[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV55970.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
  117::221     1e-16  41%  228 aa  IOJAP_MAIZE RecName: Full=Protein Iojap;
    9::112     4e-15  39%  118 aa  YQEL_BACSU RecName: Full=Uncharacterized protein yqeL;
   15::105     3e-13  36%  105 aa  YBEB_SHIFL RecName: Full=Uncharacterized protein ybeB;
   15::105     3e-13  36%  105 aa  YBEB_ECOLI RecName: Full=Uncharacterized protein ybeB;
   15::105     3e-13  36%  105 aa  YBEB_ECOL6 RecName: Full=Uncharacterized protein ybeB;
   12::101     5e-13  37%  102 aa  Y034_HAEIN RecName: Full=Uncharacterized protein HI0034;
   97::203     3e-12  37%  228 aa  CG030_MOUSE RecName: Full=Uncharacterized protein C7orf30 homolog;
  103::194     2e-11  37%  234 aa  CG030_HUMAN RecName: Full=Uncharacterized protein C7orf30;
   70::175     7e-06  29%  190 aa  YM62_CAEEL RecName: Full=Uncharacterized protein K12H4.2;
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKA
IOJAP_MAIZE     -------------AVSLAKAASEIKATDIRVLCVRRLVYWTRFFIILTAFSNAQIDAISSKMRDI--GEK
YQEL_BACSU      ---------------IAAAACDDKRAEDILALDMEGISLVADYFLICHGNSDKQVQAIAREIKDADENGI
YBEB_SHIFL      ---------------------DDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRA-A
YBEB_ECOLI      ---------------------DDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRA-A
YBEB_ECOL6      ---------------------DDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRA-A
Y034_HAEIN      ---------------------DGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECK-KA
CG030_MOUSE     ----------------------QENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKLKC
CG030_HUMAN     ----------------------QENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKLKC
YM62_CAEEL      -------------------ALTDQRAKDVFVVKSEET-EMTPYTIICSAFNSRQASAISENLRSLLKSNG


                         .         .         *         .         .         .         .:140
query           QMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDLAAExxxxxxxxxxxxxxxxx
IOJAP_MAIZE     QFSKVASGDTKPNSWTLLDFGDVVVHIFLPQQRAFYNLEEFYGNATPIEL--------------------
YQEL_BACSU      QVKKM--EGFDEARWXXXXXXXXXXXXFHKDERSYYNLEKLWGDAPLADL--------------------
YBEB_SHIFL      GLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS---------------------------
YBEB_ECOLI      GLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS---------------------------
YBEB_ECOL6      GLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS---------------------------
Y034_HAEIN      GFETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLW----------------------------
CG030_MOUSE     RSDPYVKEGKDADDWLCVDFGSMVIHLMLPETRETYELEKLWTDDQLAQIAAE-----------------
CG030_HUMAN     KRDPVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLW----------------------------
YM62_CAEEL      SMSHARRSTKRSNGWYVSEVERVQVHVMSEECREKYDLEAIWGDDRILD---------------------


                         +         .         .         .         .         *         .:210
query           xx
IOJAP_MAIZE     --
YQEL_BACSU      --
YBEB_SHIFL      --
YBEB_ECOLI      --
YBEB_ECOL6      --
Y034_HAEIN      --
CG030_MOUSE     --
CG030_HUMAN     --
YM62_CAEEL      --