[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56026.1

[Show Plain Result]


## Summary of Sequence Search
    1::278
    2::271     2e-61  44%  273 aa  THIM_CLOAB RecName: Full=Hydroxyethylthiazole kinase;       
   11::271     4e-48  39%  271 aa  THIM_ALKOO RecName: Full=Hydroxyethylthiazole kinase;       
   10::271     2e-47  39%  274 aa  THIM_CLOTE RecName: Full=Hydroxyethylthiazole kinase;       
   13::262     9e-45  44%  276 aa  THIM_CLOB8 RecName: Full=Hydroxyethylthiazole kinase;       
    8::273     4e-43  36%  273 aa  THIM_CLOCE RecName: Full=Hydroxyethylthiazole kinase;       
   15::287     2e-42  36%  287 aa  THIM_METS3 RecName: Full=Hydroxyethylthiazole kinase;       
    8::241     2e-41  40%  285 aa  THIM_DESDA RecName: Full=Hydroxyethylthiazole kinase;       
    9::272     3e-41  36%  282 aa  THIM2_METST RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::267     5e-40  42%  273 aa  THIM_DESPS RecName: Full=Hydroxyethylthiazole kinase;       
    1::263     2e-39  38%  266 aa  THIM_UNCMA RecName: Full=Hydroxyethylthiazole kinase;       
   13::261     4e-39  39%  267 aa  THIM_LEPBP RecName: Full=Hydroxyethylthiazole kinase;       
   13::261     4e-39  39%  267 aa  THIM_LEPBA RecName: Full=Hydroxyethylthiazole kinase;       
    9::285     8e-39  34%  285 aa  THIM1_METST RecName: Full=Hydroxyethylthiazole kinase 1;       
   11::273     4e-38  32%  278 aa  THIM_CLOBB RecName: Full=Hydroxyethylthiazole kinase;       
   19::275     6e-38  37%  275 aa  THIM_METHJ RecName: Full=Hydroxyethylthiazole kinase;       
   11::268     6e-38  40%  269 aa  THIM_GEOTN RecName: Full=Hydroxyethylthiazole kinase;       
    9::262     8e-38  36%  267 aa  THIM_THETN RecName: Full=Hydroxyethylthiazole kinase;       
   11::273     8e-38  32%  278 aa  THIM_CLOBA RecName: Full=Hydroxyethylthiazole kinase;       
    9::267     1e-37  40%  269 aa  THIM_GEOSW RecName: Full=Hydroxyethylthiazole kinase;       
    1::261     9e-37  34%  261 aa  THIM_METMA RecName: Full=Hydroxyethylthiazole kinase;       
   16::262     1e-36  36%  264 aa  THIM_THEP3 RecName: Full=Hydroxyethylthiazole kinase;       
   19::268     2e-36  33%  272 aa  THIM_ALKMQ RecName: Full=Hydroxyethylthiazole kinase;       
   16::262     5e-36  35%  263 aa  THIM_THEPX RecName: Full=Hydroxyethylthiazole kinase;       
   10::267     6e-36  36%  269 aa  THIM_BREBN RecName: Full=Hydroxyethylthiazole kinase;       
    8::263     1e-35  35%  266 aa  THIM_METM6 RecName: Full=Hydroxyethylthiazole kinase;       
    8::262     2e-35  37%  264 aa  THIM_METLZ RecName: Full=Hydroxyethylthiazole kinase;       
    8::263     3e-35  35%  266 aa  THIM_METM5 RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     4e-35  34%  267 aa  THIM_PASMU RecName: Full=Hydroxyethylthiazole kinase;       
    8::262     4e-35  35%  264 aa  THIM_ANOFW RecName: Full=Hydroxyethylthiazole kinase;       
   11::268     5e-35  38%  269 aa  THIM_GEOKA RecName: Full=Hydroxyethylthiazole kinase;       
    8::273     7e-35  36%  273 aa  THIM_NATTJ RecName: Full=Hydroxyethylthiazole kinase;       
    7::262     9e-35  36%  268 aa  THIM_SYNFM RecName: Full=Hydroxyethylthiazole kinase;       
    8::263     9e-35  35%  266 aa  THIM_METM7 RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     2e-34  33%  269 aa  THIM_BACWK RecName: Full=Hydroxyethylthiazole kinase;       
    6::263     3e-34  35%  266 aa  THIM_HAES1 RecName: Full=Hydroxyethylthiazole kinase;       
    8::268     4e-34  32%  269 aa  THIM_BACC4 RecName: Full=Hydroxyethylthiazole kinase;       
    1::260     6e-34  32%  261 aa  THIM_METAC RecName: Full=Hydroxyethylthiazole kinase;       
    8::263     7e-34  35%  266 aa  THIM_METMP RecName: Full=Hydroxyethylthiazole kinase;       
    1::269     7e-34  34%  272 aa  THIM_BACSU RecName: Full=Hydroxyethylthiazole kinase;       
    6::268     7e-34  32%  269 aa  THIM_BACCR RecName: Full=Hydroxyethylthiazole kinase;       
    6::268     7e-34  32%  269 aa  THIM_BACCN RecName: Full=Hydroxyethylthiazole kinase;       
    2::248     1e-33  32%  256 aa  THIM_EXIS2 RecName: Full=Hydroxyethylthiazole kinase;       
    5::267     2e-33  35%  267 aa  THIM_DESHD RecName: Full=Hydroxyethylthiazole kinase;       
    5::267     3e-33  35%  267 aa  THIM_DESHY RecName: Full=Hydroxyethylthiazole kinase;       
    6::268     3e-33  32%  269 aa  THIM_BACC2 RecName: Full=Hydroxyethylthiazole kinase;       
   17::272     4e-33  38%  274 aa  THIM_DESOH RecName: Full=Hydroxyethylthiazole kinase;       
    5::260     6e-33  33%  261 aa  THIM_METBF RecName: Full=Hydroxyethylthiazole kinase;       
    9::263     6e-33  35%  266 aa  THIM_CALMQ RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     1e-32  34%  269 aa  THIM_LISMH RecName: Full=Hydroxyethylthiazole kinase;       
    8::268     1e-32  32%  269 aa  THIM_BACLD RecName: Full=Hydroxyethylthiazole kinase;       
   15::266     1e-32  36%  274 aa  THIM_PHOPR RecName: Full=Hydroxyethylthiazole kinase;       
   14::267     1e-32  37%  267 aa  THIM_MOOTA RecName: Full=Hydroxyethylthiazole kinase;       
    6::263     1e-32  34%  263 aa  THIM_HAEIG RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     2e-32  34%  269 aa  THIM_LISMO RecName: Full=Hydroxyethylthiazole kinase;       
    6::263     2e-32  33%  263 aa  THIM_HAEIE RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     2e-32  34%  269 aa  THIM_LISIN RecName: Full=Hydroxyethylthiazole kinase;       
    8::265     2e-32  34%  265 aa  THIM_HAEIN RecName: Full=Hydroxyethylthiazole kinase;       
    6::249     2e-32  31%  265 aa  THIM1_CLOBM RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::258     3e-32  34%  260 aa  THIM_CAMLR RecName: Full=Hydroxyethylthiazole kinase;       
   11::264     3e-32  41%  264 aa  THIM_BRAHW RecName: Full=Hydroxyethylthiazole kinase;       
    6::244     7e-32  32%  265 aa  THIM2_CLOBL RecName: Full=Hydroxyethylthiazole kinase 2;       
    8::264     9e-32  35%  266 aa  THIM_METVS RecName: Full=Hydroxyethylthiazole kinase;       
   10::256     9e-32  34%  268 aa  THIM_ARCFU RecName: Full=Hydroxyethylthiazole kinase;       
    6::249     9e-32  30%  265 aa  THIM2_CLOBH RecName: Full=Hydroxyethylthiazole kinase 2;       
    6::249     9e-32  30%  265 aa  THIM2_CLOB1 RecName: Full=Hydroxyethylthiazole kinase 2;       
    8::265     1e-31  34%  265 aa  THIM_HAEI8 RecName: Full=Hydroxyethylthiazole kinase;       
    6::244     1e-31  31%  265 aa  THIM2_CLOB6 RecName: Full=Hydroxyethylthiazole kinase 2;       
    7::264     2e-31  34%  269 aa  THIM_LISMC RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     3e-31  34%  269 aa  THIM_LISMF RecName: Full=Hydroxyethylthiazole kinase;       
    2::244     3e-31  36%  259 aa  THIM_HELPS RecName: Full=Hydroxyethylthiazole kinase;       
    6::244     3e-31  31%  265 aa  THIM2_CLOBJ RecName: Full=Hydroxyethylthiazole kinase 2;       
    4::264     3e-31  34%  269 aa  THIM_ACTSZ RecName: Full=Hydroxyethylthiazole kinase;       
    6::244     3e-31  31%  265 aa  THIM2_CLOBK RecName: Full=Hydroxyethylthiazole kinase 2;       
    2::244     4e-31  34%  259 aa  THIM_HELPJ RecName: Full=Hydroxyethylthiazole kinase;       
    9::141     4e-31  51%  267 aa  THIM_DESVM RecName: Full=Hydroxyethylthiazole kinase;       
    3::245     2e-30  35%  260 aa  THIM_HELPG RecName: Full=Hydroxyethylthiazole kinase;       
   10::264     2e-30  40%  266 aa  THIM_DESDG RecName: Full=Hydroxyethylthiazole kinase;       
   10::264     2e-30  38%  271 aa  THIM_BACP2 RecName: Full=Hydroxyethylthiazole kinase;       
   19::218     3e-30  41%  278 aa  THIM_LEPCP RecName: Full=Hydroxyethylthiazole kinase;       
    7::248     3e-30  36%  263 aa  THIM_EXISA RecName: Full=Hydroxyethylthiazole kinase;       
   13::130     3e-30  53%  273 aa  THIM_DESAP RecName: Full=Hydroxyethylthiazole kinase;       
    5::261     3e-30  32%  262 aa  THIM_CLOD6 RecName: Full=Hydroxyethylthiazole kinase;       
    2::244     4e-30  35%  259 aa  THIM_HELPY RecName: Full=Hydroxyethylthiazole kinase;       
    1::259     4e-30  36%  260 aa  THIM_BACSK RecName: Full=Hydroxyethylthiazole kinase;       
   14::207     5e-30  39%  266 aa  THIM_METB6 RecName: Full=Hydroxyethylthiazole kinase;       
    7::208     6e-30  37%  265 aa  THIM_PYRFU RecName: Full=Hydroxyethylthiazole kinase;       
    6::262     8e-30  32%  262 aa  THIM_LACBA RecName: Full=Hydroxyethylthiazole kinase;       
    6::198     1e-29  38%  255 aa  THIM_LYSSC RecName: Full=Hydroxyethylthiazole kinase;       
   12::268     1e-29  41%  268 aa  THIM_AGRRK RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     1e-29  30%  268 aa  THIM_BACCZ RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     1e-29  30%  268 aa  THIM_BACCQ RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     1e-29  30%  268 aa  THIM_BACC7 RecName: Full=Hydroxyethylthiazole kinase;       
    9::268     2e-29  45%  268 aa  THIM_DESAA RecName: Full=Hydroxyethylthiazole kinase;       
   11::266     2e-29  37%  270 aa  THIM_SYNAS RecName: Full=Hydroxyethylthiazole kinase;       
    3::245     2e-29  33%  260 aa  THIM_HELPH RecName: Full=Hydroxyethylthiazole kinase;       
   12::127     2e-29  51%  269 aa  THIM_CHLSY RecName: Full=Hydroxyethylthiazole kinase;       
   12::127     2e-29  51%  269 aa  THIM_CHLAA RecName: Full=Hydroxyethylthiazole kinase;       
   15::254     3e-29  40%  267 aa  THIM_CHLT3 RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACC3 RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACC0 RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACAN RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACAH RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACAC RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     3e-29  30%  268 aa  THIM_BACAA RecName: Full=Hydroxyethylthiazole kinase;       
    3::262     4e-29  32%  263 aa  THIM_STAS1 RecName: Full=Hydroxyethylthiazole kinase;       
   10::266     4e-29  32%  268 aa  THIM_PYRAB RecName: Full=Hydroxyethylthiazole kinase;       
    7::264     4e-29  33%  269 aa  THIM_LISW6 RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     5e-29  30%  268 aa  THIM_BACHK RecName: Full=Hydroxyethylthiazole kinase;       
    6::266     9e-29  29%  268 aa  THIM_BACC1 RecName: Full=Hydroxyethylthiazole kinase;       
    7::263     2e-28  32%  265 aa  THIM_PYRHO RecName: Full=Hydroxyethylthiazole kinase;       
    6::261     2e-28  39%  263 aa  THIM_VIBPA RecName: Full=Hydroxyethylthiazole kinase;       
    3::260     2e-28  31%  260 aa  THIM1_STRPS RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     2e-28  31%  260 aa  THIM1_STRPJ RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     3e-28  31%  260 aa  THIM1_STRZT RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     4e-28  31%  260 aa  THIM1_STRPN RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     6e-28  31%  260 aa  THIM1_STRZP RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     6e-28  31%  260 aa  THIM1_STRR6 RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     6e-28  31%  260 aa  THIM1_STRP7 RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     6e-28  31%  260 aa  THIM1_STRP4 RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::260     6e-28  31%  260 aa  THIM1_STRP2 RecName: Full=Hydroxyethylthiazole kinase 1;       
    5::256     8e-28  32%  262 aa  THIM_CHLFF RecName: Full=Hydroxyethylthiazole kinase;       
    8::261     1e-27  39%  261 aa  THIM_VIBSL RecName: Full=Hydroxyethylthiazole kinase;       
    6::204     1e-27  37%  267 aa  THIM_RUBXD RecName: Full=Hydroxyethylthiazole kinase;       
    3::260     1e-27  31%  260 aa  THIM1_STRPI RecName: Full=Hydroxyethylthiazole kinase 1;       
    3::257     3e-27  33%  261 aa  THIM_STRSY RecName: Full=Hydroxyethylthiazole kinase;       
   12::123     4e-27  50%  270 aa  THIM_ROSS1 RecName: Full=Hydroxyethylthiazole kinase;       
    8::256     5e-27  33%  262 aa  THIM_CHLCV RecName: Full=Hydroxyethylthiazole kinase;       
    3::260     5e-27  30%  260 aa  THIM1_STRZJ RecName: Full=Hydroxyethylthiazole kinase 1;       
    6::263     7e-27  34%  263 aa  THIM_LACPL RecName: Full=Hydroxyethylthiazole kinase;       
    6::254     1e-26  38%  263 aa  THIM_VIBHB RecName: Full=Hydroxyethylthiazole kinase;       
    6::256     2e-26  42%  260 aa  THIM_YERE8 RecName: Full=Hydroxyethylthiazole kinase;       
    8::266     2e-26  29%  269 aa  THIM_HAEPS RecName: Full=Hydroxyethylthiazole kinase;       
    2::202     3e-26  36%  258 aa  THIM_RHIEC RecName: Full=Hydroxyethylthiazole kinase;       
   12::263     3e-26  30%  265 aa  THIM_CLONN RecName: Full=Hydroxyethylthiazole kinase;       
    3::198     1e-25  38%  236 aa  THIM_STRS2 RecName: Full=Hydroxyethylthiazole kinase;       
    3::253     1e-25  33%  256 aa  THIM_STRA1 RecName: Full=Hydroxyethylthiazole kinase;       
   12::143     1e-25  52%  270 aa  THIM_ROSCS RecName: Full=Hydroxyethylthiazole kinase;       
   19::262     1e-25  35%  266 aa  THIM_PSYWF RecName: Full=Hydroxyethylthiazole kinase;       
   17::216     2e-25  40%  277 aa  THIM_RHOFD RecName: Full=Hydroxyethylthiazole kinase;       
    2::202     2e-25  35%  258 aa  THIM_RHIE6 RecName: Full=Hydroxyethylthiazole kinase;       
    3::253     2e-25  32%  256 aa  THIM_STRA3 RecName: Full=Hydroxyethylthiazole kinase;       
   10::210     3e-25  50%  272 aa  THIM_BACA2 RecName: Full=Hydroxyethylthiazole kinase;       
   17::264     5e-25  39%  264 aa  THIM_SERP5 RecName: Full=Hydroxyethylthiazole kinase;       
   14::198     5e-25  44%  267 aa  THIM_DESVV RecName: Full=Hydroxyethylthiazole kinase;       
   14::198     5e-25  44%  267 aa  THIM_DESVH RecName: Full=Hydroxyethylthiazole kinase;       
    3::253     6e-25  32%  256 aa  THIM_STRA5 RecName: Full=Hydroxyethylthiazole kinase;       
    9::253     1e-24  35%  270 aa  THIM_COPPD RecName: Full=Hydroxyethylthiazole kinase;       
   19::216     2e-24  36%  288 aa  THIM_HALWD RecName: Full=Hydroxyethylthiazole kinase;       
    2::259     2e-24  33%  261 aa  THIM_BACHD RecName: Full=Hydroxyethylthiazole kinase;       
   11::264     3e-24  35%  267 aa  THIM_RHILW RecName: Full=Hydroxyethylthiazole kinase;       
    5::265     7e-24  37%  265 aa  THIM_METPE RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     9e-24  38%  265 aa  THIM_SALTI RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     9e-24  42%  265 aa  THIM_SALAR RecName: Full=Hydroxyethylthiazole kinase;       
    1::262     9e-24  28%  265 aa  THIM_CLOP1 RecName: Full=Hydroxyethylthiazole kinase;       
    6::255     9e-24  29%  257 aa  THIM1_OCEIH RecName: Full=Hydroxyethylthiazole kinase 1;       
    1::262     2e-23  28%  265 aa  THIM_CLOPE RecName: Full=Hydroxyethylthiazole kinase;       
    5::252     2e-23  31%  262 aa  THIM_CHLAB RecName: Full=Hydroxyethylthiazole kinase;       
    4::260     2e-23  28%  260 aa  THIM2_OCEIH RecName: Full=Hydroxyethylthiazole kinase 2;       
   15::263     3e-23  38%  265 aa  THIM_SALTY RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     3e-23  38%  265 aa  THIM_SALNS RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     3e-23  38%  265 aa  THIM_SALG2 RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     3e-23  38%  265 aa  THIM_SALEP RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     3e-23  38%  265 aa  THIM_SALDC RecName: Full=Hydroxyethylthiazole kinase;       
    3::265     3e-23  30%  269 aa  THIM_LACSS RecName: Full=Hydroxyethylthiazole kinase;       
    4::249     3e-23  29%  262 aa  THIM_STAEQ RecName: Full=Hydroxyethylthiazole kinase;       
    1::263     3e-23  28%  264 aa  THIM_STACT RecName: Full=Hydroxyethylthiazole kinase;       
   26::139     3e-23  46%  279 aa  THIM_METMJ RecName: Full=Hydroxyethylthiazole kinase;       
   10::267     3e-23  32%  271 aa  THIM_AKKM8 RecName: Full=Hydroxyethylthiazole kinase;       
    4::138     3e-23  37%  263 aa  THIM2_CLOBM RecName: Full=Hydroxyethylthiazole kinase 2;       
    4::138     3e-23  37%  263 aa  THIM1_CLOBK RecName: Full=Hydroxyethylthiazole kinase 1;       
    4::138     3e-23  37%  263 aa  THIM1_CLOBJ RecName: Full=Hydroxyethylthiazole kinase 1;       
    4::138     3e-23  37%  263 aa  THIM1_CLOBH RecName: Full=Hydroxyethylthiazole kinase 1;       
    4::138     3e-23  37%  263 aa  THIM1_CLOB6 RecName: Full=Hydroxyethylthiazole kinase 1;       
    4::138     3e-23  37%  263 aa  THIM1_CLOB1 RecName: Full=Hydroxyethylthiazole kinase 1;       
   15::260     4e-23  38%  265 aa  THIM_SALSV RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     4e-23  38%  265 aa  THIM_SALHS RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     6e-23  41%  265 aa  THIM_SALPK RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     6e-23  41%  265 aa  THIM_SALPA RecName: Full=Hydroxyethylthiazole kinase;       
   12::268     6e-23  46%  278 aa  THIM_CHLAD RecName: Full=Hydroxyethylthiazole kinase;       
   15::260     8e-23  38%  265 aa  THIM_SALPC RecName: Full=Hydroxyethylthiazole kinase;       
   15::260     8e-23  38%  265 aa  THIM_SALCH RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     8e-23  31%  275 aa  THIM_ACIBY RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     8e-23  36%  275 aa  THIM_ACIBC RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     8e-23  31%  275 aa  THIM_ACIB5 RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     8e-23  31%  275 aa  THIM_ACIB3 RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     1e-22  38%  265 aa  THIM_SALA4 RecName: Full=Hydroxyethylthiazole kinase;       
   44::274     1e-22  30%  278 aa  THIM_NATPD RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     1e-22  30%  275 aa  THIM_ACIBT RecName: Full=Hydroxyethylthiazole kinase;       
   14::271     1e-22  30%  275 aa  THIM_ACIBS RecName: Full=Hydroxyethylthiazole kinase;       
   15::263     1e-22  38%  265 aa  THIM_SALPB RecName: Full=Hydroxyethylthiazole kinase;       
    4::249     2e-22  29%  262 aa  THIM_STAES RecName: Full=Hydroxyethylthiazole kinase;       
    4::138     2e-22  36%  263 aa  THIM1_CLOBL RecName: Full=Hydroxyethylthiazole kinase 1;       
   14::209     2e-22  33%  267 aa  THIM_TOLAT RecName: Full=Hydroxyethylthiazole kinase;       
   16::263     2e-22  37%  264 aa  THIM_ERWCT RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     3e-22  37%  266 aa  THIM_STAAW RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     3e-22  37%  266 aa  THIM_STAAS RecName: Full=Hydroxyethylthiazole kinase;       
    4::261     4e-22  35%  261 aa  THIM_MACCJ RecName: Full=Hydroxyethylthiazole kinase;       
    9::254     4e-22  37%  264 aa  THIM_ALISL RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     5e-22  36%  263 aa  THIM_STAAE RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     5e-22  36%  263 aa  THIM_STAAC RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     5e-22  36%  263 aa  THIM_STAA8 RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     5e-22  36%  263 aa  THIM_STAA3 RecName: Full=Hydroxyethylthiazole kinase;       
    9::264     5e-22  28%  265 aa  THIM_PEDPA RecName: Full=Hydroxyethylthiazole kinase;       
   16::257     8e-22  34%  267 aa  THIM_VIBF1 RecName: Full=Hydroxyethylthiazole kinase;       
   11::211     8e-22  34%  267 aa  THIM_RHIL3 RecName: Full=Hydroxyethylthiazole kinase;       
    1::145     8e-22  36%  254 aa  THIM_LACF3 RecName: Full=Hydroxyethylthiazole kinase;       
   13::254     1e-21  34%  264 aa  THIM_VIBFM RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     1e-21  37%  263 aa  THIM_STAAN RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     1e-21  37%  263 aa  THIM_STAAM RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     1e-21  37%  263 aa  THIM_STAA9 RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     1e-21  37%  263 aa  THIM_STAA2 RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     1e-21  37%  263 aa  THIM_STAA1 RecName: Full=Hydroxyethylthiazole kinase;       
   20::215     1e-21  34%  265 aa  THIM_LEPIN RecName: Full=Hydroxyethylthiazole kinase;       
   20::215     1e-21  34%  265 aa  THIM_LEPIC RecName: Full=Hydroxyethylthiazole kinase;       
  245::444     1e-21  30%  518 aa  THI4_SCHPO RecName: Full=Probable thiamine biosynthetic
   25::260     1e-21  33%  275 aa  THIM_CLAMS RecName: Full=Hydroxyethylthiazole kinase;       
   14::255     2e-21  28%  266 aa  THIM_DESRM RecName: Full=Hydroxyethylthiazole kinase;       
   10::265     2e-21  30%  266 aa  THIM_SYNWW RecName: Full=Hydroxyethylthiazole kinase;       
   23::215     3e-21  32%  264 aa  THIM_LEPBL RecName: Full=Hydroxyethylthiazole kinase;       
   23::215     3e-21  32%  264 aa  THIM_LEPBJ RecName: Full=Hydroxyethylthiazole kinase;       
   35::308     3e-21  39%  309 aa  THIM_DESAH RecName: Full=Hydroxyethylthiazole kinase;       
   12::124     3e-21  49%  270 aa  THIM_COREF RecName: Full=Hydroxyethylthiazole kinase;       
   16::144     5e-21  40%  269 aa  THIM_CLOK5 RecName: Full=Hydroxyethylthiazole kinase;       
   16::144     5e-21  40%  269 aa  THIM_CLOK1 RecName: Full=Hydroxyethylthiazole kinase;       
   16::263     7e-21  35%  264 aa  THIM_PECCP RecName: Full=Hydroxyethylthiazole kinase;       
   11::141     9e-21  38%  269 aa  THIM_LACRJ RecName: Full=Hydroxyethylthiazole kinase;       
   11::141     9e-21  38%  269 aa  THIM_LACRD RecName: Full=Hydroxyethylthiazole kinase;       
    6::121     2e-20  44%  480 aa  THIME_SYMTH RecName: Full=Thiamine biosynthesis bifunctional
    1::262     2e-20  27%  265 aa  THIM_CLOPS RecName: Full=Hydroxyethylthiazole kinase;       
   15::259     3e-20  41%  262 aa  THIM_CITK8 RecName: Full=Hydroxyethylthiazole kinase;       
   21::143     6e-20  37%  268 aa  THIM_FINM2 RecName: Full=Hydroxyethylthiazole kinase;       
   19::216     8e-20  35%  277 aa  THIM_PROAC RecName: Full=Hydroxyethylthiazole kinase;       
    8::267     1e-19  38%  268 aa  THIM_CORGB RecName: Full=Hydroxyethylthiazole kinase;       
    1::246     2e-19  41%  257 aa  THIM_ROSDO RecName: Full=Hydroxyethylthiazole kinase;       
   17::252     2e-19  42%  257 aa  THIM_KLEP3 RecName: Full=Hydroxyethylthiazole kinase;       
    8::124     2e-19  43%  268 aa  THIM_CORGL RecName: Full=Hydroxyethylthiazole kinase;       
   17::252     4e-19  42%  257 aa  THIM_KLEP7 RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     9e-19  31%  262 aa  THIM_ECO5E RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     9e-19  31%  262 aa  THIM_ECO57 RecName: Full=Hydroxyethylthiazole kinase;       
   26::222     1e-18  38%  275 aa  THIM_CLAM3 RecName: Full=Hydroxyethylthiazole kinase;       
   12::148     3e-18  35%  267 aa  THIM2_STRZJ RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     3e-18  35%  267 aa  THIM2_STRP4 RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     4e-18  34%  267 aa  THIM2_STRP7 RecName: Full=Hydroxyethylthiazole kinase 2;       
   22::256     6e-18  35%  262 aa  THIM_ECO81 RecName: Full=Hydroxyethylthiazole kinase;       
   12::148     7e-18  34%  267 aa  THIM2_STRZT RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     7e-18  34%  267 aa  THIM2_STRZP RecName: Full=Hydroxyethylthiazole kinase 2;       
    1::256     1e-17  35%  256 aa  THIM_ENT38 RecName: Full=Hydroxyethylthiazole kinase;       
   15::212     2e-17  30%  267 aa  THIM_PSYIN RecName: Full=Hydroxyethylthiazole kinase;       
   13::149     2e-17  34%  268 aa  THIM2_STRPS RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     2e-17  34%  267 aa  THIM2_STRPJ RecName: Full=Hydroxyethylthiazole kinase 2;       
   15::148     2e-17  37%  272 aa  THIM_ENTFA RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-17  35%  262 aa  THIM_ECOSE RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-17  35%  262 aa  THIM_ECOL5 RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-17  35%  262 aa  THIM_ECO8A RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-17  35%  262 aa  THIM_ECO7I RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-17  35%  262 aa  THIM_ECO55 RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     3e-17  35%  262 aa  THIM_SHISS RecName: Full=Hydroxyethylthiazole kinase;       
   12::148     3e-17  34%  267 aa  THIM2_STRR6 RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     3e-17  34%  267 aa  THIM2_STRPN RecName: Full=Hydroxyethylthiazole kinase 2;       
   12::148     3e-17  34%  267 aa  THIM2_STRP2 RecName: Full=Hydroxyethylthiazole kinase 2;       
   22::256     4e-17  35%  262 aa  THIM_SHIB3 RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     4e-17  35%  262 aa  THIM_ECOSM RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     6e-17  40%  262 aa  THIM_ECOUT RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     6e-17  40%  262 aa  THIM_ECOL6 RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     6e-17  40%  262 aa  THIM_ECOK1 RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     6e-17  40%  262 aa  THIM_ECO45 RecName: Full=Hydroxyethylthiazole kinase;       
   12::148     6e-17  34%  267 aa  THIM2_STRPI RecName: Full=Hydroxyethylthiazole kinase 2;       
   22::145     1e-16  40%  262 aa  THIM_SHIBS RecName: Full=Hydroxyethylthiazole kinase;       
    3::141     1e-16  33%  259 aa  THIM1_LEUMM RecName: Full=Hydroxyethylthiazole kinase 1;       
   18::145     1e-16  40%  265 aa  THIM_ENTS8 RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     2e-16  34%  263 aa  THIM_STAAR RecName: Full=Hydroxyethylthiazole kinase;       
   22::256     2e-16  34%  262 aa  THIM_SHIDS RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECOLI RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECOLC RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECOHS RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECODH RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECOBW RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     2e-16  40%  262 aa  THIM_ECO24 RecName: Full=Hydroxyethylthiazole kinase;       
   37::249     2e-16  32%  267 aa  THIM_CARHZ RecName: Full=Hydroxyethylthiazole kinase;       
    8::260     3e-16  35%  262 aa  THIM_RHOS5 RecName: Full=Hydroxyethylthiazole kinase;       
    4::243     3e-16  27%  250 aa  THIM_LACLM RecName: Full=Hydroxyethylthiazole kinase;       
   22::253     3e-16  36%  259 aa  THIM_ECO27 RecName: Full=Hydroxyethylthiazole kinase;       
   21::145     4e-16  38%  280 aa  THIM_LACCB RecName: Full=Hydroxyethylthiazole kinase;       
   21::145     5e-16  38%  280 aa  THIM_LACC3 RecName: Full=Hydroxyethylthiazole kinase;       
    4::243     7e-16  27%  250 aa  THIM_LACLS RecName: Full=Hydroxyethylthiazole kinase;       
    4::262     9e-16  34%  263 aa  THIM_STAHJ RecName: Full=Hydroxyethylthiazole kinase;       
    4::186     9e-16  40%  263 aa  THIM_STAAB RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     9e-16  40%  262 aa  THIM_ECOLU RecName: Full=Hydroxyethylthiazole kinase;       
    2::248     1e-15  30%  270 aa  THIM_HERA2 RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     3e-15  39%  262 aa  THIM_SHIFL RecName: Full=Hydroxyethylthiazole kinase;       
   22::145     3e-15  39%  262 aa  THIM_SHIF8 RecName: Full=Hydroxyethylthiazole kinase;       
   34::272     1e-14  33%  277 aa  THIM_GEMAT RecName: Full=Hydroxyethylthiazole kinase;       
   28::290     2e-14  36%  303 aa  THIM_BIFA0 RecName: Full=Hydroxyethylthiazole kinase;       
    8::260     3e-14  35%  262 aa  THIM_RHOS4 RecName: Full=Hydroxyethylthiazole kinase;       
   13::271     3e-14  34%  281 aa  THIM_RHOE4 RecName: Full=Hydroxyethylthiazole kinase;       
   14::269     3e-14  32%  274 aa  THIM_ACIAD RecName: Full=Hydroxyethylthiazole kinase;       
    8::260     6e-14  35%  262 aa  THIM_RHOSK RecName: Full=Hydroxyethylthiazole kinase;       
    8::260     6e-14  35%  262 aa  THIM_RHOS1 RecName: Full=Hydroxyethylthiazole kinase;       
  250::523     8e-14  29%  540 aa  THI6_YEAST RecName: Full=Thiamine biosynthetic bifunctional
   15::242     1e-13  33%  246 aa  THIM_AGRT5 RecName: Full=Probable hydroxyethylthiazole kinase;     
   18::145     1e-13  33%  273 aa  THIM2_LEUMM RecName: Full=Hydroxyethylthiazole kinase 2;       
    4::143     3e-13  25%  250 aa  THIM_LACLA RecName: Full=Hydroxyethylthiazole kinase;       
   27::221     5e-13  27%  272 aa  THIM_DICNV RecName: Full=Hydroxyethylthiazole kinase;       
    1::145     7e-13  33%  262 aa  THIM_ESCF3 RecName: Full=Hydroxyethylthiazole kinase;       
   18::253     9e-13  38%  267 aa  THIM_LARHH RecName: Full=Hydroxyethylthiazole kinase;       
    3::133     1e-12  32%  259 aa  THIM_LEUCK RecName: Full=Hydroxyethylthiazole kinase;       
   22::270     2e-12  32%  274 aa  THIM_GRABC RecName: Full=Hydroxyethylthiazole kinase;       
   17::292     3e-12  40%  294 aa  THIM_BIFAA RecName: Full=Hydroxyethylthiazole kinase;       
   34::304     2e-11  37%  314 aa  THIM_BIFLO RecName: Full=Hydroxyethylthiazole kinase;       
   41::212     5e-11  31%  266 aa  THIM_DESMR RecName: Full=Hydroxyethylthiazole kinase;       
   34::304     9e-11  37%  314 aa  THIM_BIFLI RecName: Full=Hydroxyethylthiazole kinase;       
   34::304     1e-10  37%  314 aa  THIM_BIFLD RecName: Full=Hydroxyethylthiazole kinase;       
   27::213     4e-09  45%  275 aa  THIM_KINRD RecName: Full=Hydroxyethylthiazole kinase;       
   65::146     4e-05  34%  260 aa  THIM_BURTA RecName: Full=Hydroxyethylthiazole kinase;       
   67::146     6e-04  32%  276 aa  THIM_BURPS RecName: Full=Hydroxyethylthiazole kinase;       
   67::146     6e-04  32%  276 aa  THIM_BURP6 RecName: Full=Hydroxyethylthiazole kinase;       
   67::146     6e-04  32%  276 aa  THIM_BURP1 RecName: Full=Hydroxyethylthiazole kinase;       
   67::146     6e-04  32%  276 aa  THIM_BURP0 RecName: Full=Hydroxyethylthiazole kinase;       
    1::278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
THIM_CLOAB      -----LKERLENVRGTNPLIHNITNYVTVNDCANILLACGASPIMADDIGEVEEITSICRGLNINIGTLN
THIM_ALKOO      ---------LEQIKEKTPLVHHITNYVTVNDCANITLAIGGSPVMADDHKEVEDMVSIASAVVLNIGTLN
THIM_CLOTE      --------SLLKLKEKNPLIHHITNYVTVNDCANIVLAIGASPVMADDIREVEDMVSIASALVINIGTLN
THIM_CLOB8      ---------LNEVRNKKPLVHNITNYVTVNDCANILLAIGASPIMADDIKEAADITKISSALVINIGTLN
THIM_CLOCE      -----ITRLISEVRSKKPLIHNITNYVTVNDCANVTLAIGASPXXXXXXXXXXXXXXXXXXLVINIGTLN
THIM_METS3      ---------LNEVKSKNPLTHCITNFVTVNDCANAVLAIGASPIMSEDIEEVAEVVSIADALVINIGKLS
THIM_DESDA      ---------LDTVRRHEPVVHCITNYVTVNDCANMVLAAGGSPIMXXXXXXXXXXXXLSQALVINIGTLN
THIM2_METST     ---------IEKLRNKCPLTHCITNYVTINDCANVVLAIGGSPAMANEAPEIEEFVEAAGVTIINMGTLL
THIM_DESPS      ---------LQQIRENKPLIHNITNFVVMNYTANVLLATGASPVMAHAQNEVEEMVAFAGSLVLNIGTLS
THIM_UNCMA      MDARSLSGILTEVREKRPLVHHITNYVTVNDCANVTLCIGAAPVMAHAHDEVAEMVAMAGALVLNIGTLD
THIM_LEPBP      ---------LELVRSKSPLVHNITNYVVMNNTANALLAIGASPIMAHAIEEVEEMVTICSATVINIGTLS
THIM_LEPBA      ---------LELVRSKSPLVHNITNYVVMNNTANALLAIGASPIMAHAIEEVEEMVTICSATVINIGTLS
THIM1_METST     -----IAQVVEILREKSPLTHCITNVVTVKDCANAVLAVGASPIMANAPEEAEEIVGISNSLVINIGTLT
THIM_CLOBB      -------RLLEEVRAKKPLVHSITNYITATDCANVILAVGGSPTMADYVKEVEEIASISSAVVLNMGVIS
THIM_METHJ      ---------LTDIREKTPLVHHMTNYVTVNDCANITLCIGASPVMAHAEEEVGEMVALAGALVLNIGTLD
THIM_GEOTN      ---------LERVRGTKPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMAKLAGALVLNIGTLN
THIM_THETN      ------------LRDKKPLIHHITNVVTVNDCANVTLAIGALPVMAYAPEEVEEMVKNANALVLNIGTLS
THIM_CLOBA      -------RLLEEVRTKKPLVHSITNYITATDCANVILAVGGSPTMADYVKEVEEIASISSAVVLNMGVIS
THIM_GEOSW      --------ALQMVRQANPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLN
THIM_METMA      -----MKNPLKTIRETKPLVHHITNWVTIYDCANITRAFGALPVMAHAPEECADMTGISSALVLNIGTLT
THIM_THEP3      -------------------VHHITNIVTVNDCANITLAIGALPVMAHALEEVEEMVSAADALVLNIGTLT
THIM_ALKMQ      -----------------PLIHHITNYVSVNDCANIVLALGGSPIMADDPKEVVEVVSKASALVINIGTLN
THIM_THEPX      -------------------VHHITNVVTVNDCANITLAIGALPVMAHALEEVEEMVSAADALVLNIGTLT
THIM_BREBN      ---------LIKVREENPLVHNITNVVVTNFTANGLLALGASPVMAYAKQEVADMAKIAGALVLNIGTLN
THIM_METM6      ---------LTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAHAMDELEEMVSIASSLVINIGTLD
THIM_METLZ      ---------LDLVRERNPLVHQITNYVTVNDCANMTICFGASPVMSHAPEDVVDMIKIASALVLNIGTLD
THIM_METM5      ---------LTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAHAMDELEEMVSIASALVVNIGTLD
THIM_PASMU      ---------LQQIRSQNPLIHNITNVVAANFSANGLLAIGASPLMSAAMEEMHEVPRLSQALVINIGTLM
THIM_ANOFW      ---------LTRVRKESPLVHNMTNVVVTNFVANGLLAVGASPVMAYAKEEVADMVRLARALVLNIGTLN
THIM_GEOKA      ---------LERVREENPLVHNITNVVVTNWTANGLLALGASPVMAYAKEEVGEMAKLAGALVLNIGTLN
THIM_NATTJ      ---FKLGTYLTQVRQENPLVHAITNYVTMNDCANITLAAGASPAMCESRDEVSDFVPLAKALYINIGTIN
THIM_SYNFM      -------RCLEKIRAQRPLVHNITNYVVMNYTANALLCLGASPXXXXXXXXXXXXXXXXXXXXINIGTLS
THIM_METM7      ---------LTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAHAMDELEEMVSIASSLVVNIGTLD
THIM_BACWK      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_HAES1      ---------LTKLRQRNPLIHNITNIVAANFSANGLLAIGASPIMSACIEEMEEMAKLSQSLVINIGTLT
THIM_BACC4      -------KVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_METAC      -----MNEPLKTIRETKPLIHHITNWVTIYECANMTRAFGALPVMAHAPEECADMTKISSALVLNIGTLT
THIM_METMP      ---------LTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAHAMDELEEMVSIASALVVNIGTLD
THIM_BACSU      MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
THIM_BACCR      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACCN      -----IAKVVEQVRKTNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_EXIS2      ---------LRRIHDKKPLIHHLTNTVTINDCANMTLALGGSPVMAEDLLEVEEMVGLADAVVINTGTIN
THIM_DESHD      -----LTKALQALKHKTPLVHAITNVVTVNDCANSLLAVGASPAMCEAADEVFEFSQLAGSLYLNLGTLT
THIM_DESHY      -----LTEALQALKQKTPLVHAITNVVTVNDCANSLLAVGASPAMCEAADEVFEFSQLAGSLYLNLGTLT
THIM_BACC2      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMANIAGALVLNMGTLR
THIM_DESOH      ------------VREQRPLVHHITNFVVMNITANVTLAVGASPVMAHAHEEVKEMAAFAGALNLNIGTLT
THIM_METBF      ---------LKTIRETKPLIHHITNWVTIYDCANMTRAFGALPVMAHASEECAEMTGISSALVLNIGTPT
THIM_CALMQ      -------RDLKTLRDRKPLVHHFMNFVVMNDAANVTLAIGASPIMAHAKEEVEELASKANALYINIGTLD
THIM_LISMH      ---------LEKVREKGPLVHNITNIVVANDSANGLLAIGASPIMASAKEEMDELAKMADVLVINIGTLD
THIM_BACLD      -------RGIELVRKQKPLVHNMTNNVVTNFTANGLLALGASPVMAYAREEAADMAKIAGALVLNIGTLS
THIM_PHOPR      --------ALNTLRQQKPLVVNITNYVVMNNTANALLAIGASPIMAHSQEEMAEMMSFAGSLVINIGTLD
THIM_MOOTA      ------------VHEQRPLVHHITNLVVTNLTANVTLAIGASPVMAYAREEVADMARLAQAVVLNMGTLT
THIM_HAEIG      ---------LSKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANIEEMQEVPKISQALVINIGTLI
THIM_LISMO      ---------LEKVREKGPLVHNITNIVVANDSANGLLAIGASPIMASAKEEMDELAKMADVLVINIGTLD
THIM_HAEIE      ---------LAKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANVEEMQEVPKISQALVINIGTLI
THIM_LISIN      ---------LEKVREKGPLVHNITNIVVANDSANGLLAIGASPIMASAKEEMDELAKMADVLVINIGTLD
THIM_HAEIN      ---------LSKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANVEEMQEVPKISQALVINIGTLI
THIM1_CLOBM     -----------SVKFKKPLIHYITNPISINDCANMILAVGAKPIMAEHPLEVSEITSISESLGINLGNIT
THIM_CAMLR      ---------IEKIRKVKPLIHHITNYVTVNDCANASIAIGASPIMADFIQEQEEFSKICNCLVLNTGTIN
THIM_BRAHW      --------SIKEMKSKSPLVHNITNFVVMQITANALLAVGASPVMTFEKEEFEDMLSIASSLVVNIGTLT
THIM2_CLOBL     -----------NVKFKKPLIHYITNPISINDCANMILAAGAKPIMAEHPLEVSEITSASKSLGVNIGNIT
THIM_METVS      ---------LTKLRTISPLVQNITNYVVMNSTANTLLALGASPVMAHAKEELEEMIAISSALVVNIGTLD
THIM_ARCFU      -----LERDIARIAEFKPVVHHITNYVAMNDSANITIAIGASPIMSFAHGEIDELVSIASSLLINIGTLD
THIM2_CLOBH     -----------SIKLKKPLIHYITNPISINDCANIILAAGAKPIMAEHPLEVSEITSVSKSLGVNLGNIT
THIM2_CLOB1     -----------SIKLKKPLIHYITNPISINDCANIILAAGAKPIMAEHPLEVSEITSVSKSLGVNLGNIT
THIM_HAEI8      ---------LSKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANIEEMQEVPKISQVLVINIGTLI
THIM2_CLOB6     -----------SVKLKKPLIHYITNPISINDCANMILAAGAKPIMAEHPLEVSEITSVSKSLGVNLGNIT
THIM_LISMC      ---------LEKVWEKGPLVHNITNIVVANDSANGLLAIGASPIMASAKEEMDELAKMADVLVINIGTLD
THIM_LISMF      ---------LEKVWEKGPLVHNITNIVVANDSANGLLAIGASPIMGSAKEEMDELAKMADVLVINIGTLD
THIM_HELPS      ---------LKELRQKRPLVHNITNYVVAQFVANGLLALGASPLMSDAIAEMQDLAKISDALAINIGTLN
THIM2_CLOBJ     -----------SVKFKKPLIHYITNPISINDCANMILAVGAKPIMAEHPLEVSEITSISESLGINLGNIT
THIM_ACTSZ      -------RYLSLVRQQAPLEHCITNIVVTNFSANGLLALGASPFMSAMPQEVTEIQNFAQALLINIGTLN
THIM2_CLOBK     -----------SVKLKKPLIHYITNPISINDCANIILAAGAKPIMAEHPLEVSEITSVSKSLGVNLGNIT
THIM_HELPJ      ---------LKELRQKRPLVHNITNYVVAQFVANGLLALGVSPLMSDAIAEMPDLAKISDALAINIGTLN
THIM_DESVM      -------RNVDAVRRQAPLVHSITNFVVMNVTANALLAAGASPIMAHAREEMAELVNIVSSLVLNIGTLS
THIM_HELPG      ---------LKELRQKRPLVHNITNYVVAQFVANGLLALGASPLMSDAIDEMQDLAKISDALAINIGTLN
THIM_DESDG      --------AVQRVRTGAPLVHNITNYVVMXXXXXXXXXXGASPVMAHAREEVEELAGLCSSLVLNIGTLS
THIM_BACP2      ---------LEKVRAENPLVHNITNQVVTNFTANGLLALGASPVMANAKEEVAEMAQLADALVLNIGTLT
THIM_LEPCP      ------------VRAQSPLVHSITNFVVMNFNANVLLALGAAPVMAHAHDEVADMAGIAQALVLNIGTLE
THIM_EXISA      ----------NEIRQQAPLIHNITNTVVANFSANGLLAIGASPVMADAIEEVAEMTFVSDALVLNIGTLG
THIM_DESAP      --------ALARIRATKPLVHHITNYVVMNDTANVTLHVGALPVMAHTTEEAAEMTGLAGALVLNIGTLS
THIM_CLOD6      ---------IKDVKKLNPLVIHYTNNVTINDCANVTLAVGASPLMSFSYEEVEEMVSVANSVVINIGTMN
THIM_HELPY      ---------LKELRQKRPLVHNITNYVAAQFVANGLLALGASPLMSDAIDEMRDLAKISDALAINIGTLN
THIM_BACSK      ---------MELVRQNNPLIHCMTNDVVMNFTANGLLAIGASPVMAFSAAETEDMASVADALLLNIGTPS
THIM_METB6      -------------REQHPLVHHITNYVTVNDCANITIGAGGAPVMADAREEAGEMTGFAGALVLNIGTLN
THIM_PYRFU      --------ALAKVRERKPLVHNITNFVVMXXXXXXXXXXGASPVMAHAEEELEEMVRIADSVVVNIGTLD
THIM_LACBA      ---------LDDLRTQNPIVFNISNFVTVQDVANGLNALGASPIMSEEPAEAGEMVGLAGGVCLNLGAFT
THIM_LYSSC      ------------IRQQQPLIHCITNYVVANFQANGLLALGASPVMADDSHEVEEMVAIAEALLINIGTLN
THIM_AGRRK      ---------LTAMRANPPLVQCITNFVAMNIAANVMLAAGASPAMVHAEEEAGEFAAISGALTINIGTLS
THIM_BACCZ      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMTSIAGALVLNMGTLR
THIM_BACCQ      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACC7      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_DESAA      -------KILDMIRNSKPLVHHITNLVVMNDTANVTLHLGALPVMAHAVXXXXXXTSIASALVINIGTLS
THIM_SYNAS      --------AVKAIRSRAPLIHNITNYVVMNSTANALLALGASPVMAHAQEEVEEMVGIAQALVVNIGTLS
THIM_HELPH      ---------LKELRQKRPLVHNITNYVAAQFVANGLLALGASPLMSDAIDEMQDLAKISDALAINIGTIN
THIM_CHLSY      ----------ERVRQQRPLIHHITNFVVMNDTANVTLHIGGLPVMAHDRAEVAEMVTAAGALVLNVGTLS
THIM_CHLAA      ----------ERVRQQRPLIHHITNFVVMNDTANVTLHIGGLPVMAHDRAEVAEMVTAAGALVLNVGTLS
THIM_CHLT3      ------------VRTKAPLVHNITNYVVMNSTANALLSIGASPVMAHAEEEVIDMVTIAGSLVINIGTLS
THIM_BACC3      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACC0      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACAN      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACAH      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACAC      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACAA      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_STAS1      --------SLNNLRTNNPLVICYTNDVVKNFTANGLLSLGASPAMSQAPEEAIDMLTPANALLINIGTLT
THIM_PYRAB      --------ALNEVRKRKPLVHNITNFVVMXXXXXXXXXXGASPVMAHAEEELEEMIGLADAVVINIGTLD
THIM_LISW6      ---------LEKVQERGPLVHNITNIVVANDSANGLLAIGASPIMASAKQEMDELAKMADVLVINIGMLD
THIM_BACHK      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_BACC1      -----ISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAGALVLNMGTLR
THIM_PYRHO      --------ALKRVRERRPLVHNITNFVVMXXXXXXXXXXGASPVMAHAEEELEEMIRLADAVVINIGTLD
THIM_VIBPA      -----ITQALTAVRQQKPLVVNITNYVVMNNTANALLAIGASPIMAHSKQEMAEMMSFAGALVINIGTLD
THIM1_STRPS     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRPJ     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRZT     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRPN     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRZP     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRR6     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRP7     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRP4     --------SLKLLKKKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM1_STRP2     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM_CHLFF      -----MHEALQRLRQEQPVVLNITNYVSMDFLANCFLALGASPVMSVSDLELEELIGLSSAVYINIGTLD
THIM_VIBSL      -------QSLRAVREQKPLVVNITNYVVMNNTANALLAIGASPIMAHSKQELAEMMSFSGALVINIGTLD
THIM_RUBXD      --------ALRRLGERRPLVHHITNYVSVGLVANATLCTGALPVMAHAREEVAEMSGAAGALVLNIGTLD
THIM1_STRPI     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLLINIGTLT
THIM_STRSY      ---------LEKLRSQNPLTICITNDVVKNFTANGLLALGASPAMSEYPEDLEDLLPYTKGLLINTGTLT
THIM_ROSS1      ---------LARIRATRPLIHHITNLVVMNDTANVTLHVGGLPVMAHDAEEVAEMVAHAGALVLNVGTLS
THIM_CHLCV      --------ALQRLRKEKPVILNITNYVSMDFLANCFLAIGASPIMSVSDLELEELIGLSSAVYLNIGTLD
THIM1_STRZJ     --------SLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPEDLEDLLKYAGGLLINIGTLT
THIM_LACPL      ---------LNTLRNHNPIVFNIANFVTVQDVANGLNALGASPIMSAEVQEAETMVQIAGAVCINLGTLT
THIM_VIBHB      -----ITQALTAVRQQKPLVVNITNYVVMNNTANALLAIGASPIMAHSKQEMVEMMSFAGALVINIGTLD
THIM_YERE8      --PDALASALQQFRATPPLVHCLTNEVVQSFTANVLLALGAFPAMVVEPQEAAQFSTMANSLLINIGTLH
THIM_HAEPS      ---------LDAVREHNPLIHNITNLVSAHFTANGLLALGASPMMAESPDEMAELATISSAVVLNLGTPS
THIM_RHIEC      ---------LDAMREKPPLVHCITNYVAMNIAANVLLASGASPAMVHAPEEAGEFAGIASALTVNIGTLS
THIM_CLONN      ------------VKEKTPLVHSITNYVTINDCANMLLAYGASPAMVESFDESYDFAKLASCIYINLGTLT
THIM_STRS2      ---------LEKLRSQNPLTICITNDVVKNFTANGLLALGASPAMSEYPEDLEDLLPYTKGLLINTGTLT
THIM_STRA1      ---------LEQLKEVNPLTICITNNVVKNFTANGLLALGASPAMSECIEDLEDLLKVADALLINIGTLT
THIM_ROSCS      ---------LARVRATRPLIHHITNLVVMNDTANVTLHVGGLPVMAHDVEEVAEMVTHAGALVLNVGTLS
THIM_PSYWF      ------------------LVHNLTNDVAHNTVANVLLACRASPAMVHDIQEAPDFVCLSDALAINIGTLT
THIM_RHOFD      ------------VRDRSPLVHSITNLVVINFNANVLLAAGASPVMAHAHEEVADMVGIAQALVLNIGTLD
THIM_RHIE6      ---------LEAMREKPPLVHCITNYVAMNIAANVLLASGASPAMVHAPEEAGEFAGIASALTVNIGTLS
THIM_STRA3      ---------LEQLKEVNPLTICITNNVVKNFTANGLLALGASPAMSECIEDLEDLLKVANALLINIGTLT
THIM_BACA2      ---------LSKVRDQNPLVHSITNNVVTNFTANGLLALGASPVMAYAIEEAADMAKIAGALVLNIGTLS
THIM_SERP5      ---------LTQFKRQSPLIHCLTNEVVQELTANVLLALGASPAMVVEPTEAAQFSRLADALLINIGTLN
THIM_DESVV      ------------VRQRAPIIHSITNFVVMXXXXXXXXXXGASPIXXXXXXXXXXXXGIASALVLNIGTLT
THIM_DESVH      ------------VRQRAPIIHSITNFVVMXXXXXXXXXXGASPIXXXXXXXXXXXXGIASALVLNIGTLT
THIM_STRA5      ---------LEQLKEVNPLTICITNNVVKNFTANGLLALGASPAMSECIEDLEDLLKVADALLINIGTLT
THIM_COPPD      -----IKEILEQVVSTKPLVYHMTNMVAMAEQAHLTLAIGASPVMSLSSEEAAEMVNIANAVLINIGTPS
THIM_HALWD      --------ALRQLSQTTPLVNAITNDVTVNQVANIILHWGGLPVMSDDVRELDEMVNAAEACLLNMGTVS
THIM_BACHD      --------SIEMLRKSNPLIHCMTNVVVTNFTANGLLAVGASPVMAYAKEEVADMAKVANALLLNIGTLS
THIM_RHILW      ---------LTAMREKPPLVQCITNYVAMNIAANVLLAAGASPAMVHAAEEADEFAGIASALTVNIGTLS
THIM_METPE      -----LASALNDLQTKKPLVHHITNAVTINDCANITLCIXXXXXXXXXXXXXXXXXXXXXXLVLNIGTLS
THIM_SALTI      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALAR      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPAEARPFAAIANALLVNVGTLT
THIM_CLOP1      ---------MEVLKRENPLIHMITNYVTVNDLAQVTINYGGLPLMATHHDELKEITKMANGLLVNIGTLE
THIM1_OCEIH     ---------IKQVRDTKPLVHHLTNQVVMNFSANGLLSFGGSPIMAKAIEEVEQIAAISNAVLINIGTLT
THIM_CLOPE      ---------MEVLKRENPLIHMITNYVTVNDLAQVTINYGGLPLMATHHDELKEITKMANGLLVNIGTLE
THIM_CHLAB      -----MQEALQRLRKERPVILNTTNYVSMDFLANCFLAIGASPIMXXXXXXXXXXXXXXXAVYINIGTLD
THIM2_OCEIH     --------AIAKIKQDKPFIFNITNEVASNFSANGLIAIGASPAMSHTPREAKKYGEIADAVVLNLGTLT
THIM_SALTY      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALNS      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALG2      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALEP      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALDC      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_LACSS      ------KTLLDQIKQANPIITNVANSVTVDQVANVQNIIGASPIMSSDPEEAPEMVAIAQALSINIGTLS
THIM_STAEQ      ---------LERLRSENPLVICYTNDVVKNFTANGLLSLGXXXXXXXXXXXXXDFTRMASALLINIGTLT
THIM_STACT      -----MNKILDQIRTEHPLVICYTNDVVKNFTANGLLSLGASPTMSEAPQEAEDFYPVAGSVLINIGTLT
THIM_METMJ      ------------VRSQRPLVHHITNGVTINDCANITICXXXXXXXXXXXXXXXXXXXXXXXLVLNIGTLS
THIM_AKKM8      ----AVTADLGKIRETAPLVLSLTNSVVQPLTANLLLAIGAVPAMLNDAEEAVDLRSGTGALLVNLGTVT
THIM2_CLOBM     ------KNVIQKMREKTPLIHCITNYVTINDCANILLAFGASPAMCEAYDEAYDFVSISSALYINLGTLT
THIM1_CLOBK     ------KNVIQKMREKTPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM1_CLOBJ     ------KNVIQKMREKTPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM1_CLOBH     ------KNVIQKMREKTPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM1_CLOB6     ------KNVIQKMREKTPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM1_CLOB1     ------KNVIQKMREKTPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM_SALSV      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_SALHS      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_SALPK      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_SALPA      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLINVGTLT
THIM_CHLAD      ----------DRVRQQRPLIHHITNFVVMNDTANVTLHIGGLPVMAHDRXXXXXXXXXXXXXXXXXXTLS
THIM_SALPC      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_SALCH      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_ACIBY      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_ACIBC      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_ACIB5      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_ACIB3      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_SALA4      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_NATPD      ---------------------------------------GGLPVMSDDAREVDDMVATADGCLINMGTVD
THIM_ACIBT      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_ACIBS      --------AWQNMQAKTPLVQCITNSVAANYTANVLLASGASPAMIDNPYEAESFTKISSALSINLGTPT
THIM_SALPB      ---------LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANALLVNVGTLT
THIM_STAES      ---------LERLRSENPLVICYTNDVVKNFTANGLLSLGXXXXXXXXXXXXXDFTRMASALLINIGTLT
THIM1_CLOBL     ------KNVIQKMREKIPLIHCITNYVTINDCANILLSFGASPAMCEAYDEVYDFVSISSALYINLGTLT
THIM_TOLAT      ---------LERIRRSVPLTHVITNDVVTGFTANVLLALGAAPAMITAPEEAGSFAAIASVLSVNVGTLT
THIM_ERWCT      --------SLTQFRSAAPLVHCLTNDVVQSFTANVLLALNASPAMVVDPEEAAQFSAVADALLINVGTLE
THIM_STAAW      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQGLLINIGTLT
THIM_STAAS      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQGLLINIGTLT
THIM_MACCJ      ---------LNQLRKDNPLIICITNDVVKNFTANGLLALGASPAMATERQEMDEFLAHAGALLINIGSIE
THIM_ALISL      --------ALAMLREKKPLVVNITNYVVMXXXXXXXXXXGASPIMAHSQQEMAEMMSFSGALVINIGTLD
THIM_STAAE      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAAC      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAA8      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAA3      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_PEDPA      ------------IREVNPVVVNYANFVTPFLVANGLNAVGASPIMSDEVSEAEELVQLASAVVINAGASR
THIM_VIBF1      ------------LREKKPLVVNITNYVVMXXXXXXXXXXGASPIMAHSQQEMAEMMSFSGALVINIGTLD
THIM_RHIL3      ---------LKAMREKPPLVQCITNYVAMNIAANVLLAAGASPAMVHXXXXXXXXXXXXXXLTINIGTLS
THIM_LACF3      -----MQNAIATIKETNPIVLTVANNVTPADVANGLNALGASPMMSQTPEEADDMVNIAQAAAINLGTLN
THIM_VIBFM      ------------LREKKPLVVNITNYVVMXXXXXXXXXXGASPIMAHSQQEMAEMMSFSGALVINIGTLD
THIM_STAAN      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAAM      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAA9      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAA2      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_STAA1      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_LEPIN      ---------LSELRKQSPLTHVITNIVVTNWTANVLLAIGSSPAMVIAKEEAGEFAKIASGLLINIGTVT
THIM_LEPIC      ---------LSELRKQSPLTHVITNIVVTNWTANVLLAIGSSPAMVIAKEEAGEFAKIASGLLINIGTVT
THI4_SCHPO      --------ALQKLKDFTPLIHHLTNAVAKNFSANVTLAAYGSPTMGESYDEVADFAKAPGALVLNIGIL-
THIM_CLAMS      ------------LRERQPLVQCITNAVVTGFTANVLLALGAAPAMTDVPTESGPFARIASGVLINLGTPX
THIM_DESRM      ------------VRIKKPLXXXXXXXXXXXXXXXXLLAVGASPLMSEGWQEADDLAKIVDVLVLNMGTLH
THIM_SYNWW      ----------DEVRNRRPLVHCITNYVTVNDVANIILAAGASPAMVEYPAEASGFAPLASVLYFNLGTLT
THIM_LEPBL      ------------LRKRSPLTHIMTNIVVTNWTANVLLAVGASPAMVIAEEEAGEFVKIANGLLINVGTIT
THIM_LEPBJ      ------------LRKRSPLTHIMTNIVVTNWTANVLLAVGASPAMVIAEEEAGEFVKIANGLLINVGTIT
THIM_DESAH      ------------IRDQKPLVHVVTNFVVMNQTANALLALGASPTMSWAQEDAAYMSKISDALCINMGTPV
THIM_COREF      ------------VRATTPLVQCLTNAVVMQFTANALLAIGASPAMVDTPAESFDFAGVADGVLINAGTPS
THIM_CLOK5      ------------VRKSVPLVHCITNYVTINDCANILLSYGASPAMCEAYDEVFDFVKISSALYINIGTFT
THIM_CLOK1      ------------VRKSVPLVHCITNYVTINDCANILLSYGASPAMCEAYDEVFDFVKISSALYINIGTFT
THIM_PECCP      --------SLTQFRSASPLVHCLTNDVVQSFTANVLLALNASPAMVVDPEEAAQFSAVADALLINVGTLE
THIM_LACRJ      ---------IDRVRAKNPIVLNLANLVTIDKVADAVSAVGASPIMSVEPAEADEMVMLANALSINLGTIN
THIM_LACRD      ---------IDRVRAKNPIVLNLANLVTIDKVADAVSAVGASPIMSVEPAEADEMVMLANALSINLGTIN
THIME_SYMTH     ----------ERVRERRPLVHAITNCVTMEWVARGLLAAGARPVMXXXXXXXXXXXXXXXXLVLNLGTWS
THIM_CLOPS      ---------MEVLKRENPLIHMITNYVTVNDLAQVTINYGGLPLMATHHDELKVITKMANGLLVNIGTLE
THIM_CITK8      ---------LQQFRILSPLTHCMTNDVVQNFTANTLLASGASPAMVIEPEEARQFAAIASALLINVGTLT
THIM_FINM2      ------------------LIHCLTNAISINDMANAVLSIGQSPFMADNPREVEDVTRKSDSLLVNLGNIT
THIM_PROAC      --------SLERLRRDKPLVQCLTNIVVANFTANVLLSAGAVPAMVDNPEESEGFASIADGVLVNTGTPY
THIM_CORGB      --------SLTLVRQNTPLVQCLTNSVVMQFTANVLLAAGATPAMVDTPAESAEFAAVANGVLINAGTPS
THIM_ROSDO      MAPHDLLTAL---RDQNPLVHCITNYVAMNIAANVVLAAGASPAMVHAPEEIAEFTPICGALTINIGTIS
THIM_KLEP3      ------------LRAHSPLVHCMTNDVVQTFTANVLLAVGASPAMVIDPREXXXXXXXXXXLLINVGTLT
THIM_CORGL      --------SLTLVRQNTPLVQCLTNSVVMQFTANVLLAAGATPAMVDTPAESAEFAAVANGVLINAGTPS
THIM_KLEP7      ------------LRAHSPLVHCMTNDVVQTFTANVLLAVGASPAMVIDPREXXXXXXXXXXLLINVGTLT
THIM_ECO5E      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECO57      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_CLAM3      -------------RERQPLVQCITNAVVTGFTANVLLALGAAPAMTDVPTEAGPFARIASGLLVNLGTPX
THIM2_STRZJ     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM2_STRP4     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM2_STRP7     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM_ECO81      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM2_STRZT     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM2_STRZP     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM_ENT38      MQPDRLDHALHHFRTRSPLTHCMTNDVVQTFTANVLLALGASPAMVIXXXXXXXXXXXXXXLLINVGTLT
THIM_PSYIN      --------ALKTLREQKPLVVNISNYVXXXXXXXXXXXXXXSPIMAHSRDEMAEMLSFSGALVVNIGTLD
THIM2_STRPS     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM2_STRPJ     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDPREVLDFTKQSQALFINLGHLS
THIM_ENTFA      ---------------TAPLIQCITNEITCESMANALLYIDAKPIMADDPREFPQMFQQTSALVLNLGHLS
THIM_ECOSE      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOL5      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASHFAAIASALLINVGTLT
THIM_ECO8A      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECO7I      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECO55      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_SHISS      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM2_STRR6     ---------------SSSLIHCITNEISCEMLANGILALGCKPVMADDSREVLDFTKQSQALFINLGHLS
THIM2_STRPN     ---------------SSSLIHCITNEISCEMLANGILALGCKPVMADDSREVLDFTKQSQALFINLGHLS
THIM2_STRP2     ---------------SSSLIHCITNEISCEMLANGILALGCKPVMADDSREVLDFTKQSQALFINLGHLS
THIM_SHIB3      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOSM      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOUT      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOL6      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOK1      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECO45      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM2_STRPI     ---------------SSSLIHCMTNEISCEMLANGILALGCKPVMADDSREVLDFTKQSQALFINLGHLS
THIM_SHIBS      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM1_LEUMM     ---------ITDIRTKSPLVLTYANFVTPQFVANVVNVVGASPLMSRELAEFKELAGIANAVIINTGTLQ
THIM_ENTS8      ------------LRRHAPLVHCITNDVVQNFTANVLLALGASPAMVVDTDEXXXXXXXXXXLLINLGTLT
THIM_STAAR      ---------LNNIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_SHIDS      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVDTLT
THIM_ECOLI      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOLC      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOHS      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECODH      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECOBW      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_ECO24      ----------------SPLVHCMTNDVVQTFTANTLLVLGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_CARHZ      -------------------------------------AAGASPIMSEGVEEADDLVKIANAVVINIGTLH
THIM_RHOS5      ---------LDTMRSTAPLVQCITNFVAMNVMANVLLAAGASPAMVHDAEESGEFAAIAQVLTINLGTPS
THIM_LACLM      ---------LSKIQRTQPLILNLANFVTPQRVADVISFIGASPLMTSEIAELESLVEISDAVVVNIGTIS
THIM_ECO27      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_LACCB      ---------------SSPLVQCITNEITVESMANALLYIDAKPVMADDQREFPEFFAQSDALLLNLGHIS
THIM_LACC3      ---------------SSPLVQCITNEITVESMANALLYIDAKPVMADDQREFPEFFAQSDALLLNLGHIS
THIM_LACLS      ---------LGKIQRTQPLILNLANFLTPQRVADVISFIGASPLMTSEIAELESLVEISDAVVVNIGTIS
THIM_STAHJ      ---------LERLRQENPLVVCYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAGALLINIGTMT
THIM_STAAB      ---------LNKIRIENPLTICYTNDVVKNFTANGLLSIGXXXXXXXXXXXXXXFYKVAQALLINIGTLT
THIM_ECOLU      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_HERA2      LTPSSIADCWHSLRQQRPLVHVVPNLVTANDLANALLAVGAAPIMAIEPAEFSQLPN--RALVLSMGTPT
THIM_SHIFL      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_SHIF8      ----------------SPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASALLINVGTLT
THIM_GEMAT      ----------------------ITNYVAMQIXXXXXXXXXXXXXMIHTVEESGAFAGLARAVTINIGTLS
THIM_BIFA0      -----IRQAAQNVREQTPLAQSFTNFVTINLVXXXXXXXXXXXXMSFLPNDVTSLASSCGATYINVGTLL
THIM_RHOS4      ---------LDTMRREAPLVQCITNFXXXXXXXXXXXXXGASPAMVHDAEESGEFAAIAQALTINMGTPS
THIM_RHOE4      --------AIDALRDQVPLVQSLTNIVSANFLTNVLLAAGASNAHIDNXXXXXXXXXXXXXXXXNLGTPD
THIM_ACIAD      --------AWEKLQEQAPLVQCITNXXXXXXXXXXXXXXXXXXXMIDNPFEARSFTEISGALSINVGTPT
THIM_RHOSK      ---------LDTMRREAPLVQCITNFXXXXXXXXXXXXXGASPAMVHDAEESGEFAAIAQALTINMGTPS
THIM_RHOS1      ---------LDTMRREAPLVQCITNFXXXXXXXXXXXXXGASPAMVHDAEESGEFAAIAQALTINMGTPS
THI6_YEAST      ----SIQNVISQVSNNRPLVQHITNKVHQNFGANVTLALGSSPIMSEIESEVSELARINASLLLNTGSV-
THIM_AGRT5      ---------LERVRQMRPRVHCLMNTVVQKFTADGITVIGGIPSMTTSLEEIESFVTKADALTVNLGTLD
THIM2_LEUMM     -----------------PLVHCITNDITLETVANTILYLGGKPIMSSDTREFSSLFQSTDALLLNMGRLN
THIM_LACLA      ---------LEKIQEKQPLILNLANFVTPQRVADAISFAGGSPLMTAEISESETLVEIADAVVVNIGTIS
THIM_DICNV      ---------LDRAYANAPFIHCLTNNTTKFFVANALLAIGAKPAMVESWQEVVEFSQRAANVVMNLDSLT
THIM_ESCF3      MQPDLLSRTLQKFHTLSPLTHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAVASALLINVGTLT
THIM_LARHH      ------------VRQHPPLVHCLTNQVVSQFTXXXXXXXXXXXXXXXXREEAGDFARMASAVLVNVGTLT
THIM_LEUCK      ---------LSTLNETTPLVFNYANYVTPQFVANAVNVIGGSPIMAREVAEFXXXXXXXXXXXXNTGTWR
THIM_GRABC      ------------LREKRPLVHXXXXXXXXXXXXXXXXXXXXSPAMVEGVEEVDSFARMADSLVINLGTMS
THIM_BIFAA      ----AIKQAVTDVRGQTPLAQSFTNFVTINLVXXXXXXXXXXXXMSYLPDDVIATAEIAGSNYINVGTLL
THIM_BIFLO      --------AVRRVRETTPLAQSFTNFVTINLVXXXXXXXXXXXXMSFLPDDVIETAKIAGANYINVGTLL
THIM_DESMR      ---------------------------------------GASPAMTHHPXXXXXXXXXXXXXVCNMGTPG
THIM_BIFLI      --------AVRRVRETTPLAQSFTNFVTINLVXXXXXXXXXXXXMSFLPDDVIETAKIAGANYINVGTLL
THIM_BIFLD      --------AVRRVRETTPLAQSFTTFVTINLVXXXXXXXXXXXXMSFLPDDVIETAKIAGANYINVGTLL
THIM_KINRD      ------------------LVQCLTNSVVQTITXXXXXXXXXXXXMVDNVHESAAFAQIASAVLVNVGTLD
THIM_BURTA      -----------------------------------------------------------GALWINTAALM
THIM_BURPS      -------------------------------------------------------------LWINTAALM
THIM_BURP6      -------------------------------------------------------------LWINTAALM
THIM_BURP1      -------------------------------------------------------------LWINTAALM
THIM_BURP0      -------------------------------------------------------------LWINTAALM


                         .         .         *         .         .         .         .:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEXXXXXXXXXXTRGV
THIM_CLOAB      ENTIESMLKAGKMANKLKHPVILDPVGVGASKLRRQTALKLLEEVKFTVIRGNISEIKVLALGQGITXXX
THIM_ALKOO      ERTIESFVLAGKKANELNIPVILDPVGAGATAFRSQTIEKILKEVKLSVLRGNMSEIKNIYGTGTQTKGV
THIM_CLOTE      KKTVKSMFLAGKKANELNIPVILDPVGVGATKYRTSIALELLEEIKFSVVRGNISEVKVLSGMNASTKGV
THIM_CLOB8      ERTIESMIASGKKANELNIPVVFDPVGAGASEFRNSTTKRLLEEVKISVLRGNMSEIKFISGLGSTTKGV
THIM_CLOCE      KRTIESMILSGKKANEKGIPVIFDPVGAGASALRNETTSTILDKIKISVLRGNLSEISYIAGRNASTKGV
THIM_METS3      HEQVEAMKISSAQANKINTPVILDPVGVGISQLRNKVTLEIIENYKLAAIRGNITELTGIISESNTAKGV
THIM_DESDA      SRTVESMLVAGRRANSMGKPVVLDPVGAGASALRNSTLQRLLGEVRFAAIKGNASEIGFLAGKDAKARGV
THIM2_METST     EDQIEPMQIAACHTKKTNTPLVLDPVAVGVSKLRNDITIDLINKSSVDVIRGNMSEIKAIANLFNITKGV
THIM_DESPS      ESWVSSMLMASQRANTLKTPIILDPVGSGATAFRTASAKRIIAEAKVSVIRGNASEILSLGSEQSNTRGV
THIM_UNCMA      HRQVESMLAAGHRANELNIPIILDPVGAGATRLRTETAKTLLHKLHVSVLKGNAGEIATLAGAEGKVRGV
THIM_LEPBP      EPWIQSMEKAAKKAVSLGKPLVLDPVGAGASNIRNAAIRRILDAGNPTIVRGNASEILSTLSSSGKTKGV
THIM_LEPBA      EPWIQSMEKAAKKAVSLGKPLVLDPVGAGASNIRNAAIRRILDAGNPTIVRGNASEILSTLSSSGKTKGV
THIM1_METST     KEQIETMKKSAKFAIENNKPFILDPVGVGISNIRNQTPIDIITNSKPSIIRGNLSEMYDILDECTMAKGV
THIM_CLOBB      DGMVESMILAGKSANKNNVPVIFDPVGAGVANFRNESAEKILSEVKIDIIRGNISEIKFICGLSSETKGV
THIM_METHJ      TLQIDRMFIAAKAAEKYGIPIILDPVGAGATSLRTKTAQRMIQELSISVLKGNAGEIGTLAGKQAQVRGV
THIM_GEOTN      ATEVEAMLIAGRAANEAGVPVIFDPVGAGATSYRTETAHRIAEQIQLAVVRGNAAEIANMIGESWMIKGV
THIM_THETN      VEEVNTMIKAGKTANQHGVPVILDPVGAGATSLRTKSAKRIIEEVRVSVIKGNSAEISTLSGRTGKIRGV
THIM_CLOBA      EKMVEAMILAGKSANKNNVPVIFDPVGAGVANFRNKSAEKILSEVKVDIIRGNISEIKFICGLRSETKGV
THIM_GEOSW      PTEVEAMIIAGKAANEAGVPVIFDPVGAGATPYRTETARNIASAVQLSVIRGNAAEIANTIGESWTIKGV
THIM_METMA      SEIIDSMLLSAAAANKKKIPVVLDAVGVGATRFRDEMAAKILGSVRVDIIKGNYSEIAKLAGENAETKGV
THIM_THEP3      NEQVEAMIKAGKAANRLKVPVILDPVGAGATKLRTQSSKKILEEVKISVIKGNSAEISILAGKGGKIRGV
THIM_ALKMQ      DKRVQSMLLAGRKANELGIPVILDPVGVGASTFRKDTVNQLLKNIDFTVIRGNASEMQVLMNMNYSVAGV
THIM_THEPX      NEQVEAMIKAGKAANRFKVPVILDPVGAGATKLRTQSSKKILEEVKISVIKGNSAEISILAGKGGKIRGV
THIM_BREBN      EHEIEAMLIAGKSANQHGVPVLFDPVGAGATSYRTETSQRLAQELDLAFIRGNAAEVANVIGERWEIKGV
THIM_METM6      EYWIPPMEKAAKIASDLKKPIILDPVGAGATKLRTNTALKILDFADISVLRGNFGEIAAVLGEHGKTKGV
THIM_METLZ      EKQIEGMIAAANEAKKCGIPIVLDPVGAGATLYRTQTAERFMNEFPLAVIKGNAGEIGTLAGVSATVRGV
THIM_METM5      EYWIPSMEKAAKIASDLKKPIILDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAVLGEHGKTRGV
THIM_PASMU      GKEVDAMVLAGKTANEVGIPVVLDPVGVGATTFRKQTVARLLKEVKFAAIRGNAGELATIAEVNWQAKGV
THIM_ANOFW      ETDVEAMLIAGKAANEANIPVIFDPVGAGATAYRTETARRILREVNISILRGNASEIASIAGEQVRTKGV
THIM_GEOKA      DKEVEAMLVAGQAANEAGVPVIFDPVGAGATRYRTETARRIAEQVKLAVIRGNAAEIANMIGEAWTIKGV
THIM_NATTJ      QEHKDSIYLAAEKASELEIPIVLDPVGAVAIKSRLDLVKDLLTNYNVSCIKGNNAEIKCLAGRKGHGKGM
THIM_SYNFM      APWVDAMFLASRAAIERSIPVVLDPVGAGATAFRTDTARRLLDEFGITVLRGNASEIMALAGLNSTTRGV
THIM_METM7      EYWIPSMEKAAKIATDLKKPIILDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAVLGEHGKTRGV
THIM_BACWK      PEEVEAMLLAGKSANKNDVPVLFDPVGAGATSYRTEVARYIPAEIDLAVIRGNAAEIANVINEKWEIKGV
THIM_HAES1      GKDVEAMLLAGKTANQVGIPVVLDPVGVGATTFRQKTTALLLEQVQFSAIRGNAGELAYIAGVQWSTKGV
THIM_BACC4      PEEVEAMLLAGKSANANNVPVLFDPVGAGATSYRTEVARHIPAEIDLAIIRGNAAEIANVINEKWEIKGV
THIM_METAC      SEIIDSMLLSAAAANERDIPVVLDAVGVGATKFRDEMAAKILASVHIDIIKGNYSEIAKLAGENAETKGV
THIM_METMP      EYWIPSMEKAAKIASDLKKPIVLDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAVLGEHGKTRGV
THIM_BACSU      KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEAHTVGVTDWLIKGV
THIM_BACCR      PEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELASIRGNAAEIANVINERWEIKGV
THIM_BACCN      PDEVEAMLIAGKAANQQHVPVLFDPVGAGATLYRTEVARHIPNEIKLAMIRGNAAEIANVIHEKWEIKGV
THIM_EXIS2      PDMRKAQLLAGKTANRLGKPVILDPVGAGATTLRTDFMKQLMEEITFTVIKGNASEIKTLLGQAARTKGV
THIM_DESHD      KEQEMAAYLAIRGATLKGIPVILDPVACGAIPRKKATIERLGHFGRFTVIKGNLGEVKALAGLAARVRGV
THIM_DESHY      KEQEMAAYLAIRGATLKGIPVILDPVACGAIPRKKATIERLGHFGRFTVIKGNLGEVKALAGLAARVRGV
THIM_BACC2      PEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIDLAIIRGNAAEIANVINEKWEIKGV
THIM_DESOH      PYWIDAMVMAGKVAEQRGIPIVLDPVGSGATPLRTGAAKKILAEVGVNVIRGNASEVMSLFADKETVRGV
THIM_METBF      SEIIDSMLLSAAAANEKKIPVVLDAVGVGATKFRDEMAAKILGSVRVDIIKGNYSEIAKLAGESAETKGV
THIM_CALMQ      EYWVESMIIAGKAASRNNVPILLDPVGAGATRYRTEVVKRILSETEVSVVKGNGGEMLALAGVTGGVKGV
THIM_LISMH      GELVEAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAGEAWEAKGV
THIM_BACLD      RESVEAMIIAGKSANEHGVPVIFDPVGAGATPFRTESAQAIMRKVKVSAVRGNAAEIANTLGEDWLIKGV
THIM_PHOPR      SVWIPRMIYAVEQANANNKPVILDPVGCGASALRTNTARQIVALAEQLTIRGNASEIIALAGEQAQSKGV
THIM_MOOTA      GDVVEAMLLAGKAANNAGIPVVFDPVGAGATPFRTRTAQKIIKELHIDILRGNASEIASIGGFGGHTKGV
THIM_HAEIG      GKDREAMLQAGKTANEVGIPVVLDPVGVGATSYRRETISQLLAEVKFALIRGNAGELAAIAGEAWQAKGV
THIM_LISMO      GELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFAAIRGNAGELAAIAGEAWEAKGV
THIM_HAEIE      GKDREAMLQAGKTANEVGIPVVLDPVGVGATSYRRETVRQLLAEVKFTLIRGNAGELAAIAGEAWQAKGV
THIM_LISIN      GELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAGEAWEAKGV
THIM_HAEIN      GKDREAMLQAGKTANEVGIPVVLDPVGVGATSYRRETIRELLAEVKFALIRGNAGELAAIAGETWQAKGV
THIM1_CLOBM     DNKMKSMLISGKTSYEKKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM_CAMLR      ERVANSMYESAKFYGNLNKAIVLDPVALGVSMARDAINLKLLNSYKISIIKANASEIASVIGLDGKAKGT
THIM_BRAHW      KTSIEAMHKACETANKKNVPFVLDPVGAGATKLRTKTAIDLIKNYNPKVVRGNASEIMVLAGESIKTKGV
THIM2_CLOBL     DNKMKSMLISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM_METVS      EYWIPSMEKAVKIASDLKKPIILDPVGAGATKLRTNTALKLLDIGNVSVLRGNFGEISALLGEHGKTKGV
THIM_ARCFU      EYIIQAVMLAVKSAKSKGVPVLLDPVGSGATKLRTSTALSVAEE-GVDVIKGNQGEILSLLRKEGVVRGV
THIM2_CLOBH     DNKMKSMLISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM2_CLOB1     DNKMKSMLISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM_HAEI8      GKDREAMLQAGKTANEVGIPVVLDPVGVGATSYRRETIRQLLAEVKFALIRGNAGELAAIAGETWQAKGV
THIM2_CLOB6     DNKMKSMLISGKTAYENKIPQVIDLVGVGCSKLRLDYARKFISECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM_LISMC      GELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAGEAWEAKGV
THIM_LISMF      GELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAGEAWEAKGV
THIM_HELPS      ERTILCAKEAIKHYKALNKPIVLDPVGCSASALRHGTSLELLESEGISVLRGNAAELGSLVGISCGSKGL
THIM2_CLOBJ     DNKMKSMLISGKISYEKKIPQVIDLVGVGCSKLRLDYAKKFILECHPNVIKGNMSEMKAIYGIKSSAKGI
THIM_ACTSZ      QSDVEAMLIAGKAANRTGVPVVLDPVGAGATLFRRKIVEQFLAEINFAVIRGNAAEIGFLAGTDWQGKGV
THIM2_CLOBK     DNKMKSMLISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFILECHPNVIKGNMSEIKAIYGIKSSAKGI
THIM_HELPJ      ERTILCAKEAIKRYKALNKPIVLDPVGCSASALRYDTSLELLESKGISTLRGNAAELGSLVGISCESKGL
THIM_DESVM      APWIDSMFLAGAAAHERGIPVVLDPVGAGASTLRTTTAAQLMERVRPAIVRGNGSEIMALAGAAGATRGV
THIM_HELPG      ERTILCAKEAIKHYKALNKPIVLDPVGCSASALRHDTSLELLESEGISALRGNAAELGSLVGISCESKGL
THIM_DESDG      KPWIESMFAAGRIAQSRGVPVVLDPVGAGASSLRTWTSLDLLRELNISVLRGNASEILALSGAGSRTKGV
THIM_BACP2      KETVESMILAGQSANKKGIPVLLDPVGVGATTFRLKAAKQLLEQVNITVVRGNAAEAHLLEVDGWESKGV
THIM_LEPCP      PAWVESMHKARRAARARGIPVVLDPVGAGATAYRNRALSGLLAAGAPTVIRGNGSEVLSVAGLGAPTRGV
THIM_EXISA      TMTEATMIRAGQAANEAGCPIVLDPVGVGATSFRRDVVERIMRHVRVSVIRGNAGEIATLIGVDWAARGV
THIM_DESAP      PAWVDAMLLAGRRANESGIPVVLDPVGAGATAYRTETCLRLLGGLRVAVIRGNSGE--------------
THIM_CLOD6      SNMLDLFLLAGKAANKYNKPVVLDPVGVFASKARAELTSRLLNEVKFSVVKGNVSEIKFIGGFNVRGKGV
THIM_HELPY      DRAILCAKEAIKHYKALNKPIVLDPVGCSASALRHDTSLELLKSGGISALRGNAAELGSLVGISCESKGL
THIM_BACSK      NEGVDSMVLAGKAANRAGKPVIFDPVGVGATPFRNEISKRILNEVDVAVVRGNAGEIAALLGQAGTVKGV
THIM_METB6      SGIIESMILAGKVANERKIPIILDPVGAGAXXXXXXXXXXXXXXXXISIIKGNAGEIGVLAGAEAKVRGV
THIM_PYRFU      KFWINSMIKAAKLAKEYGKPLVLDPVGAGATRLRTKTALEVL-KIGATIVKGNFGEISALLGEEGKTRGV
THIM_LACBA      QAQIQQIRTVGQQANAQHKPLVIDPVAVGAVQYRKQVATGLLADFHPDVIRGNAGEIAALADISWQAKGI
THIM_LYSSC      DRTKEAMLLAGKKANTLGIPVILDPVGAGATVYRKETVHLLLTDIQFAVIRCNKGELAALVNVEWQQKGV
THIM_AGRRK      TGWLAGMTSAAQAANKAGKPWVLDPVAHYATSFRRRSVAQLLE-LQPTIIRGNASEIIALAGGTSRGQGV
THIM_BACCZ      PDEVEAMLLAGKSANMNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACCQ      PEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINERWEIKXX
THIM_BACC7      PEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINERWEIKXX
THIM_DESAA      KHWIEAMFKAGKTANDKGIPIILDPVGAGATSYRTETCHRLLEELSVSVIRGNLGEVSILAGLGGEVKGV
THIM_SYNAS      PSWVRAMASAALKAADRGIPIILDPVXXXXXXXXXXXXFQLLETVSPTIIRGNASELAFESVETMETRGV
THIM_HELPH      ERAILCAKEAIKHYKALNKPIVLDPVGCSASALRHDTSLELLKSGGISALRGNAAELGSLVGISCESKGL
THIM_CHLSY      PDWIEAMLIAGRRANELGIPIVLDPVGAGATSLRTASNRRLLEELQIAVVRGNSGE--------------
THIM_CHLAA      PDWIEAMLIAGRRANELGIPIVLDPVGAGATSLRTASNRRLLEELQIAVVRGNSGE--------------
THIM_CHLT3      KAWVXXXXXXXXXXXELQKPIVFDPVGAGATPYRTQTILELIHETPPSIIRGNSSEIKALVEAGIKTKGV
THIM_BACC3      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACC0      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACAN      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACAH      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACAC      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACAA      PDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_STAS1      KDREQDILEIAKTANEVGTPIVFDPVAVGASQYRKDFCKTFLNTVDVVVIKGNASEILALINNDAKMKGT
THIM_PYRAB      SWWRKSMIKAVEIANEMKKPIVLDPVGAGATKLRTKVALEILDR-GVTVLKGNFGEISSLLGEFGKTRGV
THIM_LISW6      GELVEAMKIAGRAANFAETQVVLDPVGVGATSYRRKVVQELLAEIQFAAIRGNAGELAAIAGEAWEAKGV
THIM_BACHK      PDEVEAMLLAGKSANTNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINEKWEIKXX
THIM_BACC1      PEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVINERWEIKXX
THIM_PYRHO      SGWRRSMVKATEIANELGKPIVLDPVGAGATKFRTRVSLEILSR-GVDVLKGNFGEISALLGEEGKTRGV
THIM_VIBPA      SVWTPRMSYAVEQANSNGKIVVLDPVGCGASSLRTETSREIARLANKLIIRGNASEIIALAGEQAQSKGV
THIM1_STRPS     DENWKLYQAALKIAEKYNVPVVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRPJ     DENWKLYQAALKIAEKYNVPVVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRZT     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRPN     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRZP     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRR6     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRP7     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRP4     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM1_STRP2     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM_CHLFF      HLFIQRAYRAVDLAVRQSKPVIFDPAGSGATKIRTEVSHHILSH--ATIIRGNASEILSFGDVPAKTRGM
THIM_VIBSL      SVWTPRMCFAVEQANANNKVVVLDPVGCGASTLRTETSREIARLADKLIIRGNASEIIALAGEQAQSKGV
THIM_RUBXD      ERQVESMLAAGRAANERGIPVILDPVXXXXXXXXXXXXXXXXSELEVSAVCGNAGEIATLAGLAAEVRGV
THIM1_STRPI     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM_STRSY      NETWELYKSALDIAEKYGVPTVLDPVAAGAGAYRKKVTLDLLHHHTISLVRGNAGEIAALIGESIETKGV
THIM_ROSS1      PDWIESMLIAGRRANELQTPVVLDPVGAGATQLRTRTNLELLRSLRIAVVR-------------------
THIM_CHLCV      HLFIQRSYRAVDIAIRQNKPIIFDPVGSGTTKIRTEVSHHLL--AHSTIVRGNASKILSFGDLSIKTRGV
THIM1_STRZJ     DENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGV
THIM_LACPL      TTQIDQMRVVGKLANQYHKPVVLDPVAVGAVPYRKEVALALLSDFQVDVIRGNAGEIAALAGMDWQAKGI
THIM_VIBHB      SVWTPRMSYAVEQANANGKIVVLDPVGCGASSLRTETSREIARLADKLIIRGNASEIIALAGEQAQSKGV
THIM_YERE8      RARAESMLSAITAANQAGTPWVLDPVAVGGLAYRTDFARHLL-TLKPAAIRGNASEIMALSGMATMGRGV
THIM_HAEPS      DEKVSXXXXXXXXXXXXXVPVVLDPVAVGASHLRQKTVATLTQNIQFAAIRGNAGELAYLADVQWASKGV
THIM_RHIEC      TQWIDGMQXXXXXXXXXGKPWVLDPVAHYATTFRRQAVADLL-ALKPTIIRGNASEIIALAGGESRGQGV
THIM_CLONN      REQEQSILMVCISAKNNNIPVVLDPVACGAVPHKIALIEKLFEIGRIDIIKGNIGEIKSLAGYNAKTRGV
THIM_STRS2      NETWELYKSALDIAEKYGVPTVLDPVAAGAGAYRKKVTLDLLHHHTISLVRGNAGEIAALIGESIETKGV
THIM_STRA1      KESWQLYQEAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLRGNGSEIAALIGEKQASKGA
THIM_ROSCS      PDWVESMLVAGRQANELDIPIVLDPVGAGATQLRTMTNLKLLRSLHIGVVRXXXXXXXXXXXXXXXMRGV
THIM_PSYWF      QTRLNSMLATAKMAHSKGIPWVLDPVAVGATAFRQQACRQLL-SLQPDVIRGNASEILALAGMSSQSRGI
THIM_RHOFD      PYWIESMQLALRAAAKRGIPVVLDPVGAGATKYRNEAIEQLLMTSLPTVVRGNGSEIMSVAGSAAQTRGV
THIM_RHIE6      TQWLDGMRXXXXXXXSSGKPWVLDPVAHYATAFRRQAVADLL-ALKPTIIRGNASEIIALAGGESRGQGV
THIM_STRA3      KESWQLYQEAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLRGNGSEIAALVGEKQASKGA
THIM_BACA2      SASVEAMIAAGKSANENGVPVIFDPVGAGATPFRTASASKIIQEVRLS----------------------
THIM_SERP5      ASRAESMLAAIEAANAAGTPWTLDPVAVGGLAYRTAFAQSLLGE-KPAAIRGNASEIMALSGLQASGRGV
THIM_DESVV      KPWVESMMLAGMAARERRLPVVLDPVGAGASSLRTTTALEILEKVRPAVVRGNGSEILALAGAAGDTRGV
THIM_DESVH      KPWVESMMLAGMAARERRLPVVLDPVGAGASSLRTTTALEILEKVRPAVVRGNGSEILALAGAAGDTRGV
THIM_STRA5      KESWQLYQEAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLTGNGSEIAALIGEKQASKGA
THIM_COPPD      KEANEAMLSAAHTAKRLGKPAILDPVGYGATKLRINLVERLLETGAFSLVKGNGGEISLLAGERAEVRGV
THIM_HALWD      ETGEEAMMTAGQAASEHDAGLVLDPVGAGATATRSRVAERLSTTLDVDVINGNRGEVAALVGEDAEVRGV
THIM_BACHD      AESIDXXXXXXXXXXXXXXPVVLDPVGAGATVFRTESCKRILKEVDVTIVRGNGGEIAALSDQAGTVKGV
THIM_RHILW      TQWIDGMQXXXXXXXXXGKPWVLDPVAHYATAFRRDAVAGLL-ALKPTIIRGNASEIIALAGGESRGQGV
THIM_METPE      KSQISAMLIAGRAANDLEVPVILDPVGAGATMLRTESARRLLTELQVAVVKXXXXXXXXXXXXXXXXXXX
THIM_SALTI      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALAR      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEIXXXXXXXXXXRGV
THIM_CLOP1      PYQMESSMISMKIAKEKGIPSVLDPVGVQASKLRKDFAKKLILEGEPSLIKGNLAEIKTLIGETSNSIGI
THIM1_OCEIH     STELESMIAAGKTANKHNIPVLLDPVGVAATSFRRNAIDKILEEVRPTVIKGNAGELASLVNINLEAKGV
THIM_CLOPE      PYQMESSMISMKIAKEKGIPSVLDPVGVQASKLRRDFAKKIILEGEPSLIKGNLAEIKTLIGETSNSIGI
THIM_CHLAB      HLFIQRAYRTVDLAVRQNKPVIFDPVAAGATKIRTEVSHHLL--AHATIVRGNASEILSFGDVTMKTRGV
THIM2_OCEIH     EDRGEAMLKAGMAANKNGVPVILDPIAVGGTDFRTEIIDDILKTVKLAAIRANAGEIAVLAGKLEKAKG-
THIM_SALTY      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALNS      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALG2      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALEP      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALDC      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_LACSS      TEPIHQMKTLMAEAYRQAKPVVIDPVAVSSIHYRQKIIDELLALGTPQIIRGNAGEIAYLAGLDWQANGI
THIM_STAEQ      RENEEDIIKIGKIANQQGTPIVFDPVAVGASTYRKNFCQRFLGEVNVTVIKGNASEILTLIDFNTTMKGT
THIM_STACT      KHHEHAMLENAKIANETETPLVFDPVAVGASKYRKDFCKYFLKKIKPTVIKGNASEILALIDDTATMKGT
THIM_METMJ      AAQVEAMLIAGRRANELGIPVVLDPVGVGATEFRTATARKLLDTLDIAVLKGNAGE--------------
THIM_AKKM8      REQGAAMQTAVREANRLNIPWVLDPVAVGALSLRTRLAGQLKEQ-SPRIIRGNASEIMALAGYSSVTKGP
THIM2_CLOBM     KEQETAAILASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM1_CLOBK     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM1_CLOBJ     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM1_CLOBH     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM1_CLOB6     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRMAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM1_CLOB1     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM_SALSV      ASRAEAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALHS      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-PLRPAAIRGNASEILALSGMALGGRGV
THIM_SALPK      ASRADAMRAAVESAYDAKTPWTLDPVAVGVLEFRRRFCLDLL-SLRPAAIRGNASEIXXXXXXXXXXRGV
THIM_SALPA      ASRADAMRAAVESAYDAKTPWTLDPVAVGVLEFRRRFCLDLL-SLRPAAIRGNASEIXXXXXXXXXXRGV
THIM_CHLAD      PDWIEAMIIAGKRANELGIPIVLDPVGAGATSLRTSSNRRLLETLQVAVIRGNSGE--------------
THIM_SALPC      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_SALCH      ASRADAMRAAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_ACIBY      SEQMQAMQISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_ACIBC      SEQMQAMQISAKTAQLNNIPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_ACIB5      SEQMQAMQISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_ACIB3      SEQMQAMQISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_SALA4      ASRADAMRGAVESAYDAKTPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_NATPD      EDGEESMVVAGTAANEGDKPLVVDPVGVGATPTRTRVANRLLDELDVTILNGNHGEITALAGDDADVRGV
THIM_ACIBT      SEQMQAMQISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_ACIBS      SEQMQAMQISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQSKGV
THIM_SALPB      ASRADAMRATVESAYDAKIPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMALGGRGV
THIM_STAES      RENEEDIIKIGKIANQQGTPIVFDPVAVGASTYRKNFCQRFLGEVNVTVIKGNASEILTLIDFNTTMKGT
THIM1_CLOBL     KEQETAAVLASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFLAGMDSETRGV
THIM_TOLAT      SAQAATIRIAVQSANQAGTPWVLDPVAAGVLPYRTELCRELLQQ-HPAAIRGNASEIMALAGQAAAGKGV
THIM_ERWCT      RTRAEAMRAAVNSAHQAGTPWVLDPVAVGGLTFRTEFCRELL-TWKPAAIRGNASEIMALAGLAAQGRGV
THIM_STAAW      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAAS      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_MACCJ      EGDKENMLQAAAFANKHHVPIVLDPVACGASKFRKDFCLRLLNEHHISIIRGNASE-LAALTDDATMKGT
THIM_ALISL      SVWTPRMHFAVEQANLNNKVVVLDPVGCGASQLRTQTARQIAEAANTLIIRGNASEIIALAGENAQSKGV
THIM_STAAE      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAAC      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAA8      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAA3      AENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_PEDPA      KESWPLMNKLCEAANQYQKPLVLDPVAVGATQYRKALNLMLLEKYHFDVIRGNIGEIAVLAGIDWQTRGI
THIM_VIBF1      SVWTPRMHFAVEQANLNNKAVVLDPVGCGASQLRTQVARQIAEAANKLIIRANASEVIALAGENAQSKGV
THIM_RHIL3      TQWIDGMQXXXXXXXXXGKPWVLDPVAHYATAFRRNAVAELL-ALKPTIIRGNASEIIALAGGESRGQGV
THIM_LACF3      PHQRGEMEAVMEAAKKYHKPTVLDPVACGATMYRLRVVTELLHQYHFTVIRGNAGEIATLAGVEWQSHGI
THIM_VIBFM      SVWTPRMHFAVEQANLNNKVVVLDPVGCGASQLRTQVARQIAEAANKLIIRANASEVIALAGENAQSKGV
THIM_STAAN      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAAM      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAA9      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAA2      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_STAA1      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_LEPIN      SNDAITMKIAAEAAHQAKIPWVLDPVAVGALGFRTELAKELLN-FKPTVIRGNASEILALAGTDGGGKGV
THIM_LEPIC      SNDAITMKIAAEAAHQAKIPWVLDPVAVGALGFRTELAKELLN-FKPTVIRGNASEILALAGTDGGGKGV
THI4_SCHPO      -ENTKTYIHAAQVNNDLARPVILDPVAVGATTARSKVINTLLNYAYYDIIKGNEGEIMNLAGEQGLMRGV
THIM_CLAMS      XXXXXXXXXXXXXXXXXGTPWVLDPVAVGALPVRTRLAHELV-ALSPTIVRGNASEIIALATGGAGGRGV
THIM_DESRM      PRQVEYFIKAGKSANQEQKPVVFDPVGIGATSYRNAVAAEILDKIKLDLIRGNHGEINFLAGITGQTKGV
THIM_SYNWW      GEQEAAMLEGRWAAASRDVPLILDPVACGVIGRKVDLIERIKSLGKIQVLKGNIAEIKSLAGLAGKAQGV
THIM_LEPBL      SNDAKAMKIAATVAHQTNTPWVLDPVAVGALGFRTETTKKLLD-LKPTVIRGNASEILTLAGIAGKGKGV
THIM_LEPBJ      SNDAKAMKIAATVAHQTNTPWVLDPVAVGALGFRTETTKKLLD-LKPTVIRGNASEILTLAGIAGKGKGV
THIM_DESAH      KGRIEVMKTLMTLAARMDKPVVLDPVGSGAGAYRTGIAKALFALAPRKIIRGNASEVCSLTGTNYTTRGI
THIM_COREF      AEQYAGMERAIEGATAAGTPWVLDPVGVGGLAERSAFLRRAVDK-HPAAIRGNASE--------------
THIM_CLOK5      REQESSAILAAVSAKTHNIPVVLDPVACAAIPKKIQFIDKLFKVGRVDVIKGNIGEIKFLAGETSNVKGV
THIM_CLOK1      REQESSAILAAVSAKTHNIPVVLDPVACAAIPKKIQFIDKLFKVGRVDVIKGNIGEIKFLAGETSNVKGV
THIM_PECCP      RSRAEAMRTAVNSAHQAGTPWVLDPVAVGGLIFRSEFCRELL-AWKPAAIRGNASEIMALAGLAAQGRGV
THIM_LACRJ      EHQATQIRTVLRAATPL-KPLVLDPVAVSAVPSRLKFAHSLLNDFHFDVIRGNASEIAALVEADNTSHGI
THIM_LACRD      EHQATQIRTVLRAATPL-KPLVLDPVAVSAVPSRLKFAHSLLNDFHFDVIRGNASEIAALVEADNTSHGI
THIME_SYMTH     PGLQQAMLEAGQVAARRGIPVVLDPVGAGGTETRTRAALELLERVRVTAVRGNAGE--------------
THIM_CLOPS      PYQMESSMISMKIAKEKGIPSVLDSVCVQVSKLRRDFAKKIILEGEPSLIKGNLAEIKTLIGETSNSIGI
THIM_CITK8      RSRAEAMRAATEQAHIAKTPWTLDPVAVGALDYRRRFCLELL-SLKPRAIRGNASEIXXXXXXXXXXRGV
THIM_FINM2      DYRIESIKKSVRIANENNIPITLDLVGVSASKLRLDLTLDILKNHTITCIKGNYSEIKSLFIKDLSTKGV
THIM_PROAC      RETTEXXXXXXXXXXSSNTPWVLDPVGVGMS-WRTRVVLDTLDVAAPAVIRANASEVLALAGTGASSRGP
THIM_CORGB      AEQYQGMTKAIEGARKAGTPWVLDPVAVGGLSERTKYAEGIVDK-QPAAIRGNASEXXXXXXXXXXXXXX
THIM_ROSDO      TPWQXXXXXXXXXXXXQNIPWVLDPVAHFISVYRREAAQQLLAQ-RPTILRGNASEILALTGETGAGKGA
THIM_KLEP3      EDRAVAMRAAVEHARQAGKPWTLDPVAVGALTVRTAFCHELL-ALQPAAIRGNASE-------ILALAGM
THIM_CORGL      AEQYQGMTKAIEGARKAGTPWVLDPVAVGGLSERTKYAEGIVDK-QPAAIRGNASE--------------
THIM_KLEP7      EDRAVAMRAAVEHARQAGKPWTLDPVAVGALTVRTAFCHELL-ALQPAAIRGNASE-------ILALAGM
THIM_ECO5E      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGVANGGRGV
THIM_ECO57      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGVANGGRGV
THIM_CLAM3      XXXXXXXXXXXXXXXXXGTPWVLDPVAVGALPVRTRLAHELV-ALSPTVVRGNASEVIALATGGAGGRG-
THIM2_STRZJ     AEKEKAIRIAASYAAQVCLPMVVDAVGVTASSIRKSLVRDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRP4     AEKEKAIRIAASYAAQVCLPMVVDAVGVTASSIRKSLVRDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRP7     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVIKGNMSEIRSLVGLKHHGVGV
THIM_ECO81      QPRVQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM2_STRZT     AEKEKAIRIAASYAAQVCLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRZP     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM_ENT38      APRAQAMRRAIEGAMAAGKPWTLDPVAVGALSYRTRFCQQIL-SLKPAAIRGNASEILALAGMSAGGRGV
THIM_PSYIN      SLWIPRMLFAVEQANIHKKTVVLDPVGCGASSLRTATSWQIAEAANKLIIRGNASEIIALAGEKGQSKGV
THIM2_STRPS     AEKEKAIRMAALYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRPJ     AEKEKAIRMAALYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM_ENTFA      QEREQSLLAASDYARQVNKLTVVDLVGYGASDIRNEVGEKLVHN-QPTVVKGNLSEMRTFCQLVSHGRGV
THIM_ECOSE      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECOL5      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECO8A      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECO7I      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECO55      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_SHISS      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM2_STRR6     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRPN     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM2_STRP2     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM_SHIB3      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRRFCLELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECOSM      QPRAQAMRAAVEQAKRSQTPWTLDPVAVGALDYRRRFCLELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECOUT      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECOL6      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECOK1      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_ECO45      QPRAQAMSAAVEQATRSQTPWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM2_STRPI     AEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLVKDLLD-YRPTVLKGNMSEIRSLVGLKHHGVGV
THIM_SHIBS      QLRAQSMCAAVEQAKSSQTPWTLDPVAVGALDYRRRFCLELLPH-KPTAIRGNASEIMALAGIANGGRGV
THIM1_LEUMM     KVEINDIIKLSQEAYQLGKPVVLDPV-AVSVPFRSKAITQFLASGHVDVIRGNAAEIAWFADIDFASQGI
THIM_ENTS8      RPQQQAMRAAIDSACAAGKPWTLDPVAVGALTLRTEFAQEILAR-RPAAIRANASEIRALTGESGGGRGV
THIM_STAAR      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_SHIDS      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECOLI      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECOLC      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECOHS      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECODH      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECOBW      QPRAQAMRAAVEQAKSSQTPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_ECO24      QLCAQSMCAAVEQAKSSQTPWTLDPVAVGALDYRRRFCLELLSH-KPTAIRGNASEIMALAGIANGGRGV
THIM_CARHZ      SRQVEYFKKAVYLANKYQKPLLLDPVGLGATTYRNETTFELLNSGNFTLIRGNYGEISFLAGNSAQVKGV
THIM_RHOS5      PRWVEGMEXXXXXXXXXXXPWVLDPV-AVXXXXXXXXXXXXXXXXKPTVIRGNASEILALAGAEARGKG-
THIM_LACLM      ESTYPLFLEACRLANQKAKPLILDPVAVNI-PFRASIVKRLSQEVKFNIIRGNSAEIAWFADKKSLNKGI
THIM_ECO27      QPRAQAMSAAVEQAQT---PWTLDPVAVGALDYRRRFCVELLSH-KPTAIRGNASEIMALAGVANGGRGV
THIM_LACCB      EVRQQNLLAAGKFAQATNQPTVIDLVGVSATQLRYDLGHQLLAN-HPNVVKGNISEMRRFADLKSTGRGV
THIM_LACC3      EVRQQNLLAAGKFAQATNQPTVIDLVGVSATQLRYDLGHQLLVN-HPNVVKGNISEMRRFADLKSTGRGV
THIM_LACLS      ESTYPLFLEACRLANQKAKPLILDPVAVNV-PFRASIVKRLSQEVKFNIIRGNSAEIAWFADKKSLNKGI
THIM_STAHJ      KANEQDILEIGKIANQQGTPIVFDPVAVGASSYRKAFCQKFLSEVKVSVIKGNASE--------------
THIM_STAAB      AQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATMKGT
THIM_ECOLU      QPRAQAMRAAVEQAKRSQTPWTLDPVAVGALDYRRCFCLELLSH-KPTAIRGNASEIMALAGIANGGRGV
THIM_HERA2      IDRMXXXXXXXXXXXXXXXPIVLDPVGVGATVWRKQAALALIATVQPTIXXXXXXXXXXXXDQTGVAHGV
THIM_SHIFL      QPRAQAMRAAVEQAKSSQTRWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_SHIF8      QPRAQAMRAAVEQAKSSQTRWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIANGGRGV
THIM_GEMAT      PAWVDGMKAAIDGATAVGTPWVLDPVAHYASAYRSAVARDLLSR-RPTILRGNASEILALAGGNTAARGV
THIM_BIFA0      PFYRDALQEISEHLSRHGCKWVLDPVAAGVGVARTEILKGFKD-YPPTVIRANASEVLHDMWQLGDAAGT
THIM_RHOS4      PRWVEGMEXXXXXXXXXXXPWVLDPV-AVXXXXXXXXXXXXXXXXKPTVIRGNASEILALAGAETRGKG-
THIM_RHOE4      DGTAEAFLISAEAARTAGTPWVLDPVGVGGLPWRSGIAVDLL-RFHPSAIRGNASEIIALAGLGGDTRG-
THIM_ACIAD      TEQIQAMQISAKTAHEHDIPWVLDPVGYG-PILKWR--SDMVDELLPSVIRGNASEIGALAGSLVQSKGV
THIM_RHOSK      PRWVEGMEXXXXXXXXXXXPWVLDPV-AVXXXXXXXXXXXXXXXXKPTVIRGNASEILALAGAETRGKG-
THIM_RHOS1      PRWVEGMEXXXXXXXXXXXPWVLDPV-AVXXXXXXXXXXXXXXXXKPTVIRGNASEILALAGAETRGKG-
THI6_YEAST      -APIEMLKAAINAYNEVNRPITFDPVGYSATETRLCLNNTLLTYGQFACIKGNCSELSLAKLNNHKMKGV
THIM_AGRT5      AERRRVIRLAIEIANASGKPWIVDPVHVDYSPSRLDFARELIAQ-SPTIVRGNRAEMSLIGDVPDVVR-I
THIM2_LEUMM     ESHEQSLSQASSLADMTKKPTVVDLVGYGITNERTKLGM-AMARNHPTVIKGNTSEIRRFVGLPSLAKGI
THIM_LACLA      EKDYPLFLTICQLANQKHKPLILDPVAVNV-PFRANFVKRLMQEVKFDIIRGNSAEIAWFADKESLNKGI
THIM_DICNV      DERLRSLSMSAQVAHDHGKWWVFDPAASDILSYRSGFARELL-RYYPRVIRGNASEISYLNDTYGRRSFE
THIM_ESCF3      QXXXXXXXXXXXXXXXXXTPWTLDPVAVGSLDYRRHFCTELL-SLNPDAIRGNASEIMALAGVSNSGRGV
THIM_LARHH      PXXXXXXXXXXXXXXXXGTPWTLDPVAVGALAFRTQFCRELLSQ-RPTAIRGNPAEILALAGEASRGRGV
THIM_LEUCK      RAELLETVKLIQIANQTQTVVVLDPVAVGIPS-RSVPVQELLTNSKVDIIRGNAAEIAWFAGIDFASHGI
THIM_GRABC      SPXXXXXXXXXXXXXXXGKPVVLDPVAVGALRYRTELARDLLE-AKPHIVRGNASEXXXXXXXXXXXXXX
THIM_BIFAA      PFFKNALPEIARKLHENGKTWVLDPVAAGIGETRTAILESFRD-VPPTIVRGNASE--------------
THIM_BIFLO      PFYKDALPEIAQRLNYLDKPWVLDPVAAGIG--RTRTAILQAFKAAPTMIRANASE--------------
THIM_DESMR      GENIEAMLXXXXXXXXXXVPVVFDPVAAGVTSRRREVAGRMLETVRLAAVRGNASEILALAGEAALSKGA
THIM_BIFLI      PFYKDALPEIAQRLNYLDKPWVLDPVAAGIG--HTRTAILQTFKAAPTMIRANASE--------------
THIM_BIFLD      PFYKDALPEIAQRLNYLDKPWVLDPVAAGIG--RTRTAILQAFKAAPTMIRANASE--------------
THIM_KINRD      DDRARAMGLAAQSADRSRTPWVLDPVAVGGLEFRTRVARDLLAS-SPTVVRGNASEVXXXXXXXXXXXXV
THIM_BURTA      SSGADTLRTAARAASETGTRWVLDPVATGAGAPEYDAIVQELLAFRPSVIRGNASELIALAGGTAAGKGV
THIM_BURPS      SSGADTLLTAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAAGKGV
THIM_BURP6      SSGADTLLTAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAAGKGV
THIM_BURP1      SSGADTLLTAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAAGKGV
THIM_BURP0      SSGADTLLTAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAAGKGV


                         +         .         .         .         .         *         .:210
query           DVCPGDAVTEDNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAYAVRNGSPLMGRITGAGCMLSCVC
THIM_CLOAB      XXXXXXXXXXXTLDNVINFAKGFSKKTGAVIAITGAIDIIANESKAYVVRNGNPNMSKITGTGCMLSAMT
THIM_ALKOO      D------SVDSSLDGGKEIAISLAKKLSCTVVITGEVDIVSDGNKTYAIQNGHKALSSITGTGCMSASLI
THIM_CLOTE      DAESWDET--NPIEERIRLVKSLSEKYNAVIGITGEKDVIGFKEEVYTVENGSSIMAKITGAGCMCTSVI
THIM_CLOB8      DASENDARTGND--EGIDVAKNLAKKLQCTVAITGATDIISDGERVVILENGTKMLSNVTGTGCMTTALI
THIM_CLOCE      DASEADIQSNDSI----AVAKAAAVKLGCVVAVTGAVDVISDGKNVVTVLNGHKMLSNVTGTGCMTTALV
THIM_METS3      DVSESDIITQDNLNENADVISKLAAKLDTVILASGPIDILSDGETTIAIDNGDEMMPYITGSGCMLSSIV
THIM_DESDA      DAQDSCLVTEDRLESAAATARHLSESTGAVVVVSGAIDIVAYSGGAWAVRNGHPLMARITGSGCMSAAVM
THIM2_METST     DVSSDDIITKDNIKSNASLVKAVADKLNTTIAVSGAIDIISDGVSIYLIDNGEEVMSKITGSGCMLTCVI
THIM_DESPS      D-------TSQSVSDAAQTASLLARELDTILAITGPTDLVTDGRRVFNVDNGHPLMPYVTGTGCSATAVV
THIM_UNCMA      D---SAGVSGD----PAEFARGLAEKLGLVVAVSGATDIVTDGKRLIYVDNGHEMMGKLSGTGCM-XXXX
THIM_LEPBP      D------ATDSSESAVETGKSLSKVTGGVVVISGATDFILKGTDMA-QISNGDALMTKVTGLGCTASALC
THIM_LEPBA      D------ATDSSESAVETGKSLSKVTGGVVVISGATDFILKGTDMA-QISNGDALMTKVTGLGCTASALC
THIM1_METST     DVAQCDIINKDTLISNCNLIKNISEKLNTTIAVSGPIDIISDGHDVYTIENGDAMMSRITGSGCMLGCVL
THIM_CLOBB      DASESDMNMGND--KKAIVAQELAKKLNCVVAITGVDDIISDGKRNVILSNGHKMLANVTGTGCMSSALC
THIM_METHJ      D---SGGVNGD----PTEITCGLAERLSCTVVMSGPIDIISDGSRTLLCENGHPYMGRISGTGCMAASVI
THIM_GEOTN      DAGEGSG-------DXXXXXXXXXXXXGTVVAITGKEDVVTDGQAAYLIHNGHPLLTKVTGAGCLLTSVV
THIM_THETN      -----EAVEEEE--DISDIAYDLAVKCGCVVAVSGKVDVITDGKKIAYVKNGHPMMGTITGTGCMLTSVV
THIM_CLOBA      DASERDMNMGND--KKVIVAQELAKKLNCVVAITGVDDIISDGKRNVILSNGHKMLANVTGTGCMSSALC
THIM_GEOSW      DAGEGSG-------DVVSLAKKAAKQLKTVVAITGKEDVVTDGNTTYIIRNGHPLLTKVTGTGCLLTSVI
THIM_METMA      E---STSISAD----PQKVAKEFAKSSSSVVVMTGKEDVISDGNRTFVVKNGHELMGSIVGTGCMAASII
THIM_THEP3      ESQSGDDISE--------AAKDLANAYNVVVAVSGVTDIITDGKRIAYVKNGHPMMGTVTGTGCMLTSVV
THIM_ALKMQ      DSMDFGGNTPKMI-------RTLAQKYKTTVAITGATDSICDGTTLISVSNGHSLLSQVTGTGCMTTSLI
THIM_THEPX      E-------SQGGVDDIAEAAKDLANAYNVVVAMSGATDIITDGKRIAYVKNGHPMMGTITGTGCMLTSVV
THIM_BREBN      DAKEAGGDVED-------LARAAAKKLRTIVAITGKVDVISDGEKTYSIHNGHPILTKVTGTGCLLTSVM
THIM_METM6      DSAAYDSNEAIEL------SKNAAKEFNTVSAVTGPIDYVSNGKEIYAISNGHPMLSKVTGTGCATTSII
THIM_METLZ      D---SGNISGD----PKEIAHSLAKEYGCTVVISGAEDIISDGKRIAGVLNGVPIMGKISGT--XXXXXX
THIM_METM5      DSAAYDSNEAIEL------SKNAAKEFNTVSAVTGPVDYVSNGKEIYAISNGHPMLSKVTGTGCASTSII
THIM_PASMU      DAGSGEA-------DLAQIAHIVAKTYQCIAMISGATDYLSDGEHHAQIHNGTPLFPKITASGCLLSAVC
THIM_ANOFW      DA--GDVQSD-----LVDVAKKAAHMFRCVVVITGKDDIVTDGERIVIVSNGDAMLTKVTGTGCLLSSVL
THIM_GEOKA      DAGGGSG-------DRVALAKRAAEQLGAVVAITGKEDVVADGQTTYLIQNGHPLLTKVTGAGCLLTSVI
THIM_NATTJ      DSLDGEDIQMVN--------SELSEKYNTMVLATGKTDLITKGNITVKVSNGTPLLGRITGSGCMLGILI
THIM_SYNFM      D-------SVHATDEARSAAVELANVYKAVVAITGAEDFITNGPKSARVANGHPLMGRVSGTGCVASSIV
THIM_METM7      DSVAYDSNEAIEL------SKNAAKEFNTVSAVTGPIDYVSNGKELYAISNGHPMLSKVTGTGCASTSII
THIM_BACWK      DAGTGNG-------NVVNIAKQAADELNTVAVITGQEDVVTDGERTILIRNGHPILTKVTGTGCLLTSVI
THIM_HAES1      DAGKGMADIAE-------IAHLVARKYQCIAVISGETDYISDGKRLAKLNNGTPLFPKITASGCLLSAVC
THIM_BACC4      DAGTGNG-------DVVSIARQAADELNTVAVITGKEDVVTDGERTIVIRNGHPILTKVTGTGCLLTSVI
THIM_METAC      EATSIDA-------DPAKVAKAFAKAESCVVVMTGKEDIISDGDRTFIVKNGHELMGSIVGTGCMAASIV
THIM_METMP      DSAAYDSNEAIEL------SKNAAKEFNTVSAVTGPVDHVSNGKEIYSISNGHSMLSKVTGTGCATTSII
THIM_BACSU      DAGEGGG-------DIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVV
THIM_BACCR      DAGTGNG-------NVVSIARQAADELNTVAVITGKEDVVTDGERTIVIRNGHPILTKVTGTGCLLTSVI
THIM_BACCN      DAGTGNG-------DSVAIATKAANKLGTVAVITGKEDIVTDGKRTVIIRNGHPILTKVTGTGCLLTSVM
THIM_EXIS2      DVAEGESLDLQSVHAFASQTKQVIVVTGPVDFVTDGV-------RQHHLDVGTKRLGQVTGTGCMTASLI
THIM_DESHD      -----DSLDEGN--DGLEACQSLARAYGCVVAATGKVDIVADGQRACLIENGTEMLTRITGAGCMAGALV
THIM_DESHY      -----DSLDEGN--DGLEACQSLARAYGCVVAATGKVDIVADGQRACLIENGTEMLTRITGAGCMAGALV
THIM_BACC2      DAGTGNG-------NVVSIARQAADELNTVAVITGKEDVVTDGERTVLIRNGHPILTKVTGTGCLLTSVI
THIM_DESOH      DSLETDAVRHE--------AGLLAGELEKVVAVTGPVDIVTDGTRTLEVHNGTPMFGRVTGTGCSATTVI
THIM_METBF      EATSINA-------DPVKIAKQFAKLSSSVIVMTGKEDIISDGERVFIVKNGHELMGSIVGTGCMAASVI
THIM_CALMQ      DSIVN--ATMDTAVKIAEEYGVTAVITGPWDYVSDGV-------RKVIVKNGTPLLQYVTGSGCMVGSVI
THIM_LISMH      DAGVGSA-------DVLSIAEKVANEWSTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_BACLD      D-------AGEESGDRTELAKKAAKLWDTAVIITGAEDVITDGTKTYTVGNGHQLLTKVTGTGCLFTSVI
THIM_PHOPR      DAL-------DSSDKAIHAAHHLATQNNCSVVISGATDYIVTTTATIALNNGHEMMPYVTGMGCSHTALT
THIM_MOOTA      DAAGAPARVAEMV-------KQVARDLNTVVAVTGATDYISDGERLIAVDNGHPLLTFVTGTGCSATSII
THIM_HAEIG      DAGQGEAVAE-----------KVAQRYGCTVLISGVVDIVSDGTQTATVHNGTSLFPKVTASGCLLSAVC
THIM_LISMO      DAGVGSA-------DVLSIAGKVANEWSTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_HAEIE      DAGKGEAVAE-----------KVAQRYGCTALISGAVDIVSDGTQTATIHNGTPLFPKVTASGCLLSAVC
THIM_LISIN      DAGVGSA-------DVLSIAEKVANEWSTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_HAEIN      DAGQGEAVAE-----------KVAQRYGCTVLISGAVDIVSDGTQTATVHNGTSLFPKVTASGCLLSAVC
THIM1_CLOBM     DVGECDIITEQNFDENIEMIKRLSMETDSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGSMLTGII
THIM_CAMLR      D---NTFVVNDHF---LDKACEYAKGHNRILVVSGEVDFIISSEKIAKIYNGSIMATKITGAGCMCASMC
THIM_BRAHW      D-------STANVNMALEAGKHLAKEYNTVVSISGETDIITDGNKVLYVSGGSPLMPVNTGMGCTSTAIT
THIM2_CLOBL     DVGACDIITEQNFDENIEMIKRLSMETGSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGCMLTGII
THIM_METVS      D----SAVYDNN--EALNISKNASKEFNTVSTVTGPIDYVSNGKEIYSISNGHEMLSKVTGTGCASTSII
THIM_ARCFU      D---------SKVTAEAADVKEVARKFGLVVVATGKEDLISDGRSVYVMRNGTEMLGRITASGCMLGSVI
THIM2_CLOBH     DVGACDIITKQNFDENIEMIKRLSMETGSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGCMLTGLI
THIM2_CLOB1     DVGACDIITKQNFDENIEMIKRLSMETGSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGCMLTGLI
THIM_HAEI8      DAGQGEAVAE-----------KVAQRYGCTVLISGAVDIVSDGTQTATVHNGTSLFPKVTASGCLLSAVC
THIM2_CLOB6     DVGACDIITEQNFDENIKMIKRLSMETGSVVAATGVVDIISNGTHTYIISNGCEVLSMITGTGCMLTGII
THIM_LISMC      DAGVGSA-------DVLSIAEKVANEWSTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_LISMF      DAGVGSA-------DVLSIAEKVANEWSTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_HELPS      DSHYATTPIE--------IVKLVAQKYSVIAVMTGKTDYVSDGKKVFSITGGSEYLALITGAGCLHAAAC
THIM2_CLOBJ     DVGACDIITEQNFDENIEMIKRLSMETGSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGCMLTGII
THIM_ACTSZ      DA--GTGADSENLSRLAQSVAQKYRCVVALSGETDFISDGL---KTYQICNGTRMLPKVTGSGCLLGAVI
THIM2_CLOBK     DVGACDIITEQNFDENIEMIKRLSMETGSVVAATGVVDIISNGTYTYIISNGCEMLSMITGTGCMLTGII
THIM_HELPJ      D--------SKHSATPIEIVKRAAQKYSVIAVMTGKTDYVSDGKKVLSITGGSEYLAAITGAGCLHAAAC
THIM_DESVM      ----------------------------------------------------------------------
THIM_HELPG      D--SHDATTPVEI------IKRAAQKYSVIAVMTGKTDYVSDGKKVLSITGGSEYLALITGAGCLHAAAC
THIM_DESDG      D-------SIHQXXXXXXXXRELAGKFGCVVVVSGAEDLITDGSSDVLVRGGHDMMPRITGMGCXXXXXX
THIM_BACP2      DAKAANG-------DVSALVKQAAKTLQTXXXXXXXXXXXXXXXXXLSIHNGHEWLTKVTGTGCLLTSVI
THIM_LEPCP      DLSSNDAVAAAQTLSRRIGSVVCVSGADDHVVDALG--------RWATLSNGHPWMTRITGVGCSATAMI
THIM_EXISA      DA--GDGACEPR-----QLALEAAKRYGCVVAVTGKEDMVSDGHVVMEVRGGTKRMTETTGTGCLLSAVV
THIM_DESAP      ----------------------------------------------------------------------
THIM_CLOD6      D-------SFDEEEDSTEIIRKIAEKLECVVVATGKIDIITNGKGTYKINNGTDKLKGITGTGCMTASLI
THIM_HELPY      D--SNDAATPVEI------IKLAAQKYSVIAVMTGKTDYVSDGKKVLSITGGSEYLALITGAGCLHAAAC
THIM_BACSK      DGKINADVKE--------LCLQAAKALRTXXXXXXXXXXXSNGEQLVAVANGHEWLTKVVGTGCLLGGVI
THIM_METB6      DSASGDPVT---------ITRTFARETGITVVMSGATDIISDGNKVLLVDNGHPLMGRISGTGCMASAVT
THIM_PYRFU      DSSTYDPERAKEL------ALAVAEEFSTIVAVTGKVDYVSDGKRVYAVYNGHELLGRVTGTGCIVAALT
THIM_LACBA      DAGEG-------AGDLVAIAQACAQKLDCVVILSGPTDIITDGTRVVKVLNGTPLFQVHVGSGDMLSSIV
THIM_LYSSC      DSGDGDIETEATLLAQRYNCIVIVTGEHDFMTDGV---------QSQWITGGNSQMTEVTGTGCLLSAIC
THIM_AGRRK      D-------SRDPXXXXXXXXXXXXXKHRTIVAVTGATDFVTDGNKASRIEGGSPLMPQVTALGCSLTCLV
THIM_BACCZ      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKVTGTGCLLTSVI
THIM_BACCQ      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGQRTIVIRNGHPILTKVTGTGCLLTSVI
THIM_BACC7      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGQRTIVIRNGHPILTKVTGTGCLLTSVI
THIM_DESAA      E---------------------------------------------------------------------
THIM_SYNAS      D--------STELSQNAVDAGRRLNDSYGSTVCISGETDFIIGDRALGIRNGHPLMTRVTGLGCTASALC
THIM_HELPH      DSQDANTPVE--------IIKRVAQKYFVIAVMTGKTDYVSDGKKVLSITGGSEYLALITGAGCLHTAAC
THIM_CHLSY      ----------------------------------------------------------------------
THIM_CHLAA      ----------------------------------------------------------------------
THIM_CHLT3      D-------STXXXXXXXXXXKHLSQKYGAVICISGATDHILNQEEYVRVENGHPMMTKVTGLGCXXXXXX
THIM_BACC3      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_BACC0      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_BACAN      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_BACAH      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_BACAC      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_BACAA      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVI
THIM_STAS1      D-------SDDNL-NAIEIAKEAHKRLNSAIIITGKEDVVIQDNQIYQLNNGSALLAKVTGAGCLLGAVI
THIM_PYRAB      DSSEYDEEKAKVLALSAAKEFNTTVAVTGAVDYVSDGG------KVFAIYNGHKLLERVTGTGCIVTAIT
THIM_LISW6      DAGVGSA-------DVLAIAEKVAKEWNTVVIISGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVC
THIM_BACHK      XXXXXXXXXXS-------IAKQAADELNTVAVITGKEDVVTDGERTIVIRNGHSILTKVTGTGCLLTSVI
THIM_BACC1      XXXXXXXXXXS-------IAKQAADELNTVAVITGEEDVVTDGERTIVIQNGHSILTKVTGTGCLLTSVI
THIM_PYRHO      D------SLEYGEEEAKKLTMNAAREFNTTVAVTGAVDYVSDGRRTFAVYNGHELLGRVTGTGCMVAALT
THIM_VIBPA      -------XXXXXXXXXXXXXHFLVKEYGASVVISGETDYIVTKEQTVQLNNGHEMMPYVTGMGCTLTALT
THIM1_STRPS     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRPJ     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRZT     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRPN     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVMIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRZP     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRR6     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRP7     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVI
THIM1_STRP4     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM1_STRP2     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM_CHLFF      DSANATHDAKD-----IAVALASECLCGCAVAVTGSEDFITDGKRHATVELGDPLMSRITGMGCSLTGVL
THIM_VIBSL      -------XXXXXXXXXXXXXQCLVAEYGANVVISGETDYVVTKDSVVTLNNGHPMMPYVTGMGCTLTALT
THIM_RUBXD      ESIGGDA---------REAALKAASSLGLTVAATGAVDYVCGGGRALAVENGHPLLGRVVGSGCASTAVV
THIM1_STRPI     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM_STRSY      DSAQIDNVGELAL--------RANQQLGIPVVITGKKDAVAVNHQVRILENGSELMPLVTGTGCLLGAVL
THIM_ROSS1      ----------------------------------------------------------------------
THIM_CHLCV      -----DSANTTHDAKETAIALANECLCGCAIAVTGAVDFITDGKRSATIELGDPLMSHVTGMGCSLTGVL
THIM1_STRZJ     DSAGVDNIDEIALAANEKFNIPIVVTGEVDAIAVNG--------EVVTIHNGSAMMPKVIGTGCLLGAVV
THIM_LACPL      DAGSGQG-------DLVEIXXXXXXXXXXXVILSGPTDVITDGQRVVKVANGTPLFQRHVGSGDLLSSIV
THIM_VIBHB      XXXXXXXXXXXXXNFLVAEYGASVVISGETDYIVTKG-------QTVQLNNGHEMMPYVTGMGCTLSALT
THIM_YERE8      D-------SVDTSXXXXXXXXXXXXXXXXVVAVTGEVDYITDGQRDVAVTGGDKLMTRVVGTGCALSAVV
THIM_HAEPS      DAGQGSG----NL---AEIAQKVAQKFNTIAVLSGEHDFVANHDRVMKLSNGVALFPKVTATGCLLSAIV
THIM_RHIEC      D-------SRDPVEQAEDSARRLAERQQAIVAVTGAVDFVTDGERAVRIKGGSVLMPEVTALGCSLTCLI
THIM_CLONN      D-------SIDNGNDSIDACISLAKKYKCIVAATGVKDIVTDGKRTALIENGSKMLTLITGAGCMVGALT
THIM_STRS2      DSAQIDNVGELAL--------RANQQLGIPVVITGKKDAVAVNHQVRILENGSELMPLVTGTGCLLGAVL
THIM_STRA1      D---GGKVAD-----LESIAVKANQVFDVPVVVTGETDAIAVRGEVRLLQNGSPLMPLVTGTGCLLGAVL
THIM_ROSCS      E---------------------------------------------------------------------
THIM_PSYWF      D--SGDSVXXXXXXXXXLTQYAKVVVVTGEIDWVTDGM------NRWAINHGHPMMTQVTAIGCALTALI
THIM_RHOFD      D------SSXXXXXXXXXXQSLVQRTQGVVCVSGQIDHILDASHRWAQLSNGHAWMTRITGVGCSATALI
THIM_RHIE6      D-------SRDPVEQAEDSARRLAERQQAIVAVTGAVDFVTDGNRAVRIKGGSVLMPQVTALGCALTCLV
THIM_STRA3      D---GGKVAD-----LESIAVKANQVFDVPVVVTGETDAIAVRGEVRLLQNGSPLMPLVTGTGCLLGAVL
THIM_BACA2      ----------------------------------------------YAVHNGDKLLTKVTGAGCLLTSVI
THIM_SERP5      -------XXXXXXXXXXXXXXXXXXNSGAVVAVTGVVDYITDGQRDWAVAGGDVLMTRVVGTGCALSAVV
THIM_DESVV      DSARTAHEAVDG-------ARALARRYXXXXXXXXXXXXXTDGDALWLVRGGSPLMPRVTGMGC------
THIM_DESVH      DSARTAHEAVDG-------GRALARRYXXXXXXXXXXXXXTDGDALWLVRGGSPLMPRVTGMGC------
THIM_STRA5      D---GGKVAD-----LESIAVKANQVFDVPVVVTGETDAIAVRGEVRLLQNGSPLMPLVTGTGCLLGAVL
THIM_COPPD      DSSPPAAIAAKTV----------AQKYNCIAAATGPDDYVSDGERVYVLRSGHEWLTRISGSGCWAGTLM
THIM_HALWD      ESVPDAAET----------AIACAQHTEAVVVSSGVTDIVATAETAFELNVGDEMLGTLVGTGCMLGGTI
THIM_BACHD      D----GSIDSDPV----ELAKHAANVLNSAXXXXXXXXXXXXXXXXXXXYNGHPWLTKVVGTGCLSGAIV
THIM_RHILW      D-------SRDPVEQAEGSARWLAERQQAIVAVTGAVDFVTDGERAVRITGGSALMPQVTALGCSLTCLV
THIM_METPE      DSADGDPVA---------VCKSLVNAYSCTVAMSGATDIVTDGDRVVLIDNGDPRMGVVSGTGCMASSLT
THIM_SALTI      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALAR      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_CLOP1      DSF-DDSLSENT----KNKIKEYARERNLIVVVSGVVDFITNGEESASVKNGTYKMSKITGTGCMLGALL
THIM1_OCEIH     -----DSIGDGNLDVIAQKVSEKYNTAVVVTGETDVIYVDN-----HLIHNGTHYLSSITGSGCLLGSII
THIM_CLOPE      DSFE-DSLSENT----KNKIKEYARERNLVVVVSGVVDFITNGEESASVKNGTYKMSKITGTGCMLGALL
THIM_CHLAB      DSTHSTQDAKD-----VATALAKECLCGCAIAVSGAIDFITDGQRHTTVELGDPFMSYVVGMGCSLTGVF
THIM2_OCEIH     ----PDSIIQEN---EPEIAKTVAKKYDTVVISTGKVDVVTDGKRTALCTNGHEMLQNITASGCLLSSFV
THIM_SALTY      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALNS      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEVDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALG2      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALEP      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALDC      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_LACSS      DAGSGE-------IDLVKVAQTAAKKQQTTILLSGPTDIITDGHHTTKVANGTPLFQVHVGSGDMLTGLC
THIM_STAEQ      D--------SDSELDSVNIAKKAANTLNTAIVITGKDDIIAKNEKIIKLSNGSPLLTKITGAGCLLGGVL
THIM_STACT      D-------SADNL-DVVDIAEKAYKEYQTAIILTGETDVIVQDNKVVKLSNGSHFLAKITXXXXXXXXXX
THIM_METMJ      ----------------------------------------------------------------------
THIM_AKKM8      ESTSSSA-------DALHAARELALHTGAAVLVTGRTDYSTDGRQVTATENGHAMMSRVTGVGCSMGALS
THIM2_CLOBM     D---------------------------------------------------------------------
THIM1_CLOBK     D---------------------------------------------------------------------
THIM1_CLOBJ     D---------------------------------------------------------------------
THIM1_CLOBH     D---------------------------------------------------------------------
THIM1_CLOB6     D---------------------------------------------------------------------
THIM1_CLOB1     D---------------------------------------------------------------------
THIM_SALSV      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEVDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALHS      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEVDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALPK      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNSQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALPA      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNSQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_CHLAD      --------------------------------------------RVLAVDNGHEWLKTLTGTGCSATTVI
THIM_SALPC      D-------TTEXXXXXXXXXXXXXHQIDCIVVVTREIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_SALCH      D-------TTEXXXXXXXXXXXXXHQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_ACIBY      D----STLSSDQ--AYQQAFSLLTHASCIAISGESDYILSNEVDAVIQVNGGSPLQPKITATGCALGALI
THIM_ACIBC      D------STLSSDXXXXXXXXXXXHADCIAISGESDYILSNEIDAVIQVNGGSPLQPKITATGCALGALI
THIM_ACIB5      D----STLSSDQ--AYQQAFSLLTHASCIAISGESDYILSNEVDAVIQVNGGSPLQPKITATGCALGALI
THIM_ACIB3      D----STLSSDQ--AYQQAFSLLTHASCIAISGESDYILSNEVDAVIQVNGGSPLQPKITATGCALGALI
THIM_SALA4      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEVDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_NATPD      ESVGEYAIAETAL--------SCARTHDTVVVASGETDIVASPEEAYEITAGHPLMAQIVGTGCMLGVTL
THIM_ACIBT      D----STLSSDQ--AYQQAFSLLTHASCIAISGESDYILSNEVDAVIQVNGGSPLQPKITATGCALGALI
THIM_ACIBS      D----STLSSDQ--AYQQAYVLLAHADCIAISGESDYILSRELDAVIQVNGGSPLQPKITATGCALGALI
THIM_SALPB      D-------TTEXXXXXXXXXXXXXRQIDCIVVVTGEIDYVTNGQRTLSIPGGDPLMTRIVGTG-XXXXXX
THIM_STAES      D--------SDSELDSVNIAKKAANTLNTAIVITGKDDIIAKNEKIIKLSNGSPLLTKITGAGCLLGGVL
THIM1_CLOBL     D---------------------------------------------------------------------
THIM_TOLAT      D-------SANQSDQAIEAAQVLAKSSGAIVAVTGEIDYITDGERVVSIKAGDPLMTRVTGTGCALSSVV
THIM_ERWCT      -------XXXXXXXXXXXXXXXXXXQVGTIVVVTGAVDYVTDGERDIAVTGGDSMMTRVVGTGCALSAVV
THIM_STAAW      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_STAAS      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_MACCJ      DA--------DQSLSTESVARRAYDKFKTAIIATGAVDAICQDEQIMLVENGTPMLTKVTGGGCLLGAVV
THIM_ALISL      -------XXXXXXXXXXXXXCYVAQQYQCSVVISGETDYVVTKEAQYKLNNGHAMMPFVTGMGCTHTALT
THIM_STAAE      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAFVLANGSPLLARVTGAGCLLGGVI
THIM_STAAC      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAFVLANGSPLLARVTGAGCLLGGVI
THIM_STAA8      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAFVLANGSPLLARVTGAGCLLGGVI
THIM_STAA3      D--------SDANLDXXXXXXXXXXXXXXXXXITGKEDVIVQDNKAFVLANGSPLLARVTGAGCLLGGVI
THIM_PEDPA      DAGNGTG-------DMSAVVQACAQKFKNVVIASGEVDYISDGQQVITVHNNTKLLPAIVGSGDLLSSIV
THIM_VIBF1      DAL-------DSSDSAVGAACYVAQKYQCSVVISGETDYIVTQDAQYKLNNGHAMMPFVTGMGCTHTALT
THIM_RHIL3      D-------SRDPVEQAEGSARWLAERQRAVVAVTGAVDFVTDGERAVRIEGGSALMPQVTALGCSLTCLV
THIM_LACF3      DAGEGNADLE------------------------------------------------------------
THIM_VIBFM      DAL-------DSSDSAVGAACYVAQKYQCSVVISGETDYIVTQDAQYKLNNGHAMMPFVTGMGCTHTALT
THIM_STAAN      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_STAAM      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_STAA9      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_STAA2      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_STAA1      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQDNKAIVLANGSPLLARVTGAGCLLGGVI
THIM_LEPIN      D---STALSSDAL----PLAQMLAEKTGAVIAISGEIDYVTNGKETISISGGDPIMTKVTGVGCSLGGVI
THIM_LEPIC      D---STALSSDAL----PLAQMLAEKTGAVIAISGEIDYVTNGKETISISGGDPIMTKVTGVGCSLGGVI
THI4_SCHPO      -----DSISQHTLAARITAVHRLAVERRCVVAMSGAVDVISDGNSTYVIKNGNPLLGQITASGCSLGSVM
THIM_CLAMS      D-------ATDEVEAALDAASLLARTYGTVVAVSGAVDHITDGHRLVRVHTGDAWLTKVTGGGCALGAVM
THIM_DESRM      DSLSNQISVK--------HLAEFANTTRTLVVSTGEVDYLSDGAKTFTNKTGHAYLQLVTGTGCALSSLA
THIM_SYNWW      DLDTGEGLEEACL---------QLAVKDKLIAVATGEVDIVAEENRYAIFNGTPLFQNITXXXXXXXXXX
THIM_LEPBL      D-------STVNSKDALPYAQELSGKTGAVVAVSGEVDYVTNGKETIEIYGGDPIMTKVTGVGCSLGALI
THIM_LEPBJ      D-------STVNSKDALPYAQELSGKTGAVVAVSGEVDYVTNGKETIEIYGGDPIMTKVTGVGCSLGALI
THIM_DESAH      D-------------------------------------------RRMILDNGTPLMNSVTGTGCILSALT
THIM_COREF      ----------------------------------------------------------------------
THIM_CLOK5      D---------------------------------------------------------------------
THIM_CLOK1      D---------------------------------------------------------------------
THIM_PECCP      -------XXXXXXXXXXXXXXXXXXQVGTIVAVTGAVDYVTDGERDIAITGGDSMMTRVVGTGCALSAVV
THIM_LACRJ      D---------------------------------------------------------------------
THIM_LACRD      D---------------------------------------------------------------------
THIME_SYMTH     ----------------------------------------------------------------------
THIM_CLOPS      DSFE-DSLSENT----KNKIKEYAKERNLIVVVSGVVDFITNGEESASVKNGTYKMSKITGTGCMLGALL
THIM_CITK8      D-------TTDTXXXXXXXXXXXXRQTGAVVAVTGEVDYVTDGQRTVSVTGGDVLMTRVVGTG-XXXXXX
THIM_FINM2      D---------------------------------------------------------------------
THIM_PROAC      EA--GDAV-EDAL----ASATQLVRHYGCVVAISGPVDHILDADRHVTVSSGHEWMTRVTGVGCSLGALT
THIM_CORGB      D-------ATDSVXXXXXXXXXXXKRTGGVVAVSGAEDLIVSADRVTWLRSGDPMLQLVIGTGCSXXXXX
THIM_ROSDO      D-------SGDSVDXXXXXXXXXXXXFGTVVAITGPVDYLTDGTREAQVSGGSSLMPQVTALGCSQTALM
THIM_KLEP3      SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVDYVTDGERVLSVAGGNPLMTRVVGTGC-XXXXX
THIM_CORGL      ----------------------------------------------------------------------
THIM_KLEP7      SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVDYVTDGERVLSVAGGNPLMTRVVGTGC-XXXXX
THIM_ECO5E      D-------TTDAAVNAIPAAQTLARETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECO57      D-------TTDAAVNAIPAAQTLARETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM_CLAM3      ------XXXXXXXXXXXXXXXXXXRTFGTVVAISGPVDHITDGHRVVRVHTGDALLTKVTGGGCALGAVM
THIM2_STRZJ     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRP4     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRP7     DASAKDQETEDLL---------------------------------------------------------
THIM_ECO81      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRIVGIHGGNPLMTKVVGTG-XXXXXX
THIM2_STRZT     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRZP     DASAKDQETEDLL---------------------------------------------------------
THIM_ENT38      D-------TTDTXXXXXXXXXXXXRQTHAIVAVTGEVDYVTDGQRTQTITGGDVMMTRVVGTG-XXXXXX
THIM_PSYIN      D-------SLDSSEAALGAARYLRDTYQCAVVISGATDFIVTAGGQIQLNNGHAMMPYVTAMGCTLSALT
THIM2_STRPS     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRPJ     DASAKDQETEDLL---------------------------------------------------------
THIM_ENTFA      DGSPLDQSEE------------------------------------------------------------
THIM_ECOSE      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECOL5      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGRRTVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECO8A      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECO7I      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRIVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECO55      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM_SHISS      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRAVGIHGGDPLMTKVVGTG-XXXXXX
THIM2_STRR6     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRPN     DASAKDQETEDLL---------------------------------------------------------
THIM2_STRP2     DASAKDQETEDLL---------------------------------------------------------
THIM_SHIB3      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRIVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECOSM      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRIVGIHGGDPLMTKVVGTG-XXXXXX
THIM_ECOUT      D---------------------------------------------------------------------
THIM_ECOL6      D---------------------------------------------------------------------
THIM_ECOK1      D---------------------------------------------------------------------
THIM_ECO45      D---------------------------------------------------------------------
THIM2_STRPI     DASAKDQETEDLL---------------------------------------------------------
THIM_SHIBS      D---------------------------------------------------------------------
THIM1_LEUMM     DATKGDVI--------------------------------------------------------------
THIM_ENTS8      D---------------------------------------------------------------------
THIM_STAAR      D--------SDANLDXXXXXXXXXXXXXXXXXXXGKEDVIVQGDKAIVLANGSPLLARVTXXXXXXXXXX
THIM_SHIDS      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGVMDYVTDGRRTVGIHGGDPLMAKVVGTG-XXXXXX
THIM_ECOLI      D---------------------------------------------------------------------
THIM_ECOLC      D---------------------------------------------------------------------
THIM_ECOHS      D---------------------------------------------------------------------
THIM_ECODH      D---------------------------------------------------------------------
THIM_ECOBW      D---------------------------------------------------------------------
THIM_ECO24      D---------------------------------------------------------------------
THIM_CARHZ      DSQTSDFAAEN--------LTEVAKRYKTVVVATGPVDYVIAEGELYLNRTGDIMLQKVTGTGCALTSLI
THIM_RHOS5      ------XXXXXXXXXXXXXXXXXXEGSGAVVAVTGPVDFVTDGRRGIRCGNGHALMPKVTALGCSLTGIV
THIM_LACLM      DALESNIDNE-------HARLAAKKTGTVIIETGKVDIISNGHEEMY-VDTDSPLFKINVGCGDMLTAVV
THIM_ECO27      D-------XXXXXXXXXXXXXXXXRETGAIVVVTGEVDYVTDGHRIVGIHGGDPLMTKVVGTG-XXXXXX
THIM_LACCB      D---------------------------------------------------------------------
THIM_LACC3      D---------------------------------------------------------------------
THIM_LACLS      DALESNIDNE-------HARLAAKKTGAVIIETGKVDIISKGHEEMY-VDTDSPLFKINVGCGDMLTAVV
THIM_STAHJ      --------------------------------------------------NGSPLLAKITGAGCLLGGIV
THIM_STAAB      D--------SDAYLDXXXXXXXXXXXXXXXXXXXGKEDVIVQGDKAIVLANGSPLLARVT----------
THIM_ECOLU      D---------------------------------------------------------------------
THIM_HERA2      DV--GHAWHDPRLVAGQLARRYGCVVGLTGVIDVVSDGMNW-----IQLEHGHQWLSQITGAGCIVTSLI
THIM_SHIFL      D---------------------------------------------------------------------
THIM_SHIF8      D---------------------------------------------------------------------
THIM_GEMAT      D-------XXXXXXXXXXXXXXXXREYGSVVAVTGAVDLVTDGTRVAMVSGGSPWMPQVTALGCSLTCLM
THIM_BIFA0      DEHNGPAGVEXXXXXXXXXXXXHSPTHTGAVAVSGEVDLVTDGRLVYRLPGGSAMMTKITGAGCSLGGVT
THIM_RHOS4      ------XXXXXXXXXXXXXXXXXXESSGAVVAVTGPVDFVTDGRRGIRCANGHPLMPRVTALGCSLTGIV
THIM_RHOE4      ------------------------------------------------------LLPRVTSTGCSLGGLV
THIM_ACIAD      D----STLKSDEMFQLAHNLLTKTSCVAISGETDYILSNAMTC--IVKVRGGSHLQPKITATGCALGTLI
THIM_RHOSK      ------XXXXXXXXXXXXXXXXXXESSGAVVAVTGPVDFVTDGRRGIRCANGHPLMPRVTALGCSLTGIV
THIM_RHOS1      ------XXXXXXXXXXXXXXXXXXESSGAVVAVTGPVDFVTDGRRGIRCANGHPLMPRVTALGCSLTGIV
THI6_YEAST      DSSSGKTNIDTLVRATQIVAFQYRTVAVCTGEFDCVADGTFGGE--YKLSSGTPIMGDITASGCSLGSTI
THIM_AGRT5      ETGPVDHLRD--------------------------------RTRNVSIVNGHPWMAKVTGTGCLSGGVI
THIM2_LEUMM     DGASSD----------------------------------------------------------------
THIM_LACLA      DALESNLEVE------------------------------------------------------------
THIM_DICNV      NVMSSSEAIE--------AAVKLAIHQRAVVVVTGEIDYVTDGETILAVRGGHPFLGRVCGTGCVLSAMI
THIM_ESCF3      D---------------------------------------------------------------------
THIM_LARHH      D-------SLDDSXXXXXXXXXXXXXXXXXXXXXXXXXFITDGERVIALAGGHPLLQQVTGTGCSLSALV
THIM_LEUCK      D---------------------------------------------------------------------
THIM_GRABC      XXXXXSTAALE-------AASILARRTGGAVAVTGATDYVTDGTRLIGIANGHPMMTRVTGLGCTATALI
THIM_BIFAA      -------------------------------------------ERTFRLPGGSAMMTKITGAGCSLGGVT
THIM_BIFLO      -------------------------------------------ETVYRLPGGSAMMTKIIGAGCSLGGVA
THIM_DESMR      D-------SQHXXXXXXXXXXXXXRSLGCTVCVSGEVDVVTDGERVVELAGGHAMMTRVTGLGCTATAFV
THIM_BIFLI      -------------------------------------------ETVYRLPGGSAMMTKITGAGCSLGGVA
THIM_BIFLD      -------------------------------------------ETVYRLPGGSAMMTKITGAGCSLGGVA
THIM_KINRD      D-------STXXXXXXXXXXXXLSRRTXXXXXXXXXXXXXXXXXRTLRVSGGHVLLTRTTGAGCSLGALV
THIM_BURTA      D---------------------------------------------------------------------
THIM_BURPS      D---------------------------------------------------------------------
THIM_BURP6      D---------------------------------------------------------------------
THIM_BURP1      D---------------------------------------------------------------------
THIM_BURP0      D---------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAFATANPXXXXXXXXXXXXGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELA
THIM_CLOAB      AAYISANVDSPLEATLASVCAMGICGELAYNRLSKRDGNSSYRNYIIDEVFNLDGDKLDDAARYE---
THIM_ALKOO      GACCGTGKGILQGAILGTMI-MGIAGEKANERLKVHEGLGSFKVYLMDAVSNFDQDDIRKRGKVDEI-
THIM_CLOTE      ASYCGAE-ENYLQATLSGVVSMGIAGEIAYEKTKNL-GPSSFRTALIDSIYNLEESSFNERGKV----
THIM_CLOB8      GAFCGAGSDYFXXXXXXXXXXXXXXXXALD--KAGKIGTGSFHIAIIDAISNL---------------
THIM_CLOCE      GSFCGAVKDYFKAAVAGVTV-MGISGEIAY-EAAGHKGTGSYHIAIIDAISRMDENIFGEKARINEI-
THIM_METS3      SCIGATNPLEGTMVAALL---MTIAGEKARSKVDSENGTGSFRAYLIDYLYKLDGQTLINKSNIEIL-
THIM_DESDA      GCCLGVAPYEMPQACLCAVSALGVAGEIAAETM-----------------------------------
THIM2_METST     GSFAITSP---LEAAIIGSLSMAISGELARRKMENNEGSGSFRTYLIDMMYNMNDETI----------
THIM_DESPS      GAFAAVDRDYLRXXXXXXXXXXXMAGKAA-------TGPGSFMIHLLDALYNMSPEQLEKGCRIKE--
THIM_UNCMA      XXXXXXXXKDYVTSTAAALASFGVAGEKAAKRC---EGPASFKIALLDEIYRLTADEVAHNIKV----
THIM_LEPBP      GAFAAVQKDQFRAATSAMAV-MGIAGEMAKSKTA---SPGSFQVAFLDALYELNADTIK---------
THIM_LEPBA      GAFAAVQKDQFRAATSAMAV-MGIAGEMAKSKTA---SPGSFQVAFLDALYELNADTIK---------
THIM1_METST     GAYAVTNPLEAAITGTLV---MGIAGELAKTARDNNKGTGSFGIYLIDELSKLNKSTILSQSKLNKM-
THIM_CLOBB      GAFAGAS-NDYFIAAICAILTMGISGEIAYEKSKGI-GMGTFHTSLIDAISMMNENIIKEKAKV----
THIM_METHJ      GSCA-AVTQDYLSASATGVSAFGIAGERAAVDAA---GPGSFKCRLFDSMASVRSDDVDRYGRIRSV-
THIM_GEOTN      GAFAAVEQDAVKAAVAALTY-YGV-XXXXXXXXXGQRGPGSFQVAFLDALARIGVDDVKREGRVEQ--
THIM_THETN      ASFC-AVAEDYFDGTLEAFVAFGIAGEKA-AQNPKVEGPGSFKVAFFDEIYNLSPGVLASERKID---
THIM_CLOBA      GAFAGASDDYFIAAICAVLT-MSISGEIAYEKSKGI-GMGTFHISLIDAISMMNENVIKEKARV----
THIM_GEOSW      GAF-XXXXXXXXXXXXXXXXXXXXXXEIA-AKNAGDEGPGSFQIAFLDALSRVGADEISRYGRIEQ--
THIM_METMA      GSFASVNPDYCDAAKDALCY-FGAAGELAAKNSA---GPGSFKVNLYDEVFNLSDEKVQAMMKVEEL-
THIM_THEP3      ASFCGV-CEDYFAATVEAFVAFGIAGERA-AQSSNVKGPGSFKVTFFDEIYNLTPEIIEKDKKVE---
THIM_ALKMQ      ATCLAVTDQALLAALAGVLI-MDLAGEGAYASLKAHESIGTFKVRIFDHIHQLTEQTILEGGSLD---
THIM_THEPX      ASFCGV-CEDYFETTIEAFVAFGIAGERA-AQSSNVKGPGSFKVTFFDEIYNLTPEIIEKDKKVE---
THIM_BREBN      GAFAAIAKDKLI---------AGAAALVCYGVXXXXXGPGSFQIEFLNALHNLTAEDVRRLGYIEK--
THIM_METM6      GAFSAVD-----EPIKAAVSGLTVYGISAEMAFGEAPYPGTFQAKVYDWLYRIDEELVLEKAKVNK--
THIM_METLZ      XXXXXXXXXDSMDGCITAMAALGIAGEEAAKTA---KGPGSFKPAFFDAVTSLTNEQFIKSARISE--
THIM_METM5      GAFSAVD-----EPLKAAVSGLTVYGISAEMAFSEAPYPGTFQAKVYDWLYRIDEKLVFEKAKVNK--
THIM_PASMU      GAFAVAKPEQYFDAMLEACTAYAIAGELAAQGLKTTQ-HGQFYVGLLDQLAHLSPETINQYARI----
THIM_ANOFW      GAFAGVG----EDVMTSSVAALAYYGVXXXXXXXXXXXPGSFQLSFLNALHETSAEEVDQYARIQ---
THIM_GEOKA      G--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGERGPGSFQTAFLDALAYTSVDDVKRHGRVEQ--
THIM_NATTJ      SAFIGAS-DNDWEAGIAATVSMGVVGEMAEESISSSTDLGSFRVKIFDHMAALTSKELQERGNVSEL-
THIM_SYNFM      AAFCAVHPDPLVAATAGLSV-LGIAGELA---ARDNPGPGTFHHLLLDALDAMETRNIEEKGRI----
THIM_METM7      GAFSAVD-----EPLKAAVSGLTVYGISAEMAFAEAPYPGTFQAKVYDWLYRIDEKLVLEKAKVNK--
THIM_BACWK      GAFVAVEKDYVKAAVAALTF-YGVAAEIAASKT-VENGPGSFQIEFLNQLANTTSDDIEKYGKIE---
THIM_HAES1      SAFAVAEQKDYFDALVEGCSAYAIAGEIAAQSLSSTQ-FGQFTLGLLDQLASLTPEQINQYARI----
THIM_BACC4      GAFVAVEKDYVKAAVAALTF-YGVASELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIEEL-
THIM_METAC      GLFAAVNRDYCDAAKDALCY-FGASGELAAAKS---SGPGSFKVHLYDEVFNLSDEKVKSMKNFEE--
THIM_METMP      GAFSAVD-----DPLKAAVSGLVVYGISAEMAFTEAPYPGTFQAKVYDWLYRIDEKLVLEKAKVNK--
THIM_BACSU      GAFCAVNP---LFAAIAAISSYGVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-
THIM_BACCR      GAFVAVEKDYVKAAVAALTF-YGVASELAAAKT-VEKGPGSFQIEFLNQLANTTSSDIEKYGKIEEL-
THIM_BACCN      GAFVAVEQDYVKAAVAALTF-YGVAAEIAASKTVD-QGPGSFQVEFLNQLANVTVSDIEQYGKAEEV-
THIM_EXIS2      ATFLGAG-YGRFDAAVFGTYAMGKAGETA----GNRPGIGSFRTGLFDAVSLMTEESL----------
THIM_DESHD      AGFCGAYEDAFGATVAALLT-MSLAGELAQETSGG-ELPGTFRAHLIDQLSLVDEALIEKRGRVQWL-
THIM_DESHY      AGFCGAYEDAFGATVAALLT-MSLAGELAQETSGG-ELPGTFRAHLIDQLSLVDEALIEKRGRVQWL-
THIM_BACC2      GAFVAVEKDYVKAVVAALTF-YGVAAELAAVKT-VEKGPGSFQIEFLNQLANTTSADIEKYGKIEEL-
THIM_DESOH      SCFCAVEPDLLVASXXXXXXXXXXXXXXXRIS----NGPGSFQAALLDTLYNLPEKIIQEKLRIREV-
THIM_METBF      GLFAAVNPDYFEASREALCY-FGVAGELAARES---NGPGSFKVNLYDEVFNLSDEKVRSMMNFEE--
THIM_CALMQ      ASFMAIN----RDFVKASVEGLVXXXXXXXXXXXXXXXPGTFKQYLIDELFNLTGDDYVKMAKVE---
THIM_LISMH      GSF-IAVQDDAFRASVEACASYAVASEYAELEL-ERKLPGSFRPLFLDALASWSVEKTHAKAKIQE--
THIM_BACLD      GAFCAVEKDVCRAAVSAAAF-YGTAAELAAAKTES-RGPGSFQIEFLNQLAAVEAMDIKERGRIREV-
THIM_PHOPR      GAFAAIGEPTGLAATAV----LGIAGEIAARDAA---GPGSLQVNLLDTLYHLDEAVLREYIRI----
THIM_MOOTA      AAFRAVEEDGVXXXXXXXXXXXXXXXXXXXVS----QGPASFQVALLDTLYNLAGEELARGVKIRLL-
THIM_HAEIG      AAFLAVSEGNYFSATLEACVAYTIAGECA--AQGLTTQVGQFQIRLLDELAALSPETIGQRGRINE--
THIM_LISMO      GSF-IAVQDDAFRASVEACASYAVASEYAEMEL-ERKLPGSFRPLFLDALASWSVEKTRAKAKIQE--
THIM_HAEIE      AAFLAVSEGNYFSATLEACVAYTIAGERAAQSL--TTQVGQFQIRLLDELAALSPETIRQRGRINE--
THIM_LISIN      GSF-IAVQDDAFRASVEACASYAVASEYAEIEL-ERKLPGSFRPLFLDALASWSVEKTRAKAKIQE--
THIM_HAEIN      AAFLAVSEGNYFSATLEACVAYTIAGECA--AQGLTTQVGQFQIRLLDELAALSPETIGQRGRINE--
THIM1_CLOBM     ASYISSGNILEGTALAIAI--MGICGELSQ----NVKGTGSFRNELIDNMF-----------------
THIM_CAMLR      GVFAGV-IEDKFQASLQAMLSFDIACEMAEEIS---NGSGSFRVNLIDALSNLNDEDVKKRAKYE---
THIM_BRAHW      GALAVSNPLXXXXXXXXXXXXXG------EKASKKSEGPASFAVAFIDELYKLDIN--DAANRVKE--
THIM2_CLOBL     ASYISSGNILEGTALAIVL--MGICGELSQ----HVKGTGSFRNEL----------------------
THIM_METVS      GAFLAVE-----EPLKASVSGLVTYGISAEMAFEESFYPGTFQAKLYDWLYRIDEKLILEKAKVNRI-
THIM_ARCFU      ASFMAVQKDFLLASLEGLAC-YNVAGELAAEKS---SGTASFRSNLIDEISKITAE------------
THIM2_CLOBH     ASYISSENILDGTVLAVAL--MGICGELSQHA----KGTGSFRNELTDNMF-----------------
THIM2_CLOB1     ASYISSENILDGTVLAVAL--MGICGELSQHA----KGTGSFRNELTDNMF-----------------
THIM_HAEI8      AAFLAVSEGNYFSATLEACVAYTIAGECA--AQGLTTQVGQFQIRLLDELAALSPETIGQRGRINE--
THIM2_CLOB6     ASYISSGNILEGTALAIVL--MGICGELSQ----HVKGTGSFRNEL----------------------
THIM_LISMC      GSF-MAVQDDAFRASVEACASYAVASEYAEIEL-ERKLPGSFRPQFLDALASWSVEKTRAKAKIQE--
THIM_LISMF      GSF-MAVQDDAFRASVEACASYAVASEYAEIEL-ERKLPGSFRPQFLDALASWSVEKTRAKAKIQE--
THIM_HELPS      ASFLSLRKDPLDSMAQLCALYKQAAFN-AQKKVSENNGNGSFLFYFLDAL------------------
THIM2_CLOBJ     ASYISSGNILEGTALAIVL--MGICGELSQ----HVKGTGSFRNEL----------------------
THIM_ACTSZ      AAFLGVSPPQDYFSACTEACTVAVAGELAQGLSNEY---GSFAMNFINQLGAIHETRLADKARV----
THIM2_CLOBK     ASYISSGNILEGTALAIVL--MGICGELSQ----HVKGTGSFRNEL----------------------
THIM_HELPJ      ASFLSLKKDPLDSMVQLCAFYKQAAFSAQKKALENNGSNGSFLFYFLDAL------------------
THIM_DESVM      --------------------------------------------------------------------
THIM_HELPG      ASFLGLKKDPLDSMVQLCALYKQAAFSAQKKVLENNGSNGSFLFYFLDAL------------------
THIM_DESDG      XXXXXXXGSVLDXXXXXXXXXXXXXXXXSRKA----KGPGSFQMHFIDALYGMQSFDVEAGVEI----
THIM_BACP2      GAFCAAGERPLHASAAALLFYGVAAEKAAQYTQN--KGPGTFQMELLNALSHTTGDVLTLG-------
THIM_LEPCP      GAFAAVQP------------------------------------------------------------
THIM_EXISA      GA-CLAVEKNALKATVTAMSGYAYCGELASERA---EGPGDFPIHFLNALHQL---------------
THIM_DESAP      --------------------------------------------------------------------
THIM_CLOD6      ASFMAVTENILEAATMGVLT-MSLSGELANLNNPPI---GTFKENLMNAIYQMDIDALSKNSNIEFL-
THIM_HELPY      ASFLSLKKDPLDSMAQLCALYKQAAFNAQKKVLENNGSNGSFLFYFLDAL------------------
THIM_BACSK      AAYAAVQPNSLVDAAVEALAFYGVCAEQAY-EQTKKEGIGSFQQTFLNELGNMTDEKAAALKRVEQI-
THIM_METB6      GVIA----------------------------------------------------------------
THIM_PYRFU      GAFVAVN-------------------------------------------------------------
THIM_LACBA      AAFCAVTPDTFEAAQTACLVFAAIGQRVVQTVPD--VGAGSFTVHLLDALQSTTVAQIEAVAAYE---
THIM_LYSSC      GA------------------------------------------------------------------
THIM_AGRRK      GAFAATRPDHPLDXXXXXXXXXXXXXXXXXXQV---DGPGSFSWRFLDALAALDEKAIDSEARVISL-
THIM_BACCZ      GAFVAVEKDYAKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSSDIEKYGKIE---
THIM_BACCQ      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGEIE---
THIM_BACC7      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGEIE---
THIM_DESAA      ----------------------GLAAEIAAPQA---KGPASFKVAFYDALYNLNAEQIEKGGRVREVS
THIM_SYNAS      GAFAAVNSSFTLXXXXXXXXXXXMAAEIS-------PGPGSLQLHFLDILYRLTEEDIARRLRI----
THIM_HELPH      ASFLGLKKDPLDSMAQLCALYKQASFNAQKKALENNGSNGSFLFYFLDAL------------------
THIM_CHLSY      --------------------------------------------------------------------
THIM_CHLAA      --------------------------------------------------------------------
THIM_CHLT3      XXXXXINPSMMEXXXXXXXXXXXXXXXXXK----NVAGPGSLQVNFLDTLYSL---------------
THIM_BACC3      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACC0      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACAN      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACAH      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACAC      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACAA      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_STAS1      ASFLPTDETTSISQLVEATSIYNIAAEKAE-QLAEDKGPGTFMTLLLDALYQVTYDDYSNQSDIQEV-
THIM_PYRAB      GAFVAVTEPLRAAISSLVVFGI-----XXXXXXXXXXXPGSFHVKLYDWLYRIDGEVIRKYAKVREV-
THIM_LISW6      GSF-IAVQDDVFRASVEACVSYAVASEYAEMEL-ERKLPGSFRPLFLDALASWSVEKTRAKAKILE--
THIM_BACHK      GAFVAVEKDYVKAAVAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_BACC1      GAFVAVEKDYVKAAIAALTF-YGVAAELAAAKT-VEKGPGSFQIEFLNQLANTTSGDIEKYGKIE---
THIM_PYRHO      GAFVAVTEPLKATTSALVTFGI-----XXXXXXXXXXXPGSFHVKLYDWLYRINENVIRTYAKVREV-
THIM_VIBPA      GAFAAIGDETXXXXXXXXXXXXXXXXXQAR-------GPGSLQMHLLDELYQLDEETLATRLKLQ---
THIM1_STRPS     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRPJ     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRZT     ASFIGLEKGQELKSLETAMLVYNIAGEIAEKRPNGH-LPGTFKAEFINALYEITDEDVKEFKRVK---
THIM1_STRPN     ASFIGLEKGQELKSLKTAVLVYNIAGEIAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRZP     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKKFKRVK---
THIM1_STRR6     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRP7     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRP4     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM1_STRP2     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM_CHLFF      AAFRSVIEDSFEATRLGVEY-FSLCGMLARERC---EGPGLFKAYFLDELYAADFDRM----------
THIM_VIBSL      GAFAAVGDESXXXXXXXXXXXXEISAESSR-------GPGSLQMNLLDELYQLDEETLIQRLKVQ---
THIM_RUBXD      GCFAAA--------------------------------------------------------------
THIM1_STRPI     ASFIGLEKGQELKSLETAMLVYNIAGEIAEKHPNGH-LPGTFKVEFINALYEITDEDVKEFKRVK---
THIM_STRSY      AAFILADEDSLLDCLEEVLSAYSIAGEMAEQKT---SLPGTFQIEFINSLYAIQSEEVEENKKV----
THIM_ROSS1      --------------------------------------------------------------------
THIM_CHLCV      AAFRSVIDDSFEAARLGVEY-FSLCGMLARERC---EGPGLFKAYFLDELYAADFDRM----------
THIM1_STRZJ     ASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGH-LPGTFKVEFINSLYEITDEDVKEFKRVK---
THIM_LACPL      AAFTAVSPTDVYQAAQVACLVLAGAGELVASQLTA-DRPATFAIDLIDRLSLVTVSEIQTIAKVD---
THIM_VIBHB      GAFXXXXXXXXXXXXXXXXXXXXXXXXQAR-------GPGSLQMNLLDELYQLDEETL----------
THIM_YERE8      AAFCALEGDRLHHVATACRIMSQVGGQVSQ----HVAGPGSFVPAFLDGLYQLE--------------
THIM_HAEPS      GAFLAVAPRELAFQAACEACTVAIAGELAAVGLQATQ-SGTFAVRLLDALAAIDATQTEQLMKAE---
THIM_RHIEC      GAFAATAP------------------------------------------------------------
THIM_CLONN      AATAGVE-DDKFIATITSILSMNIAAEHTEKEV---IGPGSFKVKLIDNIYLLKENHLRKEGKIK---
THIM_STRS2      AAF-----------------------------------------------------------------
THIM_STRA1      AAFGSSDRSDDLACLTEAMTVYNVAGEIAE-KVAKGKGVGSFQVAFLDALSQMKSEMI----------
THIM_ROSCS      --------------------------------------------------------------------
THIM_PSYWF      AGFVGAN---KKAMAQAAVTALCYYGQAAEHAMQIAQGPGSFYIHFLDSLYALQATDVSQQARV----
THIM_RHOFD      GAFCAVQP------------------------------------------------------------
THIM_RHIE6      GAFAATAP------------------------------------------------------------
THIM_STRA3      AAFGSSDRSDDLACLTEAMTVYNVSGEIAE-KVAKGKGVGSFQVAFLDALSQMKSEMI----------
THIM_BACA2      GAFCAA--------------------------------------------------------------
THIM_SERP5      AAFCSL-PGDRLDNVATACRVMSHCGEMATRRAA---GPGSFTPAFLDALYQLRPEDLQ---------
THIM_DESVV      --------------------------------------------------------------------
THIM_DESVH      --------------------------------------------------------------------
THIM_STRA5      AAFGSSDRSDDLACLTEAMTVYNVAGEIAE-KVAKGKGVGSFQVAFLDALSQMKSEMI----------
THIM_COPPD      AACLSVT--EXXXXXXXXXXXXXXXXQIAAEQS---DGPGTFRIRMFDVMYQI---------------
THIM_HALWD      AAF-----------------------------------------------------------------
THIM_BACHD      AAFASLKTDDFLEVIGYGLVAYGV-XXXXXXXXXXXXGYGSFQTAFLNQLGRLTDEDVKQHGRFE---
THIM_RHILW      GAFAATAP---EDXXXXXXXXXXXXXXXXXXXXXXXXXXXSFAWRFLDALHALDAETLDARARI----
THIM_METPE      GAFAAGSRDQVCSTXXXXXXXXXXXXXXXXRAF----GPSSFKVALMDEVAALTPPVLSAGAKIRIL-
THIM_SALTI      XXXXXXXPGAALDNVASACCWMKLAGQVAAERS---EGPGSFIPAFLDALYHLDMEAANA--------
THIM_SALAR      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_CLOP1      ALSFYDHKDLRFKEVVKAVSTWGICGELAEERLREKEGLMTFKHNLLDELSIINDETIKEREKV----
THIM1_OCEIH     AACLTTKSTLKDQLMTAVSF-YGLSASYAANQENVH-GTGSFLPVFIDSLSKMPQELTE---------
THIM_CLOPE      ALSFYDHKDLRFKEVVKAVSTWGICGELAEERLREKEGLMTFKHNLLDELSIINDETIKEREKV----
THIM_CHLAB      AAFRSVIDDSFEATKLGIEY-FTLCGMLARERC---EGPGLFKAYLLDELYASD--------------
THIM2_OCEIH     GPFVSV-VDDFYQAGIYAVTSYGIAAELA---MEKASGPGTFIPALLDEIYFLTDEKVEKYKQVHEL-
THIM_SALTY      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALNS      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALG2      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALEP      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALDC      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_LACSS      AAFVAVSPDNPYQXXXXXXXXXXXXGQLVAEAM-PTPLPGSFYPQLLDCLFNITAADVQTHAQVTEV-
THIM_STAEQ      ASFLFRNTQPSIDLLVEAVSVYNIAAEFAE-QAPHVNGPGTFLSELLDQLYQMN--------------
THIM_STACT      XXFLFRNTHPSIETLIEAVSVYNIAAERAE-QLSDSKGPGTFLTQFIDALYRIDSDAVAENCNLEEV-
THIM_METMJ      --------------------------------------------------------------------
THIM_AKKM8      AACAAVSPTPLQAAVSTAVL-MGIAGEMAFEQS---PSPGSFAVSLLDSLYALSPEDVVRRAR-----
THIM2_CLOBM     --------------------------------------------------------------------
THIM1_CLOBK     --------------------------------------------------------------------
THIM1_CLOBJ     --------------------------------------------------------------------
THIM1_CLOBH     --------------------------------------------------------------------
THIM1_CLOB6     --------------------------------------------------------------------
THIM1_CLOB1     --------------------------------------------------------------------
THIM_SALSV      XXXXXXXPGAALDNVASACCWMKLAGQTAAERS---EGPGSFIPAFLDALYHLDVEA-----------
THIM_SALHS      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALPK      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_SALPA      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_CHLAD      AAFAVERDYXXXXXXXXXXXXXXXXXXXPQAR-----GPASFKVAFYDAIYHLAADQIRAGARVVDLS
THIM_SALPC      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEA-----------
THIM_SALCH      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEA-----------
THIM_ACIBY      AAYSAVTTPTIAALSAHIH--FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDANLIEQYADVKLL-
THIM_ACIBC      AAYAVATPTIAALSAHVH---FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDDNLIEQYADIKLL-
THIM_ACIB5      AAYSAVTTPTIAALSAHIH--FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDANLIEQYADVKLL-
THIM_ACIB3      AAYSAVTTPTIAALSAHIH--FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDANLIEQYADVKLL-
THIM_SALA4      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_NATPD      ATFAAGMENATPLDAALAGTVXXXXXXXXXXXXXXYNGPASYKTAFLDTVAGLEAAPDDPAGRIERV-
THIM_ACIBT      AAYSAVTTPTIAALSAHIH--FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDANLIEQYADIKLL-
THIM_ACIBS      AAYSAVTTPTIAALSAHIH--FAIAGKLAANQA---QTMGSFSSIFMDYIHMLDANLIEQYADIKLL-
THIM_SALPB      XXXXXXXPGAALDNVASACCWMKLAGQAAAERS---EGPGSFIPAFLDALYHLDVEAANA--------
THIM_STAES      ASFLFRNTQPSIDLLVEAVSVYNIAAEFAE-QAPHVNGPSTFLSELLDQLYQMN--------------
THIM1_CLOBL     --------------------------------------------------------------------
THIM_TOLAT      AAF-----------------------------------------------------------------
THIM_ERWCT      AGFCSLEGDRLSHVTAACYV-MALAGQQATSVS---QGTGSFIPHFLDRLYTLRAEDL----------
THIM_STAAW      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAAS      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_MACCJ      ASFTKPSXXXXXXXXXXXXXXXXXXXHSANGTLPGH-----FAVNLIDQLYLIQQDDIAKESRVKEV-
THIM_ALISL      GAFAAIGDHSXXXXXXXXXXXXEIAAEQSA-------GPGSLQINLLDTLYQLDEETL----------
THIM_STAAE      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAAC      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAA8      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAA3      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_PEDPA      GAF-SAVAENTLDAAVTASLVLSCAGERAAAQLDQQNRPGSFLSYLLDELANITPEQVQDLMKIGE--
THIM_VIBF1      GAFAAIGDESXXXXXXXXXXXXEIAAEQSA-------GPGSLQMNLLDTLYQLDEETL----------
THIM_RHIL3      GAFAATAP------------------------------------------------------------
THIM_LACF3      --------------------------------------------------------------------
THIM_VIBFM      GAFAAIGDESXXXXXXXXXXXXEIAAEQSA-------GPGSLQMNLLDTLYQLDEETL----------
THIM_STAAN      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAAM      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAA9      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAA2      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_STAA1      AGFRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_LEPIN      ASF-----------------------------------------------------------------
THIM_LEPIC      ASF-----------------------------------------------------------------
THI4_SCHPO      GVTAS---------------------------------------------------------------
THIM_CLAMS      TAFASTDP-DPLRAAVAATSGYTIAADIA---AEGARGPGSFAVGLLDAL------------------
THIM_DESRM      GAFMSVT----EDKCLGVLSALAFYGAAAQKAALISQGPGTFAGNFLDALYGLEFD------------
THIM_SYNWW      XXXXXXXPEEAWLASITGLLAFNLAGERAASQAG--NRPGTFRTLLFDELFVLRGEELMKEGRLE---
THIM_LEPBL      ASF-----------------------------------------------------------------
THIM_LEPBJ      ASF-----------------------------------------------------------------
THIM_DESAH      AAFYAVT----DNGFDXXXXXXXXXXXXXXXXXXXXXGPGTFMPHFMDALYNMNEKNLAARLKVESTA
THIM_COREF      --------------------------------------------------------------------
THIM_CLOK5      --------------------------------------------------------------------
THIM_CLOK1      --------------------------------------------------------------------
THIM_PECCP      AGFCSLEGDRVSHVAAACYV-MALAGQQAASVS---QGTGSFIPNFLDRLYTLRAEDL----------
THIM_LACRJ      --------------------------------------------------------------------
THIM_LACRD      --------------------------------------------------------------------
THIME_SYMTH     --------------------------------------------------------------------
THIM_CLOPS      ALSFYDHKDLRFKEVVKAVSTWGICGELAEERLREKEGLMTFKYNLLDELSIINDEIIKEREKV----
THIM_CITK8      XXXXXXXPGNTLDNVASACSWMKQAGQSAAERS---QGPGSFIPAFLDALYHLNAE------------
THIM_FINM2      --------------------------------------------------------------------
THIM_PROAC      AAFA----------------------------------------------------------------
THIM_CORGB      XXXXXXXVDSDISXXXXXXXXXXXXXXXXXXXXXXXXXPGSFAVAFIDALYDVDAQAVASLVDVRE--
THIM_ROSDO      GAY--XXXXXXXXXXXXXXXXXXXXGSTAAQRA---DGPGSFQMHFLDALAN----------------
THIM_KLEP3      XXXXXXXPGDRLENVAAACGLMKQAGEIA-ARQG---GPGSFIPAFLDALY-----------------
THIM_CORGL      --------------------------------------------------------------------
THIM_KLEP7      XXXXXXXPGDRLENVAAACGLMKQAGAIA-ARQG---GPGSFIPAFLDALY-----------------
THIM_ECO5E      XXXXXXXPGDMLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECO57      XXXXXXXPGDMLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_CLAM3      AAFASLDP------------------------------------------------------------
THIM2_STRZJ     --------------------------------------------------------------------
THIM2_STRP4     --------------------------------------------------------------------
THIM2_STRP7     --------------------------------------------------------------------
THIM_ECO81      XXXXXXXPGDTLENIASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM2_STRZT     --------------------------------------------------------------------
THIM2_STRZP     --------------------------------------------------------------------
THIM_ENT38      XXXXXXXPGDRLNNVAAACGFMKQAGSVA---VKESRGPGSFASAFIDALWNLEAQA-----------
THIM_PSYIN      GAF-----------------------------------------------------------------
THIM2_STRPS     --------------------------------------------------------------------
THIM2_STRPJ     --------------------------------------------------------------------
THIM_ENTFA      --------------------------------------------------------------------
THIM_ECOSE      XXXXXXXPGDTLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECOL5      XXXXXXXPGDTLENIASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECO8A      XXXXXXXPGDTLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECO7I      XXXXXXXPGDTLENIASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECO55      XXXXXXXPGDTLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_SHISS      XXXXXXXPGDTLENVASACHWMKQAGERAVARS---EGLGSFVPHFLDALWQL---------------
THIM2_STRR6     --------------------------------------------------------------------
THIM2_STRPN     --------------------------------------------------------------------
THIM2_STRP2     --------------------------------------------------------------------
THIM_SHIB3      XXXXXXXPGDMLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECOSM      XXXXXXXPGDTLENIAFACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECOUT      --------------------------------------------------------------------
THIM_ECOL6      --------------------------------------------------------------------
THIM_ECOK1      --------------------------------------------------------------------
THIM_ECO45      --------------------------------------------------------------------
THIM2_STRPI     --------------------------------------------------------------------
THIM_SHIBS      --------------------------------------------------------------------
THIM1_LEUMM     --------------------------------------------------------------------
THIM_ENTS8      --------------------------------------------------------------------
THIM_STAAR      XXXRETEPDIEALIEAVSVFXXXXXXXXXXXXCG---GPGTFSPLLLDTLYHLNETTYQQRIRIQEV-
THIM_SHIDS      XXXXXXXPGDMLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_ECOLI      --------------------------------------------------------------------
THIM_ECOLC      --------------------------------------------------------------------
THIM_ECOHS      --------------------------------------------------------------------
THIM_ECODH      --------------------------------------------------------------------
THIM_ECOBW      --------------------------------------------------------------------
THIM_ECO24      --------------------------------------------------------------------
THIM_CARHZ      GAFVGVIDEPXXXXXXXXXF-YGAASEKARKISA---GPGSFLVNFIDSLYN----------------
THIM_RHOS5      GAFAAGQP-----XXXXXXXXXXXXXXXXXXXXXXXXXPGSFQVAFLDALHAMTPDDLDRGAKLE---
THIM_LACLM      GTFAAVSDDLFTAAYEATKF-FGEAGMIATKQVQNLPGN--FVNSLLDTLY-----------------
THIM_ECO27      XXXXXXXPGDTLENVASACHWMKQAGERAVARS---EGPGSFVPHFLDALWQL---------------
THIM_LACCB      --------------------------------------------------------------------
THIM_LACC3      --------------------------------------------------------------------
THIM_LACLS      GTFAAVSDDLFTAAYEATKF-FGEAGMIATKQVQNLPGN--FVNSLLDTLY-----------------
THIM_STAHJ      ASFLFREENPTLQVLEEAVSIYNIAAEIAE-KDQQVNGPGTFLPKLLDQMYNIDFNTYQQQVKRQEV-
THIM_STAAB      --------------------------------------------------------------------
THIM_ECOLU      --------------------------------------------------------------------
THIM_HERA2      GALA-AVINDVMLATVSAIAGFGMAAEVAAMHA---LGPASFRVALFDQL------------------
THIM_SHIFL      --------------------------------------------------------------------
THIM_SHIF8      --------------------------------------------------------------------
THIM_GEMAT      GAFAAVT-----APLEATVAALTLFAEAGARAHAHSEGPGSFAWRFLDALAAVTPDDLTGTERV----
THIM_BIFA0      ATYXXXXXXXXXXXXXXMLYNVGAAERASH-------GPGSFQTAFLDALWNV---------------
THIM_RHOS4      GAFAATRPPXXXXXXXXXXXXXXXXXXXKTA-----TGPGSFQVAFLDALHTLSPEALDRGARLE---
THIM_RHOE4      AAYLAVTPTALDGLVAAHTH-VAVASEIAEENASG---PGSFAVAYLDALYTVNADTIRSRARIE---
THIM_ACIAD      AAYCAVAP--VXXXXXXXXXXXXXXGKLAYDQA---QTIGSFNTMFMDYIHMMDANLIEQYACIE---
THIM_RHOSK      GAFAAIRPPXXXXXXXXXXXXXXXXXXXKTA-----TGPGSFQVAFLDALHALSPEALDRGARLE---
THIM_RHOS1      GAFAAIRPPXXXXXXXXXXXXXXXXXXXKTA-----TGPGSFQVAFLDALHALSPEALDRGARLE---
THI6_YEAST      ASFGLDSTGKLFDAVVGAVLLYKSAGKLASTRC---QGSGSFHVELIDALYQL---------------
THIM_AGRT5      AAFMAVEKDXXXXXXXXXXXXXXXXELAAQRA----KGPGTFEPAFLDALSEISGEDIINHARIE---
THIM2_LEUMM     --------------------------------------------------------------------
THIM_LACLA      --------------------------------------------------------------------
THIM_DICNV      AS------------------------------------------------------------------
THIM_ESCF3      --------------------------------------------------------------------
THIM_LARHH      AAM-TAMTDDPLSGAAVACALMKLAGERAADKAA---GPGSFAVHLLDEI------------------
THIM_LEUCK      --------------------------------------------------------------------
THIM_GRABC      GAFAAVEPDPLVXXXXXXXXXXXXXXXXXIRA----DGPGSLQVEFLDALYALDSAILRDAAR-----
THIM_BIFAA      ATYXXXXXXXXXXXXXXXXYDR--ASEIAEVKS---DGPGSFQVALLDALWNVTADQVAASDIIE---
THIM_BIFLO      ATYAVSDPLTAALSASLL---YNRAGEVADTTS---HGPGSFQVAFLDALWNVTAE------------
THIM_DESMR      GAFLAVNP------------------------------------------------------------
THIM_BIFLI      ATYAVSDPLTAALSASLL---YNRAAEIADTTS---HGPGSFQVAFLDALWNVTAE------------
THIM_BIFLD      ATYAVSDPLTAALSASLL---YNRAGEVADTTS---HGPGSFQVAFLDALWNVTAE------------
THIM_KINRD      AAY-----------------------------------------------------------------
THIM_BURTA      --------------------------------------------------------------------
THIM_BURPS      --------------------------------------------------------------------
THIM_BURP6      --------------------------------------------------------------------
THIM_BURP1      --------------------------------------------------------------------
THIM_BURP0      --------------------------------------------------------------------