELFESLLAKFSPEKSLKFTLDVAPELKLKKSKGLSVEISKTKF
TIG_METEP       ADVLQNAVNEANQQIVTDKGLRLALEPQIEEQTIIEAKGDLAFKVKLEVLPSFELADLSDVSIKKLVLKP
TIG_METC4       ADVLQNAVNEANQQIVTDKGLRLALEPQIEEQTIIEAKGDLAFKVKLEVLPSFELADLSDVSIKKLVLKP
TIG_JANSC       ESV-DEAMQG----HLDESGDRPALQPEVKMTEDWKEGDDIVVSMAYEKLPEIPDVDYKAIKLEKLVVTP
TIG_GLOVI       AQALENLIDSSLKEAIEQESIASLGRDSFEELGRYQPGEPLSFKAAVDVQPEVQLGTYTGLTVRYSEVPY
TIG_OLICO       ETIRETFTDRGFRLANEAKVTMPTDQAEIE--GILDGKKDLTYSVAIEVVPPITLADFKTFKVEKLXXXX
TIG_LEPBL       DAINTLIVDGMASI-LTKLEHPMVRFPKFEIQD-YQPGKNLIATAVYETNPEITLGKYKKIKVKLPEVSV
TIG_LEPBJ       DAINTLIVDGMASI-LTKLEHPMVRFPKFEIQD-YQPGKNLIATAVYETNPEITLGKYKKIKVKLPEVSV
TIG_DEIGD       NEVRDRLLQVHYPQAARELKL-SLVDARIEPEPLV-SGQPFSFTVRGETYPEVTLGDWRAVQLTATAPEI
TIG_BARHE       AEILNEIVSDASRSILAERGERSAMQPKIDDKKILDGKADFIFSLKYEVLPKFEIKDFEHIEIIREIAVI
TIG_PSEA6       QEIAGEAMQRNFYEAIVQEKITPAGMPNFEKTDV--DGQDLEFVAAFEVYXXXXXXXXXXXXXXXXXXXX
TIG_METPB       ADVLQNAVNEANQQIVSDKGLRLALEPQIEEQTIIEAKGDLAFKVKLEVLPSFELADLSDVSIKKLVLKP
TIG_PROMP       ASALEKIIDKSWNQALKMESIEPLSEPELVDLKFFNPEKPLKITLQTDIAPEFKLKKSKGLSVEIKKSKF
TIG_METNO       ADVVQNAVNEANQKILEENKLKLALEPRIEMPEALDAKADLSFKVALEVMPTFDLVDHSDITLTKPXXXX
TIG_ACICJ       AEVMEASVNEATERMINDRSLRPAVQPKV-EVVRAEPDSDLEFTVELEVLPEVTIPDLKAISLTRPKAPV
TIG_YERPY       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPS       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPP       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPN       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPG       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPE       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPB       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERPA       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_YERP3       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGEYKQ-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_BURTA       EVLSDKIGQEFFTISRSE-NLRVAGQPSFPKQDAAQEGA-YAFDATFEVYPEVKIGDLATAEVERSTTTI
TIG_PROM2       ASALEKIIDKSWQEALKIKSIEPLSEPELDGFESVLANKPLKVTLQTDVAPELKLKKSKGLSVEISKTKF
TIG_LEPIN       DAINTLIVDGMTSI-LSKLEHPMIRFPKFEIQD-YQPGKNLIATAIYETNPEITLGKYKKIKIKLPXXXX
TIG_LEPIC       DAINTLIVDGMTSI-LSKLEHPMIRFPKFEIQD-YQPGKNLIATAIYETNPEITLGKYKKIKIKLPXXXX
TIG_AYWBP       SDALENIVQTKYQEILQKKDFESMGMPQVIDLNKLKDNQNFTFGLEFIVKPKVILKKYLGLEITKDELEV
TIG_AGRT5       ADLVNELVREKPSEILSSRGEKSATQPAISMTEILSAESDFEFTVAYEIIPAIELKANDGIKVTREVVEV
TIG_PROMS       ASALEKIIDKSWQEALKIKSIEPLSEPELFESLLAKFSPEKSLKVTLDVAPELKLKKSKGLSVEISKTKF
TIG_PROM3       ATALETLVDAVWREVLEQESIEPLCEPEFDALESFQPGEALTLILETDVTPTPKLKATKGLQAEAEVVTF
TIG_PROM0       ASALEKIIDKSWQEALKIKSIEPLSEPELFESLLAKFSPEKSLKVTLDVAPELKLKKSKGLSVEISKTKF
TIG_EDWI9       QDVLGDLMQRNFVDAIIKEKLNPVGAPKYVPGE-YKLGEDFAYAVEFEVYPEIELKGLDTIVVEKPQVDV
TIG_TRIEI       AMALDDLINNCLEKAREQESIKAIGKTEFEEVKDFEPGKEMAFSAKVDVEPEAKVEDYKGFLVQAEEAKY
TIG_THEEB       YLAMEKLIEDAVKTAVEKNNIPYLGNLELELLDQFHPGENFSFSVTFDVEPEVTVTAYKGLTIEYNPVTY
TIG_LEPCP       YEVMNDKVGQAFAAATGEAQLRVAGTPRITEKDGSADGQ-VSFDATFEVYPEVTIGDLSALXXXXXXXXX
TIG_LEGPH       EEVAREMVQSTLYEALQKNELVPAGYPHVEPLE-IEPGKDFKYTAVFEVMPVFEIVELNQAPVELIRSEV
TIG_LEGPC       EEVAREMVQSTLYEALQKNELVPAGYPHVEPLE-IEPGKDFKYTAVFEVMPVFEIVELNQAPVELIQSEV
TIG_LEGPA       EEVAREMVQSTLYEALQKNELVPAGYPHVEPLE-IEPGKDFKYTAVFEVMPVFEIVELNQAPVELIRSEV
TIG_YERE8       QDVLGDLMQRNFVDAIIKEKINPAGAPNYVPGQYKE-GEDFTYSVEFEVYPEVELKDLESIEVEKPVVEV
TIG_RHILW       AELVNEIVREQPSAILSSRGEKSATQPEIDEADILAAEQDFEFTLSYEVLPPIELKSVKGIKVTREVIDI
TIG_OENOB       EDALNAILPDIYDQAVNEADITVVGQPQIIPDDLKHGG-PWKIHAEVTLAPTVELGDYKGXXXXXXXXXX
TIG_GLUOX       AELLEEAVNDATAKLFEEQKIRPAMQPKIEVVSAIEDGKDLEFKVETEVLPEIEVPDLSGLKLTRLGAKV
TIG_AZOSE       SEAIGAAVEKAFGDKVREQNLRVAGYPRIEPREAAVEG-ALEFSAVFEVYPQVPLGDLSGQKVERPVLTV
TIG_SYNAS       ETVS-SLVSRLYWDALKEHDI-RAXXXXXXXXXXXXXXKDFSFSATVEVEPQIDPQGYLDMTLSKEEQTV
TIG_SHEFN       QDITGEVMQRNFIEAIVAEKLNPAGAPVF--TPGSTEGDSFEFVATFEIYPEVVLTGLDSIAVEQPKAEV
TIG_RALEJ       EVRFDKAARKFFDITKEQ-DVKVAGQPKFEIKTEGVGEDEVAFDATFEVYPEVKLGDLTGAEVTRTKTEI
TIG_GLUDA       GEVLEQAVSDATRALMDERGLRPAMQPRVDLVAGAEPGGKADLEFKVEVELLPDIAQPDLSTLSLTLKAT
TIG_SYNR3       ASALEDLVDSVLRDAVEQEKVEVLGQPSFEELEKFDPAKELVVTLEMDVAPTPTLKSTKGLSAEAESVAY
TIG_BEII9       LDVVQEAVNEANRKILEENNLRPAGEPRIDKEDMFESTADFAFKVALEILPKFEIGGFEDIAIERFVADV
TIG_RHOCA       GDVLNESVDGAIKDLLDQSGDRPALQPEMENGKDWKPGTDAIFTVSYEALPPIPAFDRATVTLERLVVKA
TIG_RHILO       EILNDSIITGRGEKAAMQPEVI-MTEDEKEAEKILAGGTDFEFRLNYEVIPAIEIKDFSDIKVTRQVFDV
TIG_LACRJ       QDALNKVLPDAYNEAVKETNIQPVDQPKIDIKSM-EKGQPWVLTAEVDVMPEVKLGEYKGMEVPAQXXXX
TIG_LACRD       QDALNKVLPDAYNEAVKETNIQPVDQPKIDIKSM-EKGQPWVLTAEVDVMPEVKLGEYKGMEVPAQXXXX
TIG_VESOH       SDVINEIVNETLTDALAQVKLTPVAQPVITKVD-SNSNKNFSYTVEFEVFPKIKIADFSELSIEQTKVNI
TIG_STRMK       GEALDGLLRETFDAAVREHDLRIVGSPRIDKGDEGE----FSFVATVEVVPDFGDIDVSKLTVVRHTAEI
TIG_LACDB       EDALNFALPEAYSAAVKETGIKAVGQPQIVPVSMGK-NKAWEMKAIVTVEPEVELGQY--TEIEVPKQNT
TIG_LACDA       EDALNFALPEAYSAAVKETGIKAVGQPQIVPVSMGK-NKAWEMKAIVTVEPEVELGQY--TEIEVPKQNT
TIG_RALME       EVRFDKAARKFFDITQAQ-EVKVAGQPKFDIKTEGVADDELAFEATFEVYPEVKIGDLASAEVTRTKTEI
TIG_PHOLL       -DVLSDLMQRNFINAIIEQKINPAGAPSY-APEQFKNGEDFTYSVEFEVYPEIELKDLESIXXXXXXXXX
TIG_BRASB       QTIRDTFTERGFRLATEPKVTMPTEEAEVEK--ILSGQSDLTYTVAVEVVPAITLADFKTFSVEKPVADI
TIG_SINMW       ADLVNEIVREKPTEILTSRGEKSATQPEIGMTEILKAEADFEFTVAYEIIPPIELKDASGIKVTRXXXXX
TIG_ALISL       HDKMGEVMQRHFIEAIVKDKINPAGAPTFAPVEFAE-GQDLVFTATFEIYPEVTLQGLXXXXXXXXXXXX
TIG_SYNY3       ATAIEELIDDSIKAAVKQEELFSLRSDMENLIQIFDPEAPLTIKVAADVFPEAEYEPESYKKITAQAE--
TIG_RHISN       AELVNEIVRDKPTEILTSRGEKSATQPEVAMTEILKAEADFEFTLAYEIIPAIELKDATGIKVTREVVEI
TIG_METRJ       AEVVQNAVNEANRQIVTDNGLKLALEPQVEPTDQAEVEKALAFKVALEVMPSFELADLSDVSLTKLVAKP
TIG_DINSH       EAM-QETIDGAMAKHFEDSGDRPALQPEIKMTEDWKEGDDIEVAMSYEALPEVPDTDFSTVTLEKLVVKA
TIG_RUTMC       SDAINEIVNETLTDALTQVKATPVSQPVISKID-SEDEKNFSYTVDFEVFPEIKVADFSKLTIEQIKVEI
TIG_STRM5       GEALDGLLRETFDAAVREHDLRIVGSPRIDKGEEGE----FSFVATVEVVPDFGDIDVSKLTVVRHSAEI
TIG_RHIME       ADLVNEIVREKPTEILTSRGEKSATQPEIAMTEILNAQADFEFTVAYEIIPPIELKDASGIKVTRXXXXX
TIG_HELPS       EMIQEVLKNALKELGIENKDL--IGSPNF--TKFEKKDTHFEIEADIGLKPTIVLDKIKECVPSVGVEIP
TIG_DECAR       HEVLSEELDRVFGETVTEKKMRVAGYPRI-EPKTTESNSHLEFSAIFEVYPEFTPGDLSGSEVERPVLEV
TIG_ACIBY       QEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_ACIBT       QEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_ACIBS       QEVVNDIIRDSVFEAIQQEKINAVGTPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_ACIBC       QEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_ACIB5       QEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_ACIB3       QEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDA--LVFEATVEVYPEVEVKAFDGLEVERKTAEI
TIG_SYNP2       ASVLEDLIDDSLKAAIAQENIEALGKSSFD--DLISAYKPSSFKAAVDVPATVTLNSYKGLSFKAEKSEY
TIG_RHOBA       DRVKGSLLMDSLAKVTEDAEFSAIGEPDFDSIELPEKGE-FKYQFSIEVRPEFETPDWKKLELKKPVETI
TIG_RALSO       EVRFDKAARQFFDIT-NEQGVKVAGQPRFELKSEGVADDQFAFDATFEVYPEVKIGDLAGAELTRTKTEI
TIG_XANCP       AEAMEGLLRETFDSAVREHSLRLAGNPRIDQGE-----SDFDFVATFEVVPDFGDIDVTNLSVVRHTAEV
TIG_RHOSK       GDAMQDAIDGAMRDHLETSGDRPAMQPEVRMVDTWKEGTDVVVEMKYEALPEIPEIETSKVSLERLVVKA
TIG_RHOP2       AETIDKLVRETFRLATEP----KITMPQDQKVDILAGKSDLNYTVAIEVVPTIELADFKSFSVEKPXXXX
TIG_DEIRA       SQVRDRLLETHYSQGLRELGL-NLVDATVDPQD-VQSGQAFEFTVKGETYPEVKLGDWQGLKVSAQAPEI
TIG_XANCB       AEAMEGLLRETFDSAVREHSLRLAGNPRIDQGE-----SDFDFVATFEVVPDFGDIDVTNLSVVRHTAEV
TIG_XANC8       AEAMEGLLRETFDSAVREHSLRLAGNPRIDQGE-----SDFDFVATFEVVPDFGDIDVTNLSVVRHTAEV
TIG_RICRS       NDIIERRINHSVNHIIKEHNLNIIGRPKIEELQ-NESDKALEFTVKIELLPKITIPDLKKISLDRPKLEV
TIG_RICRO       NDIIERRINHSVNHIIKEHNLNIIGRPKIEELQ-NESDKALEFTVKIELLPKITIPDLKKISLDRPKLEV
TIG_PROMA       ASALEKLLEKIWKQALKEESIEPLCEPELAEPLLENFNPEQTLSVTLDVAPIPKLKTTKGLTTEAEPITF
TIG_BRUO2       AEIVNEILNDSSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_BRUME       AEIVNEILNDSSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_BRUAB       AEIVNEILNDSSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_BRUA2       AEIVNEILNDSSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_BRUA1       AEIVNEILNDSSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_SYNPW       ATALESLVESVWRDALAQETIEALGQPEFEELDTFKPGEALTVTMETDVAPSPTLKSTKGLKAEAETVAF
TIG_RICAH       NDVIERRINHSVNHVIKKHNLSIIGRPKIEALQ-NEPDKALAFTVKIELLPKVTIPDLKKISLDRPKLEV
TIG_NITEU       HEVLGELLQQQFNDAVNQENYRVAGIPGFESRNSDANGATYEFRATFEIYPDIELGDLSSITVNKPVLQI
TIG_LAWIP       --ITNKATEETLKIYIKEIHIKPLCNLLTEDTDFIR-NESFSSTLTFEVLPEITFPNYEGLEVHQDVVKV
TIG_BRAJA       AETIDQTIRDTFRLATEPKITMPSEQAEVEE--LLSGKTDLTYTVAIEVVPSIALADFKTFQVEKPXXXX
TIG_AGRVS       AELVNEIVRDRPSAILSERGEKSATQPEVAMTEILNAQADFEFTLAYEVIPAIELKPVDGIKIXXXXXXX
TIG_RICFE       NDIIERRINHSVNHVIKEHNLNIIGRPKIEELQ-NEPDKALEFTVKIELLPKITIPDLKKISLDRPKLEV
TIG_RHOS5       GDAMQDAIDGAMRDHLETSGDRPAMQPEVRMVDTWQEGTDVVVEMKYEALPEIPEIETSKVTLERXXXXX
TIG_PROM5       ASALEKIIDKSWKEAIEMESIEPLSEPELVDESLLKNFNPLKINLQTDVAPTLKLKKSKGLSVEIIKRKF
TIG_BURXL       EVLSDKVGKEFFDISRAE-NLRVAGQPSFPKTDATEG--DYAFDATFEVYPEVKLGDVXXXXXXXXXXXX
TIG_BRUSU       AEIVNEILNDLSRSILAERNEKSATQPEVKEAEKVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_RICCN       NDIIERRINNSVNHVIKEHNLNIIGRPKIEELQ-NESDKALEFTVKIELLPKITIPDLKKISLDRPKLEV
TIG_BORDL       ALAIENLIHKSLEEFFESAIYKPLAVPKIDEKLEINFDKDFEFTFVYESYPEFEISDISNFKVEIPEVVI
TIG_BORRA       ALAIENLIHKSLEEFFESAIYKPLAVPKIDEKLEINFDKDFEFTFVYESYPEFEISDISNFKVEIPEVVI
TIG_ACIAD       QEVVNDIIRDTVFEAIQQEKINAVGMPNIEKVEHKDDALVY--EATVEVYPEVEVKAFDTLEVERKAAEI
TIG_THIDA       QEVLGETLKTRFGEAVQTHQLRIAGYPRFEPKADASAAAEMTFSASFEVYPEVKIDALDSATLNRPVVEL
TIG_RICPU       NDIIERRINHSVNHVIKEHNLNIIGRPKIEELQ-NESDKALEFTVKIELLPKITIPDLKKISLDRPKLEV
TIG_RHORT       GEVLEKAVQESIREVMTSHELKPATQPDIDLISEVEEGKDVEFTLALEVLPEIGETDFSXXXXXXXXXXX
TIG_PROMT       ASALESLLQKVWTETLDQEGIEPLCEPELEDETILENFNP---EKTLILKLETDIT---PIPTLKKSSGL
TIG_PROM4       ASAIEKLLEVVWPQALQQESIEPLCEPELGFEALLENFNPLTLTLETDISPIPQLKSSKGLTVEAEKVVF
TIG_MARMS       LDAVEQIMRDAYVEAIQKESIQPAGMPSIEPKNFAE-GADLEFVVKIEVYPEVTLADNSAIKVDRVVSDV
TIG_SPHWW       DVLNKTVQDGVQQLLAEQ-KLRPAMQP---SVELVEPGKDVALKXXXXXXXXXXXXAIEGLKLELSVEAP
TIG_OCHA4       AEIVNEILNDSSRSLLAERNEKSATQPEVKEAEQVLDGKAFVFSLNYEVLPAIEVKDFSKIAVTRXXXXX
TIG_TREPS       QDXXXXXXXXXFAQASQDSQPLPISRPSLKKKPVFDPDEDFSFAVIYDVFPSVELRNTSGFSLSVPTVSV
TIG_TREPA       QDXXXXXXXXXFAQASQDSQPLPISRPSLKKKPVFDPDEDFSFAVIYDVFPSVELRNTSGFSLSVPTVSV
TIG_RICCK       NDIIERRINHWVNHVIKEHNLNIIGRPKIEELQ-NEPDKALEFTVKIEILPKITIPDLKKISLDRPKLEV
TIG_HAMD5       QDILIDFMQDHFSKTILQEKLNLAGRPQYLPGKYIK-NENYTYSVEFEVYPEIKLKDLELIEVEKPIVSL
TIG_BURPP       EVLSDKVGKEFFDISRSE-NLRVAGQPSFPKSDATEG--DYAFDATFEVYPEVKLGDVXXXXXXXXXXXX
TIG_RICM5       NDIIERKINHSVNHVIKEHNLNIIGRPKIEELQ-NESDKALEFTVKIELLPKITIPDFKKISLDRPKLEV
TIG_LEGPL       EEVAREMVQSTLYEALQKNELVPAGYPHVEPLE-IEPGKDFKYTAXXXXXXXXXXXXLNQAPVELIQSEV
TIG_NITEC       HEVLGELLQQQFSESINRENYRIAGVPNFESRNPGTDNSNYEFRATFEIYPNIELGDLNSITINKPVLQI
TIG_SULDN       AEALREVLNGLDELKVAMSAL--IGEPNISKFD--KSDDKIEVTVKIAMRPEINLENYADMVAPFKKPVI
TIG_RICAE       NDIIERRINHSVNHVIKEHNLNIIGRPTIEELQ-NESDKALEFTVKMELLPKITIPDLKKISLDRPKLEV
TIG_POLNS       ELQFDKAAELFYELAQKE-GVALAGQPRLEPKSEIDAEK-VVFDAFFEVLPEVKIGDFSKAEVTKYTTDI
TIG_OENOE       EDALNAILPDIYDQAVNEADITVVGQPQIIPDDLKHGG-PSKIHAEVTLAPTVELGDYKGXXXXXXXXXX
TIG_WOLPP       YVINDTIDYCSSDL-MKKIEVKSHIHPKVDIMSLPNLDKKFLYKLSFESMPKVPVIDLDXXXXXXXXXXX
TIG_POLSQ       ELQFDKASDLFYELCQKEG--IPLAQPRLEPKSELEA-ETIAFDVFFEVLPEVKMGDFSAAEVTKYTTEI
TIG_RICPR       HDIIEKRINNLVNHIIKEYNLNIIGRPKIEELQ-NEPDKDLEFTVKIELLPKITIPDLKKISLDRPAVNS
TIG_MESFL       YVTPSKIYNEAYRMMVQEVKVEPMNSPEPIPAKVSE--KELVIEFLFDLKPEIKLGDYKXXXXXXXXXXX
TIG_LEUMM       QQAMDIVLPAAYEAAIDEAGITPVGRPNIEPVSM-NKGEAWTLKAVVKTAPAIKLGEYLNLXXXXXXXXX
TIG_PROM1       ASALESLLQKVWTETLDQEGIEPLCEPELEDETILENFNP---EKTLILKLETDIT---PIPTLKKSSGL
TIG_ANAPZ       GEVVAQVIDDISSKFLKEGDFGGIAYPKVCSNSEGDGGLVYELKFEVM--PEVPVVDIDGITLKEIEVNI
TIG_BORHD       ALTIEKLIHKSLEEFFKSATYKPLAVPKIDEKLEIDFNKDFEFTVVYEAYPEFEIPDISNVEVEIPEVTV
TIG_RICTY       NDIIEKRINNLVNHVIKEYNLNIIGRPKIEELQ-NEPDKALEFTVKIELLPKITIPDLKKISLDRPKLAV
TIG_WOLTR       ----EYVVNST----IDYCSSDLMKKIEYPKVDIMEEGEKSNFVYKLSFEPEVPVIDLDKINLKKVEARI
TIG_ARCB4       DGIRKILADGLKLLDIKNSDL--IGEPSVTKFDKKDNG-DIEVELSVACKPNIDLGDYKSLVPAVXXXXX
TIG_MYCMS       YLTPIKIYNEAFKIVVKPAFDFALSQENKIQNDVKVSDKEIVIDFIFDLVLELKVGEYKNITVKKPXXXX
TIG_CHLPB       ASVAEKLASKYFVEISESENIKPASRAELENYSF--DGDTLSITLSYEIHPDFEVNDFKDYTFVQDIYAV
TIG_BORT9       ALTIEKLIHKSLEEFFKSATYKPLAVPKLDEKLEIDFSKDFEFTVVYEAYPEFELPDISNVEVEIPXXXX
TIG_MARMM       GDLLNELVPDTTQKTLDEKKLRPASQPDISVTDVLAGKADFVFEIALEIMPDFEPADPAKLSVTRPXXXX
TIG_PARUW       KECVDIVLQTGFNDALQLTHIHPLKDGHIKRPIVHYCTQEKGAHFVLEFEARPTIPSVQPQELHLHHQAP
TIG_MYCMO       EEAVKLIANDLVKIASESIDIYEVEKMSDAELDL---------KFSYPIYPEFKIKNYKSLKVTLSRAKV
TIG_CHLAB       KELNQLLIQSAYQALASVGDRRPLSPQAIKSTSVTKANEGGQVNFTYEAFPTISDIPWDKLSLEEPAKDI
TIG_XYLFM       AEVLDSLLRETLDSAIRAHSLRLAGAARIDHAN--EGGLNFVATFEVVPDGEIDVSKLGVVR---RTAKV
TIG_MYCPU       AKAIDETLNSTFEIALDKEDLYRVSKITEDEAEI---------EFFWPVRPEIEDFKYKNLNVKFKEVKV
TIG_CAMC1       DAEQDDVVEEAIKKANDDLIGEPIVS-KFDRKD-----DKIDVELTVSFKPSVDVSGYESLIPEFSNPRV
TIG_XANC5       AEAMEGLLRETFDSAVREHSLRLAGNPRIDETD-------FDFVATFEVVPDFGDIDVTKLSVVRATAEV
TIG_HELPH       EMIQEVLKNAFKELGIENKDL--IGSPNL--TKFEKKDTHFEIEADIGLKPTIVLDKIKECVPSVGVEIP
TIG_XANAC       AEAMEGLLRETFDSAVREHSLRLAGNPRIDETD-------FDFVATFEVVPDFGDIDVTKLSVVRATAEV
TIG_EHRRG       DTSSEFIKNGKFGEIISS-NVSVISCPDYSSTSGDPAGDNLVYKLSFEVMPEAPLIALDDIVLSDIEADI
TIG_UREU1       ETTTNDLVPQALTFLEQDESFTSVDTPSIDILDFKDG--ELTLKIAYDLYPVATIDSYN----DLVLTPI
TIG_SYNS3       ATALENLVDAIWRDTIKQETIEALGQPEVDGLESFEPGKPLSITFEADVAXXXXXXXXXXXXAEAESVSF
TIG_CAMC5       QDILRDVLNEAIKKSGKKSDEL-IGEPLISKFDRKDDG--IDVELTASFKPSVSVEGYEALIPEFSTPRV
TIG_HELPY       EMIQEVLKNAFKELGIENKDL--IGSPNL--TKFEKKDTHFEIEADIGLKPTIVLDKIKECVPSVGVEVP
TIG_HELPG       EMIQEVLKNAFKELGIENKDL--IGSPNLTKFEKKDA--HFEIEADIGLKPTIVLDKIKECVPSVGVEIP
TIG_EHRRW       DTSSEFIKNGKFGEIISS-NVSIISCPDYGMDVSSTSGDPVVYKLSFEVMPEAPLIALDDIVLSDIEADI
TIG_XANOR       AEAMEGLLRETFDSAVREHSLRLAGNPRIDETD-------FDFVATFEVVPDFGDIDVTTLSVVRATAEV
TIG_XANOP       AEAMEGLLRETFDSAVREHSLRLAGNPRIDETD-------FDFVATFEVVPDFGDIDVTTLSVVRATAEV
TIG_XANOM       AEAMEGLLRETFDSAVREHSLRLAGNPRIDETD-------FDFVATFEVVPDFGDIDVTTLSVVRATAEV
TIG_EHRCJ       KTISSDFVKSNKFGEIISSNIDIVSYPNYSDNDSKEENLVYKLSFEVMPEPLMDIDSIVLNGIEVDIQES
TIG_CAMFF       SEIFRDIVNESLKLAKKSSDI--IGEPKFDEKD-----GNIDIELEISFKPEVKVDGYEEIIPEYTTPKV
TIG_HELP2       EMIQEVLKNAFKELGIENKDL--IGSPNL--TKFEKKDTHFEIEADIGLKPTIVLDKIKECVPSVGVEIP
TIG_MYCGE       QKSAQNVMNSIYESVVASNDNVIDDYPTIDFKTITEQNCVLLFYFDLI--PNFQLPDYKKIKDLTPLTKL
TIG_CAMLR       DAEQDLLRN-----AVDGA----LKEVKKDAKDLV--GEPYFEKFVLSFRPEVKLDGYEELVPTYNTPKV
TIG_AQUAE       EEVGKKIADETLQKALEEANLKPVADVFLXXXXXXXXXXXXXXXXSFEVAPEFELKDVENLEVEVPKIEF
TIG_XYLFT       AEVLDSLLRETLDSAIRAHSLRLAGAARIDHAN--EGGLNFVATFEVVPDGEIDVSKLGVVR---RTAKV
TIG_XYLF2       AEVLDSLLRETLDSAIRAHSLRLAGAARIDHAN--EGGLNFVATFEVVPDGEIDVSKLGVVR---RTAKV
TIG_UREPA       ETTTNDLIPQVLTFLEQDDDSETVDTPSVDILDFKDG--ELSLKVVYDLYPVATIESYN----DLILTPI
TIG_UREP2       ETTTNDLIPQVLTFLEQDDDSETVDTPSVDILDFKDG--ELSLKVVYDLYPVATIESYN----DLILTPI
TIG_HELAH       EMFQEILKNALKELGIESKDL--IGSPNL--TKFEKKDTHFEIEADIGLKPTIVLDKIKECVPSVEVEAV
TIG_ANAMM       RNCGEDVVREVLSKVVDDASSQFMQEGGFGDVVTSEVGKGGDLVYELQFELMPEVPSINPEEIEMEAE-I
TIG_MYCGA       QLVQPIYLELVKQEKIKDSETVLEENPEVSVVEIDD--KKLALSYSFETIPEVKVGDYLKINGFLSETPV
TIG_HELHP       XXXXXXXXXXXXTAALKELEIQPIGNPMISQFN--KLNDKIELEIKLGITPTLNLDNVEDYTPEVKLKTI
TIG_EHRCR       STSSDFVKNSKFGEIISDIVSYPSYYSDNDEEDLV-----YKLSFEVMPEPLMDIDNIVLSDIEVDIQEC
TIG_MYCPN       QRSAQAVIDAIFPLVIADNENVIEDFPTIDFKTINENDCVILFDFDLV--PQFEPPDYKHIKDLSPIVPL
TIG_CHLL2       ASIAEKMASKHFSAIADEENIKPASRASFDDNQL-------SIKLSYEIHPEFELKGFEGYTFTQPRYTI
TIG_CHLT3       YQVVEELAGKNFESVAKENDLKLVGQAKIRHYELAENEK-LSIYLIYEVHPAFELKPFNEYEFKKAEYQV
TIG_XYLFA       AEVLDSLLRETLDSAIRAHSLRLAGAARIDHANEGRLNFVATFE-VVPDFGEIDVSKF---SXXXXXXXX
TIG_WOLPM       ----EYVINNTIDYCSSDLEVKSHIYPKVDVISLPDLGKEFVYKLSFESMPEVPVIDLDKINLXXXXXXX
TIG_PROA2       ASVAEKLASKYFGEIAEKETIKPASRAQLDNFSFNDDQLTITLSY--EIHPEFELKDFSGYSFVEDLYTV
TIG_MYCCT       YLTPIKLYNEAFKIVI---------KPAFDENRIQNDNSPXXXDFVFDLVLEVKIGEYKNISIKKSTVEV
TIG_SULNB       QDAEGDALRSLIDLGVKEAGINTLGEPIFKKYDKKDEG--IEVEVEISLRPTIEAEGYEKAVPAFXXXXX
TIG_HELPJ       EMIQEVLKNALKELGVETKDL--IGSPNF--TKFEKKDTHFEIEADIGLKPTIVLDKIQECVPSVGVEVP
TIG_MYCPE       ERIEDWIIDQDEKMADEICDFDPVTSKPNNSNNVLNKTVSFTMSFGKY--PEFKVKNVKDIKIEKIESKV
TIG_CHLPN       KELGELVTQDAYHALSTVGDRRPLSPKSITQFDLQEGAK---VEFSYEAFPAISDLPWENLSLEEAASEI
TIG_CHLPD       ASVAEKMASKHFGTIVDEEKIKPASRAQIESVSY--EGDELKIKLSYEIHPVFELNNYSDYTFTKARYTI
TIG_BAUCH       NYLCQDVLHQQFIAAMLKEKINVISTPNYTYSTY-QKDKDLIYQVEFEISPQVELKGIDTITVEKPLVQI
TIG_MYCHJ       RMFLPELEKQAATNIIDSDNV--IESPIFNIVNMDKNNLEIEFLYPVY--PEIKLPDYKNLKTKFAIKKI
TIG_MYCH7       RMFLPELEKQAATNIIDSDNV--IESPIFNIVNMDKNNLEIEFLYPVY--PEIKLPDYKNLKTKFAIKKI
TIG_MYCH2       RMFLPELEKQAATNIIDSDNV--IESPIFNIVNMDKNNLEIEFLYPVY--PEIKLPDYKNLKTKFAIKKI
TIG_KOSOT       DMVLEELSRKIEDTLKDEELFIPAV-----IADRKIEGDVAVFVVELHREPKVELKDYTGLELSVPKQEE
TIG_CAMJR       NLFKSAVNSALQELKKENKEL--VGEPYFEKFDRKDG--EIIAELILSFKPEIKLEGYEKLIPEYQTPKV
TIG_CAMJE       NLFKSAVNSALQELKKENKEL--VGEPYFEKFDRKDG--EIIAELILSFKPEIKLEGYEKLIPEYQTPKV
TIG_CAMJ8       NLFKSAVNSALQELKKESKEL--VGEPYFEKFDRKDG--EIIAELILSFKPEIKLDGYEKLIPEYQTPKV
TIG_GRABC       XXXXXXXXXXXQTM-VSERGLRPALQPKV-ELVRVDLDQDVEFKVELELLPDITLPDLGSVSLRLKAEPS
TIG_CAMHC       KELEDDAKNDIFRNFVDESKNEILGEPIFSKYE--EKDGIIDVEMKMSFRPEVKIDGYEKFIPEFATPRV
TIG_PELPB       ATVAEKMASKYFGEIADAEKIKPASRAQI--IDVAFAPEELKITLAYEIHPEFEVKDFSGYTFTQNRYVI
TIG_MYCS5       QNLSKENLNEVYKQLMERKEPVTFAYT----IDLKEKENGFTFDYKFAKVPTVSDLDVKSAKTELKLEKV
TIG_CAMJJ       NLFKSAVNSALQELKKESKEL--VGEPYFEKFDRKDG--EIIAELILSFKPEIKLDGYEKLIPEYQTPKV
TIG_CHLP8       AEVAEKMASKHFSAIADEEKINPASRAQIDSFNFGDG--ELTIKISYEIHPEFELKDLSAYSFTQAEYSV
TITIN_DROME     ISCVAENVTSSTKLCVEELKLPPVITSDKDQTIKVKENDDVTFTVKYTGVPTPE-ACWTTRKVVIPKSKR


                         +         .         .         .         .         *         .:210
query           TDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKATDDKGEEIPSLTTENRPYGLGANLFPAEFD
TIG_BACSK       TDEDVEAELKKLQEQHAELEIANGDTAVIDFAYVD---------GEAFEGGTAENYSLEIGSNSFIPGFE
TIG_SYNWW       KEEDVIQKFEDMRQQY-----AQVVEKIEEPAAMGDKLNIDFEDGEAFAGGKGEDYSLELGSNTFIPGFE
TIG_BACCN       TDEDVENELKALQER-------QAELVVKEDGTVENGDTAVIDNGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_NOCSJ       SDADVEEQVEALRERFATLIDVE--RPAAEGDFVVMDLVATRD-GEPIEGAEVSGMSYRVGRGGMLDGLD
TIG_LYSSC       TDEEVDAQIQEQLAR-------KAELEIKEDEAIVEGDTAVIDGDEAFEGGKGEDYPLEIGSGSFIPGFE
TIG_STAAR       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAE       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAB       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAS1       TDEELQESIDHQLGHL-------AEMVVKEDGAIENGDTVNIDDGEQFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAW       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAT       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAS       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAN       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAM       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAAC       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAA9       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAA8       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAA3       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAA2       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_STAA1       SDDELQEAIDHSLGHL-------AEMVVKEDGVVENGDTVNIDDGEEFEGGQAEGYDLEIGSGSFIPGFE
TIG_HALOH       TEEDIEAQLKSLQEQHSQLKSTDKEV-VEEGDFVVIDFVGTID-GEEFQGGSAEEYNLEVGSGTFIPGFE
TIG_STAES       SDEELQESIDHSLSHL-------AEMVVKEDGAVENGDTVNIDDGEEFDGGQAEGYDLEIGSGSFIPGFE
TIG_STAEQ       SDEELQESIDHSLSHL-------AEMVVKEDGAVENGDTVNIDDGEEFDGGQAEGYDLEIGSGSFIPGFE
TIG_STACT       TDEELQEAIDHSLGHLAEMEDGSVTVNIDFDGYVD---------GEQFEGGQAESYDLEIGSGMFIPGFE
TIG_BREBN       TEESVDAELKRMQERHVAVEEGAAQTG-------DIAVIDFEQDGVAFEGGKAEDYSLELGSGTFIAGFE
TIG_CORJK       DDEAIDAELKNLQARFGTLKPADRA--VKKGDFVSIDLSATID-GETVDEATTEGLSHEVGNDSLIEGLD
TIG_STAHJ       TDEDLQEAIDHSLGHL-------ADMVVKEDGAVENGDTVNIDDGEQFEGGQADGYDLEIGSGSFIPGFE
TIG_MYCS2       TDEEVDAELQSLRARFGTLKGVERG--VQEGDFVSIDLSATVD-GNEVPEAATEGLSHEVGSGQLIDGLD
TIG1_DESHY      TDXXXXXXXXXXXXXHAKVLNLEEGTVQAQDTVIDFAGSVD---GVAFEGGTAEGYDLVIGSGSFIPGFE
TIG_MYCSS       TDEEVDTELQSLRARFGTL--TGVDRPAKDGDFVSIDLSATVD-GKDVPEATTEGLSHEVGSGQLIEGLD
TIG_MYCSK       TDEEVDTELQSLRARFGTL--TGVDRPAKDGDFVSIDLSATVD-GKDVPEATTEGLSHEVGSGQLIEGLD
TIG_MYCSJ       TDEEVDTELQSLRARFGTL--TGVDRPAKDGDFVSIDLSATVD-GKDVPEATTEGLSHEVGSGQLIEGLD
TIG_CLOAB       TDEDVENELKGMQE-------KNARIELKEDGEADIAV--IDFKGDDVAFEGGEGKDYSLGSGTFIDNFE
TIG_MYCGI       TDEDIEAEIEALQKRFGTL--TGVERPAENGDFVSIDLSATVD-GKDVPEAKTEGLSHELGSGQLIEGLD
TIG_MOOTA       TEADIDAYLKRLQERYAEIEDEPAAA----GDIVTIDFKGTVD-GQPYPGMEGNNYPLELGSGTFITGFE
TIG_GEOSW       XXXXXXNELKRLQENY-------AELVVKEDGKVENGDTAVIDDGEPFEGGKAENYSLEIGSGTFIPGFE
TIG_BACLD       TDEDVQNELKSLQER-------QAELVVKEDGKVEEGDTVVLDDGEAFEGGKAENYSLEVGSGSFIPGFE
TIG_BACCQ       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACC7       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_NOCFA       GDEDIEEQLNSLRQRFGTL--TGVERPVQEGDFVSIDLSATVD-GQEVPEASTTGLSHEVGSGQLIEGLD
TIG_BACC1       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_ALKMQ       QEEDVQNELNKLT------EQNARMIAVEDRPVQDGDMVVIDYKGDQFEGGTAEKQSLTIGSNQFIPGFE
TIG_RHOE4       TDEAIEEQLLSLRQRFGTLTGVDRA--VEDGDFVSIDLSATVD-GENVAEATASGLSHEVGSGQLIEGLD
TIG_BACHK       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACCZ       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACC3       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACC0       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACAN       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACAH       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACAC       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACAA       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_PELTS       SGEDVEKELVRLQNRYAKLVTLEEGTVEKGDAIIDFAGRIDGE-----PIKGGEGRDYSLGSGSFVQGFE
TIG_NATTJ       XXXXXXXXXXQMQEQHAEYEDVEDGEAENGDRLVIDFEGYVD--GEPIEGGQAENHNIELGSNQFIPGFE
TIG_STRP7       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_DESRM       TDEDVEKELARLQDRHAKLVTLEEG-EIKKDDITLIDFTGYVD-GEAFEGGHAENYSLTVGSGTFIPGFE
TIG_STRR6       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRP2       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_ALKOO       QEEDIQRELDGLAERMITVEDRA----VKEGDMVIIDYKGMVD-GIAFEGGTAERQSLTIGSGQFIPGFE
TIG_CLOPH       TEDEIMAELDKVRERTITVEDRAVMDKIDFEGFVD-GVAFEGGKGEDY-ALT-------IGSHSFIDTFE
TIG_BACWK       XXXXXXXXXXALQER-------QAELVVKEDGTAADGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_MYCVP       TDEDVDAEIEALQKRFGTLTGVDRA--AEDGDFVSIDLSATVD-GKDVPEANTEGLSHEVGSGQLIEGLD
TIG_EXISA       TEDEVTAELEALQQQGAELAVKEGAIENGDTAVFDFAGFA---DGEQFEGGTAENYTLEIGSGQFIPGFE
TIG_MACCJ       XXXXXNKAIEAARKAELVVKEEG---EVAEGDVVNLDFDGYVNE-EAFEGGKAEGYDLEIGSGQFIPGFE
TIG_BACHD       SDEDVEQELKSLQER-------QAELVVVEEEAIQEGDTAVLDDGEAFEGGKAENYSLEIGSGQFIPGFE
TIG_GEOKA       TDEDVENELKRLQEDY-------AELVVKEDGTVENGDTVVIDDGEPFEGGKAENYSLEIGSGTFIPGFE
TIG_CORA7       SEEDVDKALEDLASRFGELKDTKRKMKTGDYAIIDI---TTEVDGTKLDEASHEGMTYRIGDDNLIKGLD
TIG_MYCPA       TDEDVDAELQSLRARFGTL--TGVERPVAEGDFVSIDLSATID-GQEVPGATAQGLSHEVGSGRLIEGLD
TIG_MYCA1       TDEDVDAELQSLRARFGTL--TGVERPVAEGDFVSIDLSATID-GQEVPGATAQGLSHEVGSGRLIEGLD
TIG_BACA2       TDEDVQNELKALQER-------QAELVVKEEGAVENGDTVVLDDGEAFEGGKAENYSLEVGSGSFIPGFE
TIG_MYCA9       EDSEVEAELDALRARFGTLKGVERA--AENGDFVSIDLSATVD-GKEVEEAATTGLSHEIGSGQLIDGLD
TIG_ANATD       XXXXXXXXXXXXXXXFVPVE-----RPVENGDIVTIDFEGFVD-GEPINGGSAKDYELTIGSNTFIPGFE
TIG_MYCMM       TDDEVNAELESLRARFGTLTEVE--RPVATGDFISIDLSAAVD-GEDVPNAAAEGLSHEVGSGRLIAGLD
TIG_GEOSF       NDEVVTGRLREMQENMAHLEPAEAGVAAKSGDYVTFDFKGSID-GVPFDGGAADDFQLELGSGRFIPGFE
TIG_LACS1       LKADIENELNRLQQQ-------EAELVLKEDEPAEQGDTVVIDDGEAFDGGKGENHSLELGSGQFIPGFE
TIG_GEOSL       DESIVEKRLQEMREHLRSLEEGSVA----EDGHFAVIDFTGYVDGVPFEGGSAESYQLELGSGRFIPGFE
TIG_FINM2       TDSDVDMKVNHELESNARVQEVE-GREAKENDTVSINFKGVDDKA--FDGGEAEDYELVLGSHTFIPGFE
TIG_CLOB8       EDTEIDKQIKEMQEKNARIEVKTEGNIAKGD------IAVIDFKGDGVAFEGGEGSDYSLGSGTFIDNFE
TIG_BACP2       TDEDVQEELKGM-------QNRQAELVVKEEGAIENGDTVVLDDGEAFEGGKAENYSLEVGSGSFIPGFE
TIG_CLOBB       XXXXXXXXXXXXXXXNARIETKEEGT-IADGNIAIIDFKGFVD-GEAFEGGEGTDYPLEIGSGTFIDNFE
TIG_GEOTN       TDEDVENKLKRLQENY-------AELVVKEEGTVENGDTAVIDDGEPFEGGKAENYSLEIGSGTFIPGFE
TIG_MYCUA       TDDEVNAELESLRARFGTL--TGVERPVATGDFISIDLSAAVD-GEDVPNAAAEGLSHEVRSGRLIAGLD
TIG_CLOPS       KDEDIEKQLADMQAR-------NARVETKEEGTVENGNIAVIDFKGFIDDVAFEDYPLEIGSGSFIDNFE
TIG_MYCBT       GEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLS--ATVD-GEDIPNAAAEGLSHEVGSGRLIAGLD
TIG_MYCBP       GEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLS--ATVD-GEDIPNAAAEGLSHEVGSGRLIAGLD
TIG_MYCBO       GEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLS--ATVD-GEDIPNAAAEGLSHEVGSGRLIAGLD
TIG_SYMTH       TDQEVEEQLSALRERLATLV-TDESGEVGQGSFAVIDFEGFID-GEPFEGGKGEGYTVEIGSGTFIPGFE
TIG_STRZT       TDADVEERIERERNNLAELVIKEAAAEDGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRZP       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRZJ       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRPS       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRPJ       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRPI       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRP4       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_CARHZ       XXXXXXXXXXYLQNRYITVEDGEA--KFGDIVVIDFAGKM---NGEPLEGGSADNYRLELGSKVFIPGFE
TIG_STRPN       TDADVEERIERERNNLAELVIKEAAAENGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_EUBR3       SDEEVDAELENQR-------NKNARTVTVTDRPVAEGDTAVIDDGVAFEGGKGENHPLEIGSHTFIDTFE
TIG_CLONN       TDEDVEKQLNAMLEKNARIITKEEGAAVQKNDIAIIDFKGFVD-GKAFEGGEATDYSLEIGTGTFIDNFE
TIG_DESVM       DMKEVDEVITRIRTNMAELVPVAEARPGKDGDVVVLDFAAFEN-GEPVEGISAENFQMNLGDRQALEDFE
TIG_BACSU       XXXXXQNELKALQER-------QAELVVKEEGAVEEGNTVVLDDGEAFEGGKAENYSLEVGSGSFIPGFE
TIG_MYCTU       GEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLS--ATVD-GEDIPNAAAEGLSHEVGSGRLIAGLD
TIG_MYCTA       GEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLS--ATVD-GEDIPNAAAEGLSHEVGSGRLIAGLD
TIG_DESAP       XXXXXXXXXXXXRNRYAKLVTIEEGT-VEMGDIITIDYEGTIN-GEPFAGGSATDRSVEVGKGFVAKDFD
TIG_OCEIH       XXXXXXXXXXNVRERH-------AELIVKEEEAIENGDTAVIDDGVAFEGGKGENHSLEIGSGQFIPGFE
TIG_CORDI       NDEAIDAQIDKLRER---FGEXXXXXXXXXXXXXXXXXXXXXXXGEKLEEATTEGMSYQVGAGDLIDGLD
TIG_STRS7       TDEEVDAKVERERNNL-------AELVVKEDAAVEGDTVVIDFVGSEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRGC       TDEDVDARIERERNNLAELVLKEGPAAEGDTVVIDFVGSV---DGVEFDGGKGDNFSLGLGSGQFIPGFE
TIG_CORGL       XXXXXXXXXXXXXXXFSTLKDHNH--KLKKGEFVTINITASID-GEKIEEATTEGLSYEIGSDDLIDGLD
TIG_CORGB       XXXXXXXXXXXXXXXFSTLKDHNH--KLKKGEFVTINITASID-GEKIEEATTEGLSYEIGSDDLIDGLD
TIG_COREF       XXXXXXXXLESLRARFSTLKDHNH--KLKKGEFVTLNLSASVD-GEKVEEATTEGLSYEIGSGDLIDGLD
TIG_BIFLO       KDEDVDKRLEALRQRFGTLVGVDRPAAKGDFANIDL---TAEIDGETVDS--QEGVSYELGSNTMLDGLD
TIG_BIFLD       KDEDVDKRLETLRQRFGTLVGVDRPAAKGDFANIDL---TAEIDGETVDS--QEGVSYELGSNTMLDGLD
TIG_RHOSR       TDEAVEEQLLSLRQRFGTLTGVERA--VEDGDFISIDLSATVD-GEAVPEATASGLSHEVGSGQLIEGLD
TIG_LEIXX       TPDDVEEELDRLRSRFCTLVTVDRPAKKGDFAQIDL---VAEIGGEEVD--TAANISYEIGSGELIEGID
TIG_BIFLI       KDEDVDKRLETLRQRFGTLVGVDRPAAKGDFANIDL---TAEIDGETVDS--QEGVSYELGSNTMLDGLD
TIG_ANOFW       XXXXXXXXXKRLQERH-------AELVVKEEGTVENGDTVVIDDGEAFEGGKAENYSLVIGSGTFIPGFE
TIG_STREM       TDEEVDAKVERERNNXXXXXXXXXXXXXGDTVVIDFVGSV---DGVEFDGGKGDNFSLELGSGQFIPGFE
TIG_CLOTE       KDEDVENTLKEMQQ-----RNARIQTKEDEEAIEKGNIAVIDFKGDEVPFEGGEGYDYSLGSGTFIDNFE
TIG_BDEBA       DPKKIDQVLENIRASRATFEVVAEDRAVKMG---DIAVINFEGGGAPLENGSGTDHHLELGAKQFIEGFE
TIG_RHOOB       TDEAVEEQLLSLRQRFGTLTGVERA--VEDGDFISIDLSATVD-GEAVPEATASGLSHEVGSGQLIEGLD
TIG_PELCD       EDQDVEDRLQDMLK-------SRAKVEVSEREVAQAGDIAVIDDGEAFAGGKAEGHELELGSNSFIPGFE
TIG_STRGG       TDEEVEKAVEQLRERFAATNPVERAAADGDVVTIDLQAKV---DGEVLEDGVADGVSYTIGSGELLDGID
TIG_SALAI       DDSEIDEQVQSLRERFATLKTVDRA--AGEGDFVQIDLNATVD-GEEVPGGSASNLSHEVGSKQLLPGLD
TIG_GEOSM       DDSVVAARLKEMQERMAQLGPAPEGHAAAMGDFVTFDFKGSID-GVYFEGGSAEDFQLELGSGRFIPGFE
TIG_BACCR       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACC4       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_BACC2       XXXXXXNELKSLQER-------QAELVVKEEGTVENGDTAVIDDGEAFEGGKGENYSLAIGSGTFIPGFE
TIG_FRASC       TDEQVEEQLGALRDRFAVLTPVERA--VQAGDYVSLDLSAEAD-GTPIDGAEATGLSYEVGSGNLVEGLD
TIG_STRE4       TDEEVDAKVERERNNXXXXXXXXXXXXXGDTVVIDFVGSV---DGVEFDGGKGDNFSLELGSGQFIPGFE
TIG_CLOBA       XXXXXXXXXXXXXXXNARVETKEEGT-IADGNIAIIDFKGFVD-GEAFEGGEGTDYPLEIGSGTFIDNFE
TIG_CALS8       XXXXXXXXXXXXXXXFISVD-----REVQNGDIVTIDFEGFVD-GESIENGSAQDYELTIGSGRFIPGFE
TIG_STRPC       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLGLGSGQFIPGFE
TIG_CLOBL       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_CLOBK       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_CLOBH       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_CLOB6       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_CLOB1       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_FUSNN       TDDLLKEELEIMVRNHAKLEEVEAGYKAQLDDTVDLAFEGFMD-GAPFPGGKAESHLLKLGSKSFIDNFE
TIG_FRAAA       TDEQVEEQLGALRDRFAQLQPVERAVQTGDFVSLDLSAQA---DGKPIEGAEATGLSYEVGSGNLIEGLD
TIG_LACPL       YAKDVDAELESRREKQAELEDQPAA---KGDTVV-IDFKGFVD-GEPFEGGESENYSLELGSNSFIPGFE
TIG_MYXXD       TDEQVNEQLERMRQSMARLEPVTDRDTAASGDYVTVDFDATVD-GQPFAGSKAE----GITVQVQPGELV
TIG_CLOBM       EDEAVENELKSMQE-------KNARVFLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_SACEN       XXXXXXXXXXXLRARFGTL--AGVERPAQQGDFVSIDLSATVD-GQEVEEAQTSGLSYEIGSGQLIDGID
TIG_KOCRD       TAEDEQKALDELRARFGTLKDRPAA----EGDHVTLDLQALVD-GEEVDA--ANDLSYEVGSGTMLEGID
TIG_CLOTH       XXXXXXXXLKAVAERIMSVEDRG----IQKGDIVDIDFEGFID-GEPFEGGKASGYVLEVGSGTFIDGFE
TIG_CLOBJ       EDEAVENELKSMQE-------KNARVSLKEEGEIEKGNIAIIDDGKAFEGGEAKDYEIEIGSGTFIGDFE
TIG_DESAA       TEQEIENQIAMIRKNMSSLETEEEDRPAKEEDFVLIDYEGVCPDGQPDELRFTENFTMELGTGRILKDFD
TIG_CLOPE       XXXXXXKQLADMQAR-------NARVETKEEGTVENGNIAVIDFKGFIDDVAFEDYPLEIGSGSFIDNFE
TIG_CLOP1       XXXXXXKQLADMQAR-------NARVETKEEGTVENGNIAVIDFKGFIDDVAFEDYPLEIGSGSFIDNFE
TIG2_DESHY      KERDIDKVLEELQYKNKKITDKEIAPAEKGDTVVDYDCELDGTKFEPVVDYKAL-----LDDSSDTMGFE
TIG_LISIN       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_STRPD       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRPM       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRPF       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_DESDG       DENEVNAVLERIRTNLADVVTV-AEHRPAKDGEIAVLDFAAYENGEPIAGVAADNFELNLGGNQALVDFE
TIG_STRPZ       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDAGKGDNFSLELGSGQFIPGFE
TIG_STRPG       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRP8       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRP6       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRP3       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_LISMH       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_DEHE1       TEENIDTVIDQVLHQRATWEKAERPVKMGD----MLLMKVESTLNGE-PYLNREDMQYSVREEIYPAPFG
TIG_PEDPA       TSKEVDEEIEKKREQ-------QAELVLKEGKPAENGDTVTIDFDGSVDGVAADNYDLVLGSNSFIPGFE
TIG_LISMO       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_LISMF       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_LISMC       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_AERHH       KDEDLGNMIDTLRKQHATWSEVDAA--AADGMRVTMDFVGSID-GEEFDGGKAEGFNLVLGAGRMIPGFE
TIG_STRP1       SDEDVDAKIERERQNLAEIKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_CLOCE       TDEDLENEFNKVVERLVSVTDQSGDTAVIDEGFID-SVPFEGGKGEDYSLV--------IGSGTFIPGFE
TIG_STRAW       XXXXXXKAVTELRERFASTSPVERAAEDGDVVTLDLEAKV---DGEVLEDGVAEGVSYTIGSGELLDGID
TIG_STRA1       SDEEVDAKVERERNNLLTVKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_LISW6       XXXXXXXXXXXXXXXXXXXVVKEDAPAENGDTVI-LDFEGFKD-GVAFEGGQAENHSLELGSGQFIPGFE
TIG_STRA5       SDEEVDAKVERERNNLLTVKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_STRSV       TDAEVDERIERERNNLAELVLKEGPAADGDTVVIDFVGSV---DGVEFDGGKGDNFSLGLGSGQFIPGFE
TIG_BIFA0       SDDDVNNRLGTLRQRFATLVGVDRPAQKGDFANIDLTAQ-TD--GETVDS--QEGVSYEIGSGTMLDGLD
TIG_PROAC       XXXXXXXXXXTLRQRFATNTEVERA--AAKDDLVTIDLAGTRD-GEVLEDATASGVTYKVGSEGMLEGLD
TIG_DEIDV       TDDVLNRTLSDLQERNATFESVDRAIEASDQVTI-------EEQGE-------DGGTYPVYLDVAEAHVR
TIG_AERS4       KDEDLANMIDTLRKQH--------ATWXXXXXXXXXGMRVTMDDGEEFDGGKAEGFNLVLGAGRMIPGFE
TIG_STRU0       TDEEVDAKIERERQNL-------AELVVKEDAAVEGDTVVIDFVGSEFDGGKGENFSLELGSGQFIPGFE
TIG_STRA3       VSAEVDAKVERERNNLLTVKDGEAA---QGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_GEOBB       DDSVVAARLKEMQERMSQLGPAPEGHAAAMGDFVTFDFKGAMD-GVYFEGGSAEDFQLELGSGRFIPGFE
TIG_GEOMG       DVAPVEARLNEMREGMAELKPLEEGKCAETGNFVVIDFVGSVD-GIPFEGGAAESYQLELGSGRFIPGFE
TIG_ENTFA       TDEDVEARLK--RE-----QESQAELVIKEDAAAENGDTVVIDGDEAFEGGKGENYSLELGSNSFIPGFE
TIG_DEHSB       AEENIDTVVDQVLHQRATWETAERPVKMG-----DMLLMQVESTLNGEPYLNREDMQYSVREEIYPAPFG
TIG_CORK4       XXXXXXXXXXNLRARFGTLK--AVERPVQKDDFVSIDLSATVG-GEPVDEATTEGLSHQVGNGELIEGLD
TIG_DEHSC       AEENIDTVVDQVLHQRATWETAERPVKMG-----DMLLMQVESTLNGEPYLNREDMQYSVREEIYPAPFG
TIG_RUBXD       XXXXXXXXXXXXXGQFATLA-AVEDRPVREGDFVILDFKGERMAGGELPGAEAEDYMLEVGRGELLEDFE
TIG_GEOUR       NEEVIANRLKEMQENMSHLEPADAQHSAMNGDFVTFDFKGFVG-GEPFDGGAAEDYQLELGSGRFIPGFE
TIG_STRCO       XXXXXXKSVEQLRERFASTSPVERAAADGDVLTLDLQAKV---DGEILEDGVADGVSYTIGSGELLDGID
TIG_BIFAA       TDEDINNRLEALRQRFGTLVSVDRPAAKGDYANIDL---NAEINGETVDS--QEGVSYELGSATMLDGLD
TIG_FRASN       TDEQVEEHLTNLRDRFAVLKPVE--RPVQEGDFVSLDLSASVD-GEAIEDATATGMSYEVGSGNLIDGID
TIG_CLOD6       SDENVDAKLQEMVEK--NARLVSVEDKALEDGDTAIIDFEGFENGVAFDGGKGENYNLVIGSNTFIPGFE
TIG_ACIC1       SXXXXXXXXXXXXXRFATLKPVDRPARRGDFVTIDMTVRL---DGEVLEDGTVTGASYEVGSAQLVEGLD
TIG_THETN       YDGDVEYELEKLRQQNARIIPVEGRPAEQGDIAVIDFEGYIDDKPFE--GGKGENYELELGSNTFVPGFE
TIG_MYCLE       TD-DVEAELRSLRARFGTLIGVDRPVALGDFVSIDLSATI---NGEKVPNADAEGLSHEVGYGRLIAGLD
TIG_MYCLB       TD-DVEAELRSLRARFGTLIGVDRPVALGDFVSIDLSATI---NGEKVPNADAEGLSHEVGYGRLIAGLD
TIG_ERYLH       SDEQVMETIERIAGQNKSYKDAAKTRKAADGDQLIIDFTGSVD-GVEFEGGKAEDAPLVLGSGTFIPGFE
TIG_THEFY       XXXXXNERLEALRQRFATLIGVDRPAEQGDHVSIDLSASV---DGKKLEDAQASGVSYEIGAGTLLQGLD
TIG_GEOLS       DEKAVEGEIERMREN-------MAQLAPVEEGTVEKGMVLTVDFSFAVPGYPEEDASVEVGNGRLLPGLE
TIG_STRMU       TDAEVDEKIERERNNLAELEDAA----VEGDTVVIDFVGSVD--GVEFDGGKGDNFSLELGSGQFIPGFE
TIG_CLOK5       KEEDIEQELK-------NMQQKDARIETKENGSIENGNIAIIDDGKEFEGGEGQDYQLEIGSGTFIDNFE
TIG_CLOK1       KEEDIEQELK-------NMQQKDARIETKENGSIENGNIAIIDDGKEFEGGEGQDYQLEIGSGTFIDNFE
TIG_DESPS       XXXXXXXXXXXMQK-------KAAALHVVDRPAVDGDMVTVDENGEALAQVKSDDHQVDLGAGSMGKDFE
TIG_ONYPE       TDYEVEEKINSLLEKQTTLESKT------QNDFLELTDIAVDDKPFE--GGTAKDFSLEIGSGQFVPGFE
TIG_THERP       XXXXXXXXXXGLRRSRAVWKTPDEPRQPRDGDQVIVDIEAYE--GEQPFQEPLRQATFVLGESNLFAEID
TIG_SYNS9       DASRVDSMIEDSRKQLATVVPVEGRAAEKGDIAV-LGFKGTSDDGSEIEGGSADSMDVDLDNGRMIPGFI
TIG_LACBA       YQKDIDAEIEKQRQQQAELEDEAAAVVIDFDGYVD---------GKQFDGGKADNYSLELGSNSFIPGFE
TIG_HERAR       SDAEIDKTIDILRKHYHVKGEQSA----HGDGGSDLTAKNSDRNGVEFQGGKAEGYAFVLGEGRMLAEFE
TIG_EXIS2       XXXXXXXXLKTMQER-------GAELVVKEDGAIENGDTVVFDDGEQFDGGTAENYSLVIGSGNFIPGFE
TIG_CHRSD       TEADVDQMIETLRTQHAEWEAVDRAAANGDQVTIDFEGYLGD---EPFXXXXXXXXXXXXXSNSFIPGFE
TIG_THEPX       YDGDVEYELEKLRQQNARIAESGDIAVIDFEGFID---------GKPFEGGKAENYELELGSNTFIPGFE
TIG_THEP3       YDGDVEYELEKLRQQNARIAESGDIAVIDFEGFID---------GKPFEGGKAENYELELGSNTFIPGFE
TIG_ALHEH       TDADVDEVLERLRKQQAEYNEVDRASQEGDRVVID--FKGTVD-GEEFSGNEGNDVPVVLGAGQMPPAFE
TIG_KINRD       PEEEVETRLTALRERFGTLTDRPAA----DGDFVSIDLRAEID-GEEIE--TAKGISYRIGQGNMIEGLD
TIG_VIBCM       TDADVAEMLETLRKQQATWKEVDEAAENGKRVSIDFVGSI---DGVEFEGGKAENFPLEMGAGRMIPGFE
TIG_VIBCH       TDADVAEMLETLRKQQATWKEVDEAAENGKRVSIDFVGSI---DGVEFEGGKAENFPLEMGAGRMIPGFE
TIG_VIBC3       TDADVAEMLETLRKQQATWKEVDEAAENGKRVSIDFVGSI---DGVEFEGGKAENFPLEMGAGRMIPGFE
TIG_SYNFM       ADEQVDSELQRLREQHAELRTLETERPAREGDVAVIDFTPSVD-GKVFEKGKSADYMAEIGKKAVHPDFD
TIG_SACD2       TDADVDTMIETLQKSQADW--APVKRKSKKGDRVVIDFKGTKD-GEAFEGGTAEGQTLVLGSNSMIPGFE
TIG_RHOPT       XXXXXXEAIKRIADANRAYADKAEGAKAETGDRVTVSFKGTID-GVAFDGGTGEDIPVVIGSASFIPGFE
TIG_DESVV       XXXXXXXXIARIRRNMAELVPV-AETRPGADGDVVVLDFAAFENGEPIEGVSAENFQLSLGEKQSLEDFE
TIG_ANAVT       DPARVDEVLEKERQELATLIPVEGAAQIGDVAVVDIAKAEGDDENAEIPGGDASDFQVELQEDKFIPGFV
TIG_TREDE       SEKDIKKELERLQERNALVTACKEGTSAEKDHIATIDYCELDDEGKTISGTERKDFVFTIGSGLNIYKID
TIG_LACSS       TIKDVEQELETRRERQAELEDAAAEN--GDTVVIDYAGSV---DGVPFDGGQADNYSLELGSNSFIPGFE
TIG_LACCB       SAKDIDAELEKRREQ-------QAELVVKDDKAAENGDTVVIDDGTEFDGGSSKNYSLELGSNSFIPGFE
TIG_LACC3       SAKDIDAELEKRREQ-------QAELVVKDDKAAENGDTVVIDDGTEFDGGSSKNYSLELGSNSFIPGFE
TIG_THICR       TDKDVEKMVTRLREQKMAWKPANGNKKAKEGDQVIIDF-VXXXXXXXXXXXXXXXVPLELGSGRMIPGFE
TIG_PSEHT       TDEDLANMLETLRKQHADW--AEVDTAAGENDRVTVDFVGTID-GEVFEGGKAEDFPLELGQGRMIPGFE
TIG_MARAV       ADKDIDNMIDNLRRQQATMKEVKRKSKNKDIVTID--FKGSID-GEEFEGGSAEGHRLTLGSGQMIPGFE
TIG_AZOC5       TDEEVDEMVKRIADGNRSFDAKEGAAASGDRITVDFVGSI---DGVPFEGGAGEDVPVVIGSNSFIPGFE
TIG_ANASP       DPARVDEVLEKERQELATLIPVEGSAQIGDVAVVDIAKAEGDDENAEIPGGDASDFQVELQEDRFIPGFV
TIG_DESVH       XXXXXXXXIARIRRNMAELVPV-AETRPGADGDVVVLDFAAFENGEPIEGVSAENFQLSLGEKQSLEDFE
TIG_DESDA       XXXXXXXXLDRIRAQLVPVEGKGPAV----DGQIATVDFAAFENGEPVEGVKAESFDLALGERQALEDFE
TIG_ZYMMO       DNAVIDEKIKEFAEHQKSFDDSKKDHKAENGDLVVVDFVGKVD-GEPFEGGTGSDMSVELGAGQFIPGFE
TIG_PELPD       DPQKIEDEIARMRDGMAQLVEGDVAVEMGHMVTIDYAF-SVDGFPEE--STSAENAVVEVGAHRLLPEFE
TIG_ALCBS       TDADVDTMIETLRQQRAEFADVDRASEIGDRVNID--FKGLKD-GEAFEGGTAEGQNLELGSGQMIPGFE
TIG_RHOPB       ADSDVDEAINRIAMGNRSYADKGEGAKAESGDRVTISFKGTID-GTPFDGGTGEGIQVVIGSATFIPGFE
TIG_NOVAD       TEAEVDEAVARIGQGQKSFTXXXXXXXXXXXXQIIIDFLGKVD-GVAFEGGAAEDTPLELGAGRFIPGFE
TIG_THISH       SDADVDKVIETLRRQRKEFVAVDRAAQKGDQVIVDFDGSL---DGEAFEGGKGEAMPVELGEGRMLAAFE
TIG_SYNJA       KPEQIDQLIDRWRDQRATLEDRPA----QLGDVVVIDFQARDAEGNPLEEIAAQDFQLELKEENFIPGFV
TIG_VIBSL       KEADVEEMIETLRKQQATWTEVEAAADAGSRATIDFVGSI---DGEEFEGGKAENFPLEMGAGRMIPGFE
TIG_SYNSC       DASRVDAMIEDSRKQMATVVPVEGRAAQNGDIAV-LGFKGTTDDGSEIEGGSADSMDVDLENGRMIPGFI
TIG_ROSS1       TDETVNHAMEIRRDRHVALDEPRPALTVQIETFVDGEPLNPRAEGEDIPQSTLVLDPERIVPGLY-----
TIG_SYNJB       KPEQIDQLIDRWRDQRATLEDRPA--QLGDVVVIDFA--ARDAEGNPLDEMTTQDFQLELKEDNFIPGFV
TIG_RENSM       SDEDRQKALDDLRGRFGTLKPADRPAAKDDFITIDINAKIAD---EDVDSAT--GLSYQVGAGTMLEGLD
TIG_LARHH       TDAEIDKTIDVLRKQRTRFNRVERAAADTDRVIIDFAGKI---DGEAFAGGSSENFPFVLGQGQMLPEFE
TIG_DICNV       SDKDVDEMIDTLRRQRANFVESDKIAGNGDRLTLDFIGTL---NGEPFEGGKGEDFCFNLGSGQMLPDFE
TIG_THEYD       XXXXXXXXLQRLSKERGTYEPTEEPAMSEDLVVIDY----TTDIGKE-----AKDYIYKLGAGPFPEDFS
TIG_CHRVO       GDAEIEKTIDILRKQRTRYN--RVEREAAEGDRVIIDFKGAID-GVAFEGGSSENFPFVLGQGQMLAEFE
TIG_STRSY       TDEEVDAKIEAARNNLAELVIKEGPAAEGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_STRS2       TDEEVDAKIEAARNNLAELVIKEGPATEGDTVVIDFVGSI---DGVEFDGGKGENFSLGLGSGQFIPGFE
TIG_JANMA       SEAEIDKTIDILRKHYHAHGDGGSDLTAKNGDRVTIDFVGTID-GVEFQGGKAEDYAFVLGEGRMLAEFE
TIG_DESOH       TDEEVDHQLTLLRKNLAKLQDIAEPRPAQEKDAAIIDYQARLD-GQPVADLPDEQEFHRIGSGAIDKTFD
TIG_PSEU5       TDADVDNMLEILRKQNTRFESVERAAENGDQVNIDFVGKI---DGEAFAGGSAKGTQLVLGSGRMIPGFE
TIG_NITOC       TDKDIEGVLKKLQEQHIEWEPMERPAQEADGVTITYHGSI---EGKPFPGGSKENFFVILGKGTTLKEFE
TIG_LACAC       YQKDIDAELDKRREQ--SAELVLKKGKAENGDTVTIDYKGTID-GKEFDGGSAENYSLELGSGTFIPGFE
TIG_IDILO       TEKDVDNMLETLQKQHADWKEVKRKSKKGDRVTMDFVGSI---DGEEFEGGKADDFALELGEGRMIPGFE
TIG_CLAMS       XXXXXXXXXXSLRSRFGTLITVDRPAKTGDFVQIDLTATIAGNAVD-----TASGISYELGSGDLIDGID
TIG_BEUC1       XXXXXXXRLDLLRQRYGTLTGVDRAAETGD--YVVIDMTATID-GEEVD--TVSGVSYEIGSGNMLDGLD
TIG_PSEPF       ADADLDKMLDILRKQNTRFEVADRAAQNEDQLNIDFVGKV---DGEVFAGGSAKGTQLVLGSGRMIPGFE
TIG_LACLS       TDEEVETRLTNAQNNLAELVVKETAAENGDTVVIDFVGSV---DGVEFEGGKGSNHSLELGSGQFIPGFE
TIG_THET2       TEEMVEKALEELRQRYAELVPVEREAQEKDHLFV------RTEEGAEFPIDLAKALPH----------VR
TIG_MAGSM       QDSDVETVITRVREEYRTQEGVAAASGDRMEGFVD---------GEAFEGGKAEDYVLELGSNRFIPGFE
TIG_LACLM       TDEEVETRLTNAQNNLAELAVKETAAENGDTVVIDFVGSV---DGVEFEGGKGSNHSLELGSGQFIPGFE
TIG_ECOSE       TDADVDGMLDTLRKQQATWKDKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO24       TDADVDGMLDTLRKQQATWKDKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_CLAM3       XXXXXXXXXXSLRSRFGTLITVDRPAKTGDFVQIDLTATIGGNAVD-----TASGISYELGSGDLIDGID
TIG_VIBVU       KDADVEEMIETLRKQQXXXXXXXXXXXXGKRVSIDFVGSI---DGEEFEGGKAENFPLEMGAGRMIPGFE
TIG_RHOCS       ADAMVDDGLKRIAANRKTSAPLEAERPAQSGDIVVIDFDGSVD-GEKRPGMKGEDHELELGSGSFIPGFE
TIG_COXB2       TEEDLDKMLEALRKQYAEWKEVDRPAKADDRVIID--FEGTLD-GKPFERGSAKDFQLELGSKRMIAGFE
TIG_COXB1       TEEDLDKMLEALRKQYAEWKEVDRPAKADDRVIID--FEGTLD-GKPFERGSAKDFQLELGSKRMIAGFE
TIG_SHISS       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_SHIFL       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_SHIF8       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_SHIDS       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_NOSP7       DPEQVDSSLEKERQELATLIPVEGSAQIGDIAVVDFKGSFAKAEGEDIPGAEATDFQVELQEDKFIPGFI
TIG_MANSM       TDADVDNMVEVLRKQQATWETDNAATK---DDRVTIDFVGSID-GEEFQGGKANDFVLAMGQGRMIPGFE
TIG_LACLA       SDEEVETRLTNSQNNLAELVVKETAAENGDTVVIDFVGSV---DGVEFEGGKGSNHSLELGSGQFIPGFE
TIG_LACF3       SDADVDSELENKRQQQAELEDEAAA----DGDTVVIDYEGSVD-GEKFDGGSADNYSLVLGSGSFIPGFE
TIG_ECOUT       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOSM       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOLU       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOLI       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOLC       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOK1       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOHS       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECODH       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOBW       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO8A       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO81       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO7I       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO5E       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO57       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO55       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO45       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECO27       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_DELAS       DDAAIDKTVDILRKQRRTFAQRAQADVAVDGDRVTVDFEGKID-GETFSGGKAEDFQFLVGEGQMLKEFE
TIG_CELJU       TDVDVDNMIDVLRKHQATWTQVERA--AADGDQVNINFVGTKD-GVEFAGGKADNQNLILGSNSMIPGFE
TIG_BORPD       TDAEVQQTLDVLRKQRANFE-AREGRAAQDGDRVTLDFAGTID-GVPFEGGKAESFPFVLGQGRMLPEFE
TIG_ACIAC       TDAAIDKTIDILRKQRRTFAQRAQGTPAEDGDRVTVDFEGKID-GETFSGGKAEDFQFLVGEGQMLKEFE
TIG_NEIG1       GDAEVDQTVEILRKQRTRFNHVDREARNGDRVIIDFEGKI---DGEPFAGGTSKNYAFVLGAGQMLPEFE
TIG_PELUB       DTNETDKRIKEIAKSQNNFKEVAADVRAVEENLVIFDYKATID-GKDFTGGEGKNTQLILGKDLFIKGFD
TIG_HALHL       TDADLDNVLERLRKQHADYQEVDRAAQDEDRVVID--FHGTID-GEAFTGNSAEDAPLILGAGQLPEAFE
TIG_DESAD       XXXXLKEVENRLLQSMAKIAPIEDDRPAKDGELASVTFSAEMD-GEPIPGVQADNFDLPIGEGHSLEEFE
TIG_BORA1       TDAEVDKTLDVLRKQRASYETREGRA-AQDDDRIVLDFAGTID-GVPFEGGKAENFPFILGQGRMLPEFE
TIG_SHEAM       TDADVDSMIETLRKQHATFDAAPRAAEEGDKVVINFVGSV---DGEEFQGGKAEGFELQLGSGRMIPGFE
TIG_SALPC       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALCH       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_RHOPA       XXXXXXEAIKRIADANRAYADKAEGAKAETGDRVTVSFKGTID-GVAFDGGTGEDIPVVIGSASFIPGFE
TIG_PSEF5       ADADLDNMLEILRKQNVRFEVADRAAQNDDQLNIDFVGKV---DGEVFAGGSAKGTQLVLGSGRMIPGFE
TIG_DESAH       TDQEVDAQIQMIRKTMATKEKVTEERPVKVEDFVLIDYQGFVDGAPCDAAPKVENYVMAIGSNTLPAEFS
TIG_MESSB       PDEEVDEQVKRVADSVRTYXXXXXXXXXXDKVTLDYVGKL---DGEPFDGGSANDSEVVIGHGQFIPGFE
TIG_FRATN       TDKEVKQMIENLRKQFATFSEVDKAVEKDDKVTIDFVGK---KDGEAFEGGTANDTDVIIGSGQMIPGFE
TIG_ECOL6       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ECOL5       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_COXBU       TEEDLDKMLEALRKQYAEWKEMDRPAKADDRVIID--FEGTLD-GKPFERGSAKDFQLELGSKRMIAGFE
TIG_SHIBS       TDADVDGMLDTLRKQQATWKEKDSAVEAEDRVTIDFTGSV---DSEEFEGGKASDFVLAMGQGRMIPGFE
TIG_SHELP       TDADVDAMIETLRKQHATFEAVEREAAEGDKAKIDFVGSI---DGEEFEGGKAEDFELQLGSGRMIPGFE
TIG_SHIB3       TDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV---DSEEFEGGKASDFVLAMGQGRMIPGFE
TIG_RHOP5       GDSDVDDAIKRIVEANRGYDDKGEGATAASGDRVTVSFKGSID-GTPFDGGSAEGIPVVIGSGTFIPGFE
TIG_NEIG2       GDAEVDQTVEILRKQRTRFNHVDREARNGDRVIIDFEGKI---DGEPFAGGASKNYAFVLGAGQMLPEFE
TIG_MICAN       VDPESVENWFKERQEQLAVEDRGA--QLGDVAIVDYRGKSA-ETGEDIPDIDGEDLRVDMEAGRFIEGMV
TIG_HAEDU       TTADIDKMIEVLRKQQXXXXXXXXXXXXNDRVIIDFVIDGAEFEGGKATEFT-----LNMGQGSMIPGFE
TIG_ESCF3       TDADVDMMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSVD---GEEFEGGKASDFVLAMGQGRMIPGFE
TIG_CYAP8       NPEKLENWFKERQEQQATLEDRKA--EMGDVAIVDYEGYFAPEEGEEIPGVQGQDFRVDLTEGRFIQGMV
TIG_ACTP2       TEADLDKMIDVLRKXXXXXXXXXXXXXXEDRVVIDFVGSV---DGEEFEGGKATDFTLAMGQDRMIPGFE
TIG_VEREI       TEASIDKTLQGLRKQRRSFAQRAHDAPAQDGDGVTVDFEGKID-GEPFANGKAENFRFVIGEGPMPKEFE
TIG_SYNE7       FDANRVDNVLAEQQKQMAVEGRNAA--IGDVAVIDF-QGILVESGEEIPGGSGTDFQIEVEEDRFIPGFI
TIG_RHOFD       TDSAIDKTVDILRKQRRTFSQRPHDAAAQDGDRVTVDFEGKID-GEVFAGGKAEDFQFIVGDGQMLKEFE
TIG_OPITP       TEDEVDRVIEGMRAERAEFK--VAERPAAKGDYVKLAYEGKID-GKPIAEIAPDKQIYGANEGVIPG-LG
TIG_LACGA       LVKDVDAELNKRREQ--NAELVLKDGKAAKGDTVTIDYTGTID-GKPFDGGSAQNYSLELGSGTFIPGFE
TIG_ACTSZ       TEADVDNMIEVLRKQQATWAESQAAANAEDRVTIDFS--GTID-GEEFEGGKASDFVLFMGQGRMIPGFE
TIG_ENT38       TDADVDGMLDTLRKQQANWKDKDGAVDAEDRVTIDFSGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_AZOBR       EDSAVDEALTRLASAH-SVQAPVTEDRAAEKGDIAVIDSPVRSTGEALPGMDGKDYPLELGANQFVPGFE
TIG_SYNP6       FDANRVDNVLAEQQKQMAVEGRNAA--IGDVAVIDF-QGILVESGEEIPGGSGTDFQIEVEEDRFIPGFI
TIG_SHEHH       TEADVDSMIETLRNQHATFEVAERAAAEGDKAKINFVGSI---DGEEFEGGKADDFELQLGSGRMIPGFE
TIG_SALTY       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALTI       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALNS       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALHS       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_ROSDO       DDAAIDEALGSLAETAQNFENRKKGSKAKDGDQIVMDFLGKVD-GEAFDGGAAEDYPLVLGSNSFIPGFE
TIG_CITK8       TDADVDVMLDTLRKQQATWKDKDGAADAEDRVTIDFTGSV---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_ANADE       TDESVSAELTKIQDSMAQLVAVEGRFEAQEGDWAVIDHEGTID-GKPFDGSTAE----GVTVKVAPGPIT
TIG_SALSV       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALPK       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALPB       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALPA       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALG2       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALEP       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALDC       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_SALA4       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_PECCP       TDADVDTMLETLRKQQATWKETDRAAAAEDRVTIDFTGSI---DGEVFEGGKASDFVLAMGQNRMIPGFE
TIG_NEIMB       GDAEVDQTVEILRKQRTRFNHVEREARNGDRVIIDFEGKI---DGEPFAGGASKNYAFVLGASQMLPEFE
TIG_BURVG       GDAEIDRTLDILRKHYXXXXXXXXXXXXXXXXXXKNGDRVTVDFVGKIDDVTAEDFPFVLGEGRMLPEFE
TIG_BURCM       GDAEIDRTLDILRKHYXXXXXXXXXXXXXXXXXXXXXXRVTVDFVGKIDDVTAEDFPFVLGEGRMLPEFE
TIG_ARTAT       XXXXXXXXLDELRGRFGTLK--SVERPAKNDDFLTIDITATID-GEDIDS--AAGLSYQVGAGTMLEGLD
TIG_SERP5       NDADVDTMLDTLRKQQATWKETDRAAQAEDRVTVDFSGSI---DGEEFEGGKASDFVLAMGQGRMIPGFE
TIG_SALAR       TDADVDVMLDTLRKQQATWKEKDGAADAEDRVTLDFT--GTVD-GEEFEGGKATDFVLAMGQGRMIPGFE
TIG_ENTS8       TDADVDTMLDTLRKQQATWKDKDGAADAEDRVTIDFTGSV---DGEEFEGGKATDFVLAMGQGRMIPGFE
TIG_VIBHB       NDSDVEEMIETLRKQQATWXXXXXXXXXGKRVSIDFVGSI---DGEEFEGGKAENFPLEMGAGRMIPGFE
TIG_SILST       -DAAVTEALENLASSAQEFEEEGAASEDGDQVVIDFVGKVD---GEAFDGGSAEDYPLTLGSNSFIPGFE
TIG_PSYWF       TDEDVDTMIENLRKQRQEFAEKEGA--ADEGDQVTFDFEGSID-GEKFEGGSAEDFKLVLGSGQMIPGFE
TIG_DESMR       XXXXXXXXXXRVRKNLAEVKPLSDNRPAKDGEIVSVTFEAFED-GKAIPGVRAENFELTLGEGQALPAFE
TIG_BURCC       GDAEIDRTLDILRKHYXXXXXXXTAAKNGDRVTVDFVGKIDD---VAFQGGTAEDFPFVLGEGRMLPEFE
TIG_ACTPJ       TEADLDKMIDVLRKXXXXXXXXXXXXXXEDRVVIDFVGSV---DGEEFEGGKATDFTLAMGQSRMIPGFE
TIG_ACTP7       TEADLDKMIDVLRKXXXXXXXXXXXXXXEDRVVIDFVGSV---DGEEFEGGKATDFTLAMGQSRMIPGFE
TIG_SYNPX       DAAKVDEMLEDSRKQLATVVPVEGRAAEQGDIAV-LGFKGTSDDGSEIEGGSADSMDVDLEHGRMIPGFI
TIG_SPHAL       DDKAVMAKIEEFAAQMKRFEEAPKTRKAATGDQVIIDFAGSVD-GTPFDGGTGEDMAVEIGSGQLIPGFE
TIG_PSEAE       SDADVDNMLDVLRKQNTRFEVVERAAQNDDQLNIDFVGKI---DGEAFAGGSAKGTLLVLGSGRMIAGFE
TIG_PSEAB       SDADVDNMLDVLRKQNTRFEVVERAAQNDDQLNIDFVGKI---DGEAFAGGSAKGTLLVLGSGRMIAGFE
TIG_PSEA8       SDADVDNMLDVLRKQNTRFEVVERAAQNDDQLNIDFVGKI---DGEAFAGGSAKGTLLVLGSGRMIAGFE
TIG_NITMU       TPADVDKTLEVLRKQRVEFEPVDRPAQAGDRINID--YRGLID-GAEFAGGKAENFSLVLGEGRLLKDFE
TIG_NITHX       XXXXXXEAIKRIADQNRSYSARAEGAKAENGDRVTISFKGTID-GELFEAGSSDDVLVVLGSNALIPGFE
TIG_LACH4       YQKDVDAELDKRREQ--NAELVLKKGKSAKGDTVTIDYKGTID-GKEFEGGSAENYSLELGSGAFIPGFE
TIG_FRAP2       TDKEVKQMIENLRKQLATFSEVERAVQKDDKVVIDFVGKR---DGEVFEGGSANDQELVIGSGQMIPGFE
TIG_BURCH       GDAEIDRTLDILRKHYXXXXXXXXXXXXXXXXXXKNGDRVTVDFVGKIEDVTAEDFPFVLGEGRMLPEFE
TIG_BURCA       GDAEIDRTLDILRKHYXXXXXXXXXXXXXXXXXXKNGDRVTVDFVGKIEDVTAEDFPFVLGEGRMLPEFE
TIG_BURA4       GDAEIDRTLDILRKHYXXXXXXXXXXXXXXXXXXKNGDRVTVDFVGKIDDVTAEDFPFVLGEGRMLPEFE
TIG_VIBVY       KDADVEEMIETLRKQQXXXXXXXXXXXXGKRVSIDFVGSI---DGEEFEGGKAENFPLEMGAGRMIPGFE
TIG_MAGSA       PDAEVDDALAKIAERNETSEPVKRASKSGDVVVIDFVGKV---DGVAFPGGTAEGYSLKLGSNTFIPGFE
TIG_HAES2       SDADIDKMLDILRKQQATWIETQDVAKADDRVTIDFVGSV---DGEEFEGGKSTDFVLAMGQGRMIPGFE
TIG_HAES1       SDADIDKMLDILRKQQATWIETQDVAKADDRVTIDFVGSV---DGEEFEGGKSTDFVLAMGQGRMIPGFE
TIG_PSE14       VDSDLDNMLEVLRKQNVRFEVADRAAQNEDQLNIDFVGKV---DGEVFAGGSATATQLVLGSGRMIPGFE
TIG_NITSB       SDEEVEKRIEELADAMAQFKEIEEDRPAKEGDLVVIDFKGTLEDGSEIEGGSAQNFELRLGSGQFIPGFE
TIG_NEIMA       GDAEVDQTVEILRKQRTRFNHVEREARNGDRVIIDFEGKI---DGEPFAGGASKNYAFVLGASQMLPEFE
TIG_NEIM0       GDAEVDQTVEILRKQRTRFNHVEREARNGDRVIIDFEGKI---DGEPFAGGASKNYAFVLGASQMLPEFE
TIG_TERTT       TDADIDKMVETLQKGQSSWEPVKRKSKKGDKVTIDFLGKI---DGEAFDGGEAKGHQLELGSGSMIPGFE
TIG_SHESW       TDADVDSMIETLRKQHATY--AAVEREAADGDKVKMNFVGSVD-GEEFEGGKAEDFELQLGSGRMIPGFE
TIG_SHESR       TDADVDSMIETLRKQHATF--AAVEREAADGDKVKMNFVGSVD-GVEFEGGKADDFELQLGSGRMIPGF<