[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56092.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    5::144     2e-40  69%  144 aa  RL11_STRSF RecName: Full=50S ribosomal protein L11;
    5::144     2e-40  68%  144 aa  RL11_STRLA RecName: Full=50S ribosomal protein L11;
    3::141     4e-40  67%  141 aa  RL11_CHLPB RecName: Full=50S ribosomal protein L11;
    3::140     5e-40  57%  141 aa  RL11_CLOB8 RecName: Full=50S ribosomal protein L11;
    5::144     7e-40  67%  144 aa  RL11_STRVG RecName: Full=50S ribosomal protein L11;
    4::142     9e-40  67%  143 aa  RL11_LEIXX RecName: Full=50S ribosomal protein L11;
    4::139     1e-39  66%  142 aa  RL11_NOCSJ RecName: Full=50S ribosomal protein L11;
    3::137     3e-39  57%  141 aa  RL11_CLOPS RecName: Full=50S ribosomal protein L11;
    3::137     3e-39  57%  141 aa  RL11_CLOPE RecName: Full=50S ribosomal protein L11;
    3::137     3e-39  57%  141 aa  RL11_CLOP1 RecName: Full=50S ribosomal protein L11;
    5::144     6e-39  66%  144 aa  RL11_STRVN RecName: Full=50S ribosomal protein L11;
    5::144     6e-39  66%  144 aa  RL11_STRLI RecName: Full=50S ribosomal protein L11;
    5::144     6e-39  66%  144 aa  RL11_STRCO RecName: Full=50S ribosomal protein L11;
    3::140     6e-39  55%  141 aa  RL11_CLOTE RecName: Full=50S ribosomal protein L11;
    5::144     8e-39  65%  144 aa  RL11_STRGR RecName: Full=50S ribosomal protein L11;
    5::144     8e-39  65%  144 aa  RL11_STRGG RecName: Full=50S ribosomal protein L11;
    3::140     8e-39  56%  141 aa  RL11_CLOBB RecName: Full=50S ribosomal protein L11;
    3::140     8e-39  56%  141 aa  RL11_CLOBA RecName: Full=50S ribosomal protein L11;
    4::143     1e-38  64%  143 aa  RL11_MICLC RecName: Full=50S ribosomal protein L11;
    3::139     1e-38  58%  140 aa  RL11_GEOSM RecName: Full=50S ribosomal protein L11;
    3::139     1e-38  58%  140 aa  RL11_GEOBB RecName: Full=50S ribosomal protein L11;
    5::144     2e-38  64%  144 aa  RL11_STRAW RecName: Full=50S ribosomal protein L11;
    3::141     2e-38  65%  141 aa  RL11_PELPB RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOBM RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOBL RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOBK RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOBJ RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOBH RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOB6 RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  55%  141 aa  RL11_CLOB1 RecName: Full=50S ribosomal protein L11;
    3::139     2e-38  55%  141 aa  RL11_TRIEI RecName: Full=50S ribosomal protein L11;
    3::140     2e-38  65%  141 aa  RL11_PROA2 RecName: Full=50S ribosomal protein L11;
    3::139     4e-38  56%  141 aa  RL11_SYNJA RecName: Full=50S ribosomal protein L11;
    3::140     4e-38  56%  141 aa  RL11_GEOTN RecName: Full=50S ribosomal protein L11;
    3::139     4e-38  58%  140 aa  RL11_GEOSF RecName: Full=50S ribosomal protein L11;
    3::140     4e-38  57%  141 aa  RL11_GEOKA RecName: Full=50S ribosomal protein L11;
    3::140     4e-38  58%  141 aa  RL11_CLOD6 RecName: Full=50S ribosomal protein L11;
    3::140     5e-38  55%  141 aa  RL11_EXISA RecName: Full=50S ribosomal protein L11;
    4::141     5e-38  56%  143 aa  RL11_ACIC1 RecName: Full=50S ribosomal protein L11;
    4::141     7e-38  54%  143 aa  RL11_KINRD RecName: Full=50S ribosomal protein L11;
    3::139     7e-38  56%  140 aa  RL11_GEOUR RecName: Full=50S ribosomal protein L11;
    3::140     7e-38  56%  141 aa  RL11_GEOSW RecName: Full=50S ribosomal protein L11;
    3::141     7e-38  65%  141 aa  RL11_CHLT3 RecName: Full=50S ribosomal protein L11;
    3::139     8e-38  55%  141 aa  RL11_SYNJB RecName: Full=50S ribosomal protein L11;
    3::140     8e-38  53%  140 aa  RL11_HALOH RecName: Full=50S ribosomal protein L11;
    3::141     8e-38  65%  141 aa  RL11_CHLTE RecName: Full=50S ribosomal protein L11;
    3::140     1e-37  54%  140 aa  RL11_SYMTH RecName: Full=50S ribosomal protein L11;
   35::142     1e-37  65%  143 aa  RL11_PROAC RecName: Full=50S ribosomal protein L11;
    3::140     1e-37  55%  141 aa  RL11_FINM2 RecName: Full=50S ribosomal protein L11;
    3::140     1e-37  54%  141 aa  RL11_CYAP8 RecName: Full=50S ribosomal protein L11;
    3::140     1e-37  54%  141 aa  RL11_OCEIH RecName: Full=50S ribosomal protein L11;
    3::140     1e-37  55%  141 aa  RL11_BACSK RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  56%  141 aa  RL11A_BACHD RecName: Full=50S ribosomal protein L11-1;
    3::140     2e-37  55%  141 aa  RL11_BACWK RecName: Full=50S ribosomal protein L11;
   25::132     2e-37  66%  133 aa  RL11_BACST RecName: Full=50S ribosomal protein L11;Flags: Fragment;
    3::140     2e-37  55%  141 aa  RL11_BACLD RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACHK RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACCZ RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACCN RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC7 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC4 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC3 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC2 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC1 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACC0 RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACAN RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACAC RecName: Full=50S ribosomal protein L11;
    3::140     2e-37  55%  141 aa  RL11_BACAA RecName: Full=50S ribosomal protein L11;
    3::141     3e-37  54%  141 aa  RL11_CLOK5 RecName: Full=50S ribosomal protein L11;
    3::140     3e-37  55%  141 aa  RL11_BACSU RecName: Full=50S ribosomal protein L11;       
    3::140     3e-37  55%  141 aa  RL11_BACA2 RecName: Full=50S ribosomal protein L11;
    3::140     3e-37  53%  141 aa  RL11_ALKMQ RecName: Full=50S ribosomal protein L11;
    3::139     4e-37  56%  141 aa  RL11_THEEB RecName: Full=50S ribosomal protein L11;
    3::140     4e-37  54%  140 aa  RL11_STACT RecName: Full=50S ribosomal protein L11;
    3::139     4e-37  55%  141 aa  RL11_MICAN RecName: Full=50S ribosomal protein L11;
    3::139     4e-37  55%  141 aa  RL11_GEOSL RecName: Full=50S ribosomal protein L11;
    5::142     4e-37  54%  144 aa  RL11_FRASN RecName: Full=50S ribosomal protein L11;
    3::139     4e-37  53%  141 aa  RL11_CLOAB RecName: Full=50S ribosomal protein L11;
    3::141     4e-37  65%  141 aa  RL11_CHLP8 RecName: Full=50S ribosomal protein L11;
   33::139     6e-37  64%  141 aa  RL11_ACAM1 RecName: Full=50S ribosomal protein L11;
    3::141     7e-37  63%  141 aa  RL11_PELLD RecName: Full=50S ribosomal protein L11;
    3::140     7e-37  54%  141 aa  RL11_BREBN RecName: Full=50S ribosomal protein L11;
    3::140     7e-37  54%  141 aa  RL11A_BACCR RecName: Full=50S ribosomal protein L11-1;
    4::143     9e-37  64%  143 aa  RL11_ARTAT RecName: Full=50S ribosomal protein L11;
    3::139     1e-36  54%  140 aa  RL11_GEOMG RecName: Full=50S ribosomal protein L11;
    3::140     1e-36  54%  141 aa  RL11_EXIS2 RecName: Full=50S ribosomal protein L11;
    3::140     1e-36  51%  141 aa  RL11_CYAP7 RecName: Full=50S ribosomal protein L11;
    3::139     1e-36  53%  141 aa  RL11_CYAP4 RecName: Full=50S ribosomal protein L11;
    3::139     1e-36  53%  141 aa  RL11_ANAVT RecName: Full=50S ribosomal protein L11;
    3::139     1e-36  53%  141 aa  RL11_ANASP RecName: Full=50S ribosomal protein L11;
    3::140     2e-36  52%  141 aa  RL11_CLONN RecName: Full=50S ribosomal protein L11;
    3::139     2e-36  55%  141 aa  RL11_GEOLS RecName: Full=50S ribosomal protein L11;
    3::139     2e-36  53%  141 aa  RL11_CYAA5 RecName: Full=50S ribosomal protein L11;
    3::140     3e-36  54%  141 aa  RL11_LYSSC RecName: Full=50S ribosomal protein L11;
    4::143     3e-36  62%  143 aa  RL11_ARTS2 RecName: Full=50S ribosomal protein L11;
    4::143     3e-36  62%  143 aa  RL11_ARTCA RecName: Full=50S ribosomal protein L11;
    3::139     4e-36  55%  140 aa  RL11_PELPD RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAW RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAT RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAS RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAR RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAN RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAM RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAAB RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAA9 RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAA8 RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAA3 RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAA2 RecName: Full=50S ribosomal protein L11;
    3::140     5e-36  55%  140 aa  RL11_STAA1 RecName: Full=50S ribosomal protein L11;
    1::140     6e-36  63%  141 aa  RL11_TROWT RecName: Full=50S ribosomal protein L11;
    1::140     6e-36  63%  141 aa  RL11_TROW8 RecName: Full=50S ribosomal protein L11;
    3::139     6e-36  53%  141 aa  RL11_THENN RecName: Full=50S ribosomal protein L11;
    3::140     6e-36  64%  141 aa  RL11_PROVI RecName: Full=50S ribosomal protein L11;
    3::139     8e-36  53%  141 aa  RL11_GLOVI RecName: Full=50S ribosomal protein L11;
   33::139     1e-35  61%  141 aa  RL11_SYNP2 RecName: Full=50S ribosomal protein L11;
    3::140     1e-35  53%  140 aa  RL11_STAHJ RecName: Full=50S ribosomal protein L11;
    3::140     1e-35  53%  140 aa  RL11_STAES RecName: Full=50S ribosomal protein L11;
    3::140     1e-35  53%  140 aa  RL11_STAEQ RecName: Full=50S ribosomal protein L11;
    3::139     1e-35  52%  141 aa  RL11_THEAB RecName: Full=50S ribosomal protein L11;
    3::139     1e-35  53%  142 aa  RL11_DICTD RecName: Full=50S ribosomal protein L11;
    3::139     1e-35  53%  142 aa  RL11_DICT6 RecName: Full=50S ribosomal protein L11;
    3::139     1e-35  51%  142 aa  RL11_DESHY RecName: Full=50S ribosomal protein L11;
    3::139     1e-35  51%  142 aa  RL11_DESHD RecName: Full=50S ribosomal protein L11;
    3::140     1e-35  62%  141 aa  RL11_CHLL2 RecName: Full=50S ribosomal protein L11;
    3::142     1e-35  52%  143 aa  RL11_ALHEH RecName: Full=50S ribosomal protein L11;
    3::140     2e-35  54%  140 aa  RL11_STAAC RecName: Full=50S ribosomal protein L11;
    3::141     2e-35  50%  141 aa  RL11_NATTJ RecName: Full=50S ribosomal protein L11;
    3::141     2e-35  52%  141 aa  RL11_LACPL RecName: Full=50S ribosomal protein L11;
    3::140     2e-35  64%  141 aa  RL11_CHLCH RecName: Full=50S ribosomal protein L11;
    3::139     3e-35  54%  140 aa  RL11_PELCD RecName: Full=50S ribosomal protein L11;
    3::139     4e-35  53%  140 aa  RL11_THEPX RecName: Full=50S ribosomal protein L11;
    3::139     4e-35  53%  140 aa  RL11_THEP3 RecName: Full=50S ribosomal protein L11;
    3::140     4e-35  49%  141 aa  RL11_NOSP7 RecName: Full=50S ribosomal protein L11;
    3::140     4e-35  52%  141 aa  RL11_MOOTA RecName: Full=50S ribosomal protein L11;
    3::142     4e-35  52%  143 aa  RL11_CHRSD RecName: Full=50S ribosomal protein L11;
    3::140     4e-35  48%  141 aa  RK11_PORYE RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::140     5e-35  51%  141 aa  RL11_CLOTH RecName: Full=50S ribosomal protein L11;
    3::140     5e-35  61%  141 aa  RL11_CHLPD RecName: Full=50S ribosomal protein L11;
    3::139     7e-35  51%  141 aa  RL11_THESQ RecName: Full=50S ribosomal protein L11;
    3::139     7e-35  51%  141 aa  RL11_THEMA RecName: Full=50S ribosomal protein L11;
    3::141     7e-35  51%  145 aa  RL11_FLAJ1 RecName: Full=50S ribosomal protein L11;
    3::142     9e-35  51%  142 aa  RL11_RUTMC RecName: Full=50S ribosomal protein L11;
    3::140     9e-35  50%  141 aa  RL11_PETMO RecName: Full=50S ribosomal protein L11;
    3::141     9e-35  51%  141 aa  RL11_LACCB RecName: Full=50S ribosomal protein L11;
    3::141     9e-35  51%  141 aa  RL11_LACC3 RecName: Full=50S ribosomal protein L11;
    3::140     9e-35  51%  141 aa  RL11_HERA2 RecName: Full=50S ribosomal protein L11;
   36::142     9e-35  61%  144 aa  RL11_FRASC RecName: Full=50S ribosomal protein L11;
    3::139     9e-35  53%  141 aa  RL11_EUBR3 RecName: Full=50S ribosomal protein L11;
    3::140     9e-35  53%  141 aa  RL11_ALKOO RecName: Full=50S ribosomal protein L11;
    3::140     9e-35  46%  141 aa  RK11_PORPU RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::140     1e-34  52%  140 aa  RL11_STAS1 RecName: Full=50S ribosomal protein L11;
    3::141     1e-34  61%  141 aa  RL11_LACF3 RecName: Full=50S ribosomal protein L11;
    3::139     1e-34  53%  142 aa  RL11_DESRM RecName: Full=50S ribosomal protein L11;
    3::139     1e-34  51%  141 aa  RL11_DESAD RecName: Full=50S ribosomal protein L11;
    3::139     2e-34  50%  141 aa  RL11_THEP1 RecName: Full=50S ribosomal protein L11;
    3::142     2e-34  51%  143 aa  RL11_HALHL RecName: Full=50S ribosomal protein L11;
    3::139     2e-34  50%  142 aa  RL11_CLOPH RecName: Full=50S ribosomal protein L11;
    3::142     2e-34  52%  143 aa  RL11_BURM1 RecName: Full=50S ribosomal protein L11;
    3::139     3e-34  51%  141 aa  RL11_SYNE7 RecName: Full=50S ribosomal protein L11;
    3::141     3e-34  55%  142 aa  RL11_PRB01 RecName: Full=50S ribosomal protein L11;
    3::140     3e-34  50%  141 aa  RL11_FUSNN RecName: Full=50S ribosomal protein L11;
    3::139     3e-34  52%  141 aa  RL11_STRS2 RecName: Full=50S ribosomal protein L11;
    3::141     3e-34  50%  141 aa  RL11_LACSS RecName: Full=50S ribosomal protein L11;
    3::141     3e-34  50%  142 aa  RL11_HAHCH RecName: Full=50S ribosomal protein L11;
    3::139     3e-34  51%  140 aa  RL11_GEMAT RecName: Full=50S ribosomal protein L11;
    3::140     3e-34  51%  140 aa  RL11_DESDA RecName: Full=50S ribosomal protein L11;
    3::139     3e-34  51%  141 aa  RL11_CARHZ RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURTA RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURPS RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURP6 RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURP1 RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURP0 RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURMS RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURMA RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURM9 RecName: Full=50S ribosomal protein L11;
    3::142     3e-34  52%  143 aa  RL11_BURM7 RecName: Full=50S ribosomal protein L11;
    3::139     4e-34  51%  140 aa  RL11_THETN RecName: Full=50S ribosomal protein L11;
    3::139     4e-34  49%  141 aa  RL11_SYNY3 RecName: Full=50S ribosomal protein L11;
    3::139     4e-34  53%  141 aa  RL11_STRPI RecName: Full=50S ribosomal protein L11;
    3::139     4e-34  50%  141 aa  RL11_DESPS RecName: Full=50S ribosomal protein L11;
    2::140     4e-34  50%  144 aa  RL11_DEIRA RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRZT RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRZP RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRZJ RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRR6 RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRPS RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRPN RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRPJ RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRP7 RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRP4 RecName: Full=50S ribosomal protein L11;
    3::139     6e-34  52%  141 aa  RL11_STRP2 RecName: Full=50S ribosomal protein L11;
    3::144     6e-34  51%  145 aa  RL11_PERMH RecName: Full=50S ribosomal protein L11;
    3::141     6e-34  50%  141 aa  RL11_LACBA RecName: Full=50S ribosomal protein L11;
    3::142     6e-34  51%  143 aa  RL11_BURVG RecName: Full=50S ribosomal protein L11;
    3::142     6e-34  51%  143 aa  RL11_BURCM RecName: Full=50S ribosomal protein L11;
    3::142     6e-34  51%  143 aa  RL11_BURA4 RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  50%  141 aa  RL11_SYNP6 RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  53%  141 aa  RL11_STRSV RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPZ RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPM RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPG RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPF RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPD RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPC RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRPB RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRP8 RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRP6 RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRP3 RecName: Full=50S ribosomal protein L11;
    3::139     7e-34  52%  141 aa  RL11_STRP1 RecName: Full=50S ribosomal protein L11;
   35::141     7e-34  59%  143 aa  RL11_SALTO RecName: Full=50S ribosomal protein L11;
   35::141     7e-34  59%  143 aa  RL11_SALAI RecName: Full=50S ribosomal protein L11;
    3::140     7e-34  60%  141 aa  RL11_LACRJ RecName: Full=50S ribosomal protein L11;
    3::140     7e-34  60%  141 aa  RL11_LACRD RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  51%  143 aa  RL11_BURS3 RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  51%  143 aa  RL11_BURCJ RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  51%  143 aa  RL11_BURCH RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  51%  143 aa  RL11_BURCC RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  51%  143 aa  RL11_BURCA RecName: Full=50S ribosomal protein L11;
    3::142     7e-34  50%  148 aa  RL11_ALTMD RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  52%  141 aa  RL11_STRGC RecName: Full=50S ribosomal protein L11;
    3::140     1e-33  51%  141 aa  RL11_LACS1 RecName: Full=50S ribosomal protein L11;
    3::141     1e-33  51%  142 aa  RL11_HAEDU RecName: Full=50S ribosomal protein L11;
    3::137     1e-33  50%  141 aa  RL11_CLOCE RecName: Full=50S ribosomal protein L11;
    3::142     1e-33  53%  143 aa  RL11_BURP8 RecName: Full=50S ribosomal protein L11;
    3::141     1e-33  51%  142 aa  RL11_ACTP7 RecName: Full=50S ribosomal protein L11;
    3::141     1e-33  51%  142 aa  RL11_ACTP2 RecName: Full=50S ribosomal protein L11;
    3::142     1e-33  50%  143 aa  RL11_THIDA RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  49%  141 aa  RL11_THELT RecName: Full=50S ribosomal protein L11;
    3::141     1e-33  52%  141 aa  RL11_SYNAS RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  52%  141 aa  RL11_STRU0 RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  52%  141 aa  RL11_STRS7 RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  52%  141 aa  RL11_STREM RecName: Full=50S ribosomal protein L11;
    3::139     1e-33  52%  141 aa  RL11_STRE4 RecName: Full=50S ribosomal protein L11;
    5::144     1e-33  61%  144 aa  RL11_STRAT RecName: Full=50S ribosomal protein L11;
    3::140     1e-33  60%  141 aa  RL11_LACAC RecName: Full=50S ribosomal protein L11;
    3::141     2e-33  50%  141 aa  RL11_PEDPA RecName: Full=50S ribosomal protein L11;
    3::142     2e-33  52%  143 aa  RL11_MARAV RecName: Full=50S ribosomal protein L11;
    3::144     2e-33  51%  144 aa  RL11_LEGPL RecName: Full=50S ribosomal protein L11;
    3::144     2e-33  51%  144 aa  RL11_LEGPH RecName: Full=50S ribosomal protein L11;
    3::144     2e-33  51%  144 aa  RL11_LEGPC RecName: Full=50S ribosomal protein L11;
    3::144     2e-33  51%  144 aa  RL11_LEGPA RecName: Full=50S ribosomal protein L11;
    3::142     2e-33  50%  142 aa  RL11_IDILO RecName: Full=50S ribosomal protein L11;
    2::140     2e-33  49%  144 aa  RL11_DEIDV RecName: Full=50S ribosomal protein L11;
    3::142     2e-33  51%  143 aa  RL11_BORPD RecName: Full=50S ribosomal protein L11;
    3::139     2e-33  51%  141 aa  RL11_STRTD RecName: Full=50S ribosomal protein L11;
    3::139     2e-33  51%  141 aa  RL11_STRT2 RecName: Full=50S ribosomal protein L11;
    3::139     2e-33  51%  141 aa  RL11_STRT1 RecName: Full=50S ribosomal protein L11;
    3::139     2e-33  51%  141 aa  RL11_STRSY RecName: Full=50S ribosomal protein L11;
   33::139     2e-33  58%  141 aa  RL11_FERNB RecName: Full=50S ribosomal protein L11;
    2::140     2e-33  49%  144 aa  RL11_DEIGD RecName: Full=50S ribosomal protein L11;
    3::142     2e-33  52%  143 aa  RL11_BURXL RecName: Full=50S ribosomal protein L11;
    3::142     3e-33  50%  143 aa  RL11_THISH RecName: Full=50S ribosomal protein L11;
    1::140     3e-33  51%  140 aa  RL11_SYNFM RecName: Full=50S ribosomal protein L11;
    3::139     3e-33  49%  141 aa  RL11_ROSCS RecName: Full=50S ribosomal protein L11;
    3::139     3e-33  51%  140 aa  RL11_HELMI RecName: Full=50S ribosomal protein L11;
    3::142     3e-33  50%  143 aa  RL11_BORPA RecName: Full=50S ribosomal protein L11;
    3::142     3e-33  50%  143 aa  RL11_BORBR RecName: Full=50S ribosomal protein L11;
    3::142     4e-33  51%  142 aa  RL11_PSEA6 RecName: Full=50S ribosomal protein L11;
    1::141     4e-33  48%  141 aa  RL11_LEPBP RecName: Full=50S ribosomal protein L11;
    1::141     4e-33  48%  141 aa  RL11_LEPBA RecName: Full=50S ribosomal protein L11;
    3::139     4e-33  49%  141 aa  RL11_LACLA RecName: Full=50S ribosomal protein L11;
    3::140     4e-33  52%  141 aa  RL11_CALS8 RecName: Full=50S ribosomal protein L11;
    3::142     4e-33  50%  143 aa  RL11_BORPE RecName: Full=50S ribosomal protein L11;
    3::142     4e-33  50%  143 aa  RL11_BORA1 RecName: Full=50S ribosomal protein L11;
    3::142     5e-33  50%  143 aa  RL11_VARPS RecName: Full=50S ribosomal protein L11;
    3::142     5e-33  51%  145 aa  RL11_SULSY RecName: Full=50S ribosomal protein L11;
    3::142     5e-33  50%  143 aa  RL11_POLSQ RecName: Full=50S ribosomal protein L11;
    3::142     5e-33  49%  144 aa  RL11_POLSJ RecName: Full=50S ribosomal protein L11;
    3::140     5e-33  49%  140 aa  RL11_LAWIP RecName: Full=50S ribosomal protein L11;
    3::142     5e-33  50%  143 aa  RL11_LARHH RecName: Full=50S ribosomal protein L11;
    3::141     5e-33  49%  147 aa  RL11_FLAPJ RecName: Full=50S ribosomal protein L11;
    3::139     6e-33  50%  141 aa  RL11_STRA5 RecName: Full=50S ribosomal protein L11;
    3::139     6e-33  50%  141 aa  RL11_STRA1 RecName: Full=50S ribosomal protein L11;
    3::142     6e-33  49%  142 aa  RL11_RHOPT RecName: Full=50S ribosomal protein L11;
    3::142     6e-33  49%  142 aa  RL11_RHOPA RecName: Full=50S ribosomal protein L11;AltName:
    3::142     6e-33  50%  144 aa  RL11_POLNA RecName: Full=50S ribosomal protein L11;
    3::140     6e-33  53%  143 aa  RL11_PHEZH RecName: Full=50S ribosomal protein L11;
    3::142     6e-33  52%  143 aa  RL11_NITEC RecName: Full=50S ribosomal protein L11;
    3::142     6e-33  50%  143 aa  RL11_LEPCP RecName: Full=50S ribosomal protein L11;
    4::142     6e-33  48%  142 aa  RL11_CORDI RecName: Full=50S ribosomal protein L11;
    3::140     8e-33  49%  141 aa  RL11_SYNR3 RecName: Full=50S ribosomal protein L11;
    3::139     8e-33  50%  141 aa  RL11_SYNPX RecName: Full=50S ribosomal protein L11;
    3::139     8e-33  50%  141 aa  RL11_STRMU RecName: Full=50S ribosomal protein L11;
    3::139     8e-33  50%  141 aa  RL11_STRA3 RecName: Full=50S ribosomal protein L11;
    3::142     8e-33  50%  143 aa  RL11_POLNS RecName: Full=50S ribosomal protein L11;
    3::139     8e-33  49%  141 aa  RL11_LACLS RecName: Full=50S ribosomal protein L11;
    3::139     8e-33  49%  141 aa  RL11_LACLM RecName: Full=50S ribosomal protein L11;
    3::142     8e-33  51%  143 aa  RL11_BURPP RecName: Full=50S ribosomal protein L11;
    9::142     1e-32  47%  146 aa  RL11_SALRD RecName: Full=50S ribosomal protein L11;
    3::139     1e-32  48%  141 aa  RL11_ROSS1 RecName: Full=50S ribosomal protein L11;
    3::142     1e-32  48%  142 aa  RL11_RHOPB RecName: Full=50S ribosomal protein L11;
    3::139     1e-32  50%  142 aa  RL11_PELTS RecName: Full=50S ribosomal protein L11;
    3::140     1e-32  50%  142 aa  RL11_NITWN RecName: Full=50S ribosomal protein L11;
    3::141     1e-32  47%  145 aa  RL11_GRAFK RecName: Full=50S ribosomal protein L11;
    4::143     1e-32  47%  146 aa  RL11_CORK4 RecName: Full=50S ribosomal protein L11;
    3::139     1e-32  50%  141 aa  RL11_SYNPW RecName: Full=50S ribosomal protein L11;
    3::139     1e-32  49%  141 aa  RL11_PROMA RecName: Full=50S ribosomal protein L11;
    3::142     1e-32  51%  143 aa  RL11_NITOC RecName: Full=50S ribosomal protein L11;
    5::142     1e-32  59%  143 aa  RL11_KOCRD RecName: Full=50S ribosomal protein L11;
    3::140     1e-32  47%  140 aa  RL11_DEHSC RecName: Full=50S ribosomal protein L11;
    3::142     1e-32  49%  143 aa  RL11_AZOSB RecName: Full=50S ribosomal protein L11;
    3::142     1e-32  50%  142 aa  RL11_ALCBS RecName: Full=50S ribosomal protein L11;
    3::142     2e-32  48%  142 aa  RL11_RHOP2 RecName: Full=50S ribosomal protein L11;
    3::139     2e-32  50%  141 aa  RL11_PROMM RecName: Full=50S ribosomal protein L11;
    3::139     2e-32  48%  140 aa  RL11_DESMR RecName: Full=50S ribosomal protein L11;
    3::140     2e-32  47%  140 aa  RL11_DEHSB RecName: Full=50S ribosomal protein L11;
    3::140     2e-32  46%  140 aa  RL11_DEHE1 RecName: Full=50S ribosomal protein L11;
    3::139     2e-32  48%  140 aa  RL11_BDEBA RecName: Full=50S ribosomal protein L11;
    3::139     2e-32  48%  141 aa  RK11_PHATR RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::142     2e-32  48%  142 aa  RL11_VESOH RecName: Full=50S ribosomal protein L11;
    3::141     2e-32  47%  147 aa  RL11_BACTN RecName: Full=50S ribosomal protein L11;
    3::141     2e-32  47%  147 aa  RL11_BACFR RecName: Full=50S ribosomal protein L11;
    3::141     2e-32  47%  147 aa  RL11_BACFN RecName: Full=50S ribosomal protein L11;
    3::140     2e-32  51%  141 aa  RL11_ANATD RecName: Full=50S ribosomal protein L11;
   74::211     2e-32  49%  224 aa  RK11_SPIOL RecName: Full=50S ribosomal protein L11,
   35::142     3e-32  55%  142 aa  RL11_THEFY RecName: Full=50S ribosomal protein L11;
    3::142     3e-32  47%  142 aa  RL11_RHILO RecName: Full=50S ribosomal protein L11;
    3::139     4e-32  49%  141 aa  RL11_SYNSC RecName: Full=50S ribosomal protein L11;
    3::140     4e-32  59%  141 aa  RL11_LACDB RecName: Full=50S ribosomal protein L11;
    3::140     4e-32  59%  141 aa  RL11_LACDA RecName: Full=50S ribosomal protein L11;
    4::142     4e-32  60%  143 aa  RL11_CLAMS RecName: Full=50S ribosomal protein L11;
    3::141     4e-32  48%  147 aa  RL11_BACV8 RecName: Full=50S ribosomal protein L11;
    3::142     4e-32  49%  142 aa  RL11_ACIF5 RecName: Full=50S ribosomal protein L11;
    3::142     4e-32  49%  142 aa  RL11_ACIF2 RecName: Full=50S ribosomal protein L11;
    3::139     4e-32  47%  141 aa  RK11_ODOSI RecName: Full=50S ribosomal protein L11, chloroplastic;
  102::209     4e-32  58%  222 aa  RK11_ARATH RecName: Full=50S ribosomal protein L11,
    3::142     5e-32  49%  142 aa  RL11_YERPG RecName: Full=50S ribosomal protein L11;
    3::141     5e-32  50%  142 aa  RL11_SOLUE RecName: Full=50S ribosomal protein L11;
    3::142     5e-32  47%  142 aa  RL11_RHOPS RecName: Full=50S ribosomal protein L11;
    3::140     5e-32  48%  141 aa  RL11_PROM4 RecName: Full=50S ribosomal protein L11;
    3::139     7e-32  47%  141 aa  RL11_SYNS3 RecName: Full=50S ribosomal protein L11;
    3::140     7e-32  50%  143 aa  RL11_SPHWW RecName: Full=50S ribosomal protein L11;
    3::139     7e-32  47%  141 aa  RL11_PROMS RecName: Full=50S ribosomal protein L11;
    3::139     7e-32  47%  141 aa  RL11_PROMP RecName: Full=50S ribosomal protein L11;
    3::139     7e-32  47%  141 aa  RL11_PROM2 RecName: Full=50S ribosomal protein L11;
    3::139     7e-32  47%  141 aa  RL11_PROM0 RecName: Full=50S ribosomal protein L11;
    3::142     7e-32  47%  142 aa  RL11_MESSB RecName: Full=50S ribosomal protein L11;
    4::142     7e-32  60%  143 aa  RL11_CLAM3 RecName: Full=50S ribosomal protein L11;
    3::140     9e-32  48%  142 aa  RL11_NITHX RecName: Full=50S ribosomal protein L11;
    3::141     9e-32  50%  143 aa  RL11_ACIBL RecName: Full=50S ribosomal protein L11;
    3::139     9e-32  46%  141 aa  RK11_GUITH RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::142     1e-31  48%  142 aa  RL11_YERPY RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPS RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPP RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPN RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPE RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPB RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERPA RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  48%  142 aa  RL11_YERP3 RecName: Full=50S ribosomal protein L11;
    3::139     1e-31  47%  141 aa  RL11_SYNS9 RecName: Full=50S ribosomal protein L11;
    3::139     1e-31  47%  141 aa  RL11_METI4 RecName: Full=50S ribosomal protein L11;
   33::139     1e-31  59%  141 aa  RL11_KOSOT RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  47%  142 aa  RL11_BRAJA RecName: Full=50S ribosomal protein L11;
    3::142     1e-31  47%  142 aa  RL11_BARQU RecName: Full=50S ribosomal protein L11;
    3::140     1e-31  46%  141 aa  RL11B_BACCR RecName: Full=50S ribosomal protein L11-2/L11-3;
    3::139     2e-31  49%  141 aa  RL11_SYNWW RecName: Full=50S ribosomal protein L11;
    3::142     2e-31  47%  142 aa  RL11_OLICO RecName: Full=50S ribosomal protein L11;
    3::139     2e-31  47%  141 aa  RL11_NAUPA RecName: Full=50S ribosomal protein L11;
    4::142     2e-31  49%  142 aa  RL11_MYCSS RecName: Full=50S ribosomal protein L11;
    4::142     2e-31  49%  142 aa  RL11_MYCSK RecName: Full=50S ribosomal protein L11;
    3::142     2e-31  47%  147 aa  RL11_CYTH3 RecName: Full=50S ribosomal protein L11;
    4::141     2e-31  62%  143 aa  RL11_BIFLO RecName: Full=50S ribosomal protein L11;
    4::141     2e-31  62%  143 aa  RL11_BIFLD RecName: Full=50S ribosomal protein L11;
    3::142     2e-31  48%  143 aa  RL11_TERTT RecName: Full=50S ribosomal protein L11;
   37::144     2e-31  56%  145 aa  RL11_RUBXD RecName: Full=50S ribosomal protein L11;
    3::142     2e-31  48%  143 aa  RL11_DELAS RecName: Full=50S ribosomal protein L11;
    3::142     2e-31  48%  143 aa  RL11_CELJU RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  48%  143 aa  RL11_SACD2 RecName: Full=50S ribosomal protein L11;
    1::141     3e-31  55%  141 aa  RL11_CHLFF RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  48%  142 aa  RL11_BRUO2 RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRASO RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRASB RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BARHE RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  48%  142 aa  RL11_BARBK RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_RHOP5 RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  143 aa  RL11_RHOFD RecName: Full=50S ribosomal protein L11;
    3::153     3e-31  46%  154 aa  RL11_LEUMM RecName: Full=50S ribosomal protein L11;
    3::140     3e-31  49%  141 aa  RL11_HELHP RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUSU RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUSI RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUME RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUMB RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUC2 RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUAB RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUA2 RecName: Full=50S ribosomal protein L11;
    3::142     3e-31  47%  142 aa  RL11_BRUA1 RecName: Full=50S ribosomal protein L11;
    3::142     5e-31  50%  143 aa  RL11_PSEU5 RecName: Full=50S ribosomal protein L11;
    3::141     5e-31  46%  147 aa  RL11_PARD8 RecName: Full=50S ribosomal protein L11;
    3::142     5e-31  50%  144 aa  RL11_NEIG2 RecName: Full=50S ribosomal protein L11;
    3::142     5e-31  50%  144 aa  RL11_NEIG1 RecName: Full=50S ribosomal protein L11;
    3::142     5e-31  48%  143 aa  RL11_DIAST RecName: Full=50S ribosomal protein L11;
    4::143     5e-31  59%  147 aa  RL11_CORA7 RecName: Full=50S ribosomal protein L11;
    4::141     5e-31  62%  143 aa  RL11_BIFLI RecName: Full=50S ribosomal protein L11;
    3::142     5e-31  48%  143 aa  RL11_ACISJ RecName: Full=50S ribosomal protein L11;
    3::141     6e-31  46%  141 aa  RL11_THERP RecName: Full=50S ribosomal protein L11;
    3::141     6e-31  49%  142 aa  RL11_COLP3 RecName: Full=50S ribosomal protein L11;
    3::142     6e-31  47%  142 aa  RL11_BART1 RecName: Full=50S ribosomal protein L11;
    3::142     8e-31  47%  142 aa  RL11_OCHA4 RecName: Full=50S ribosomal protein L11;
    3::140     8e-31  45%  140 aa  RL11_DESVM RecName: Full=50S ribosomal protein L11;
    3::139     8e-31  46%  140 aa  RL11_DESAA RecName: Full=50S ribosomal protein L11;
    1::141     8e-31  55%  141 aa  RL11_CHLAB RecName: Full=50S ribosomal protein L11;
    4::141     8e-31  58%  143 aa  RL11_BEUC1 RecName: Full=50S ribosomal protein L11;
    3::139     8e-31  42%  141 aa  RK11_GRATL RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::142     1e-30  47%  143 aa  RL11_VEREI RecName: Full=50S ribosomal protein L11;
    3::150     1e-30  50%  150 aa  RL11_PARDP RecName: Full=50S ribosomal protein L11;
    3::140     1e-30  49%  143 aa  RL11_NOVAD RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  49%  142 aa  RL11_MYCSJ RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  49%  142 aa  RL11_MYCGI RecName: Full=50S ribosomal protein L11;
    3::142     1e-30  49%  144 aa  RL11_NEIM0 RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  47%  142 aa  RL11_MYCTU RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  47%  142 aa  RL11_MYCTA RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  47%  142 aa  RL11_MYCBT RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  47%  142 aa  RL11_MYCBP RecName: Full=50S ribosomal protein L11;
    4::142     1e-30  47%  142 aa  RL11_MYCBO RecName: Full=50S ribosomal protein L11;
    3::139     1e-30  47%  140 aa  RL11_DESAH RecName: Full=50S ribosomal protein L11;
    3::142     2e-30  49%  144 aa  RL11_NEIMF RecName: Full=50S ribosomal protein L11;
    3::142     2e-30  49%  144 aa  RL11_NEIMA RecName: Full=50S ribosomal protein L11;
    3::140     2e-30  46%  140 aa  RL11_DESVV RecName: Full=50S ribosomal protein L11;
    3::140     2e-30  46%  140 aa  RL11_DESVH RecName: Full=50S ribosomal protein L11;
    3::139     2e-30  47%  141 aa  RL11_DESOH RecName: Full=50S ribosomal protein L11;
    1::141     2e-30  55%  141 aa  RL11_CHLCV RecName: Full=50S ribosomal protein L11;
    4::141     2e-30  60%  143 aa  RL11_BIFAA RecName: Full=50S ribosomal protein L11;
    3::141     2e-30  46%  145 aa  RL11_PORGI RecName: Full=50S ribosomal protein L11;
    3::141     2e-30  46%  145 aa  RL11_PORG3 RecName: Full=50S ribosomal protein L11;
    3::139     2e-30  50%  141 aa  RL11_NITSB RecName: Full=50S ribosomal protein L11;
    3::142     2e-30  49%  143 aa  RL11_HERAR RecName: Full=50S ribosomal protein L11;
    3::140     2e-30  49%  143 aa  RL11_CAUSK RecName: Full=50S ribosomal protein L11;
    3::142     3e-30  47%  142 aa  RL11_VIBCM RecName: Full=50S ribosomal protein L11;
    3::142     3e-30  47%  142 aa  RL11_VIBCH RecName: Full=50S ribosomal protein L11;
    3::142     3e-30  47%  142 aa  RL11_VIBC3 RecName: Full=50S ribosomal protein L11;
    3::140     3e-30  48%  143 aa  RL11_CAUCR RecName: Full=50S ribosomal protein L11;
    3::140     3e-30  48%  143 aa  RL11_CAUCN RecName: Full=50S ribosomal protein L11;
    3::140     3e-30  46%  141 aa  RL11_AMOA5 RecName: Full=50S ribosomal protein L11;
    3::142     3e-30  47%  143 aa  RL11_ACIAC RecName: Full=50S ribosomal protein L11;
    3::139     3e-30  45%  141 aa  RK11_THAPS RecName: Full=50S ribosomal protein L11, chloroplastic;
    1::142     4e-30  50%  143 aa  RL11_TREDE RecName: Full=50S ribosomal protein L11;
    3::141     4e-30  47%  141 aa  RL11_SILST RecName: Full=50S ribosomal protein L11;
    3::140     5e-30  50%  143 aa  RL11_SPHAL RecName: Full=50S ribosomal protein L11;
    5::144     5e-30  45%  144 aa  RL11_RHOSR RecName: Full=50S ribosomal protein L11;
    5::144     5e-30  45%  144 aa  RL11_RHOOB RecName: Full=50S ribosomal protein L11;
   29::139     5e-30  50%  142 aa  RL11_MESFL RecName: Full=50S ribosomal protein L11;
    3::142     5e-30  47%  142 aa  RL11_BAUCH RecName: Full=50S ribosomal protein L11;
    3::141     5e-30  45%  142 aa  RL11_AKKM8 RecName: Full=50S ribosomal protein L11;
    3::145     7e-30  47%  147 aa  RL11_SORC5 RecName: Full=50S ribosomal protein L11;
    3::139     7e-30  48%  141 aa  RL11_HELAH RecName: Full=50S ribosomal protein L11;
    3::142     7e-30  48%  143 aa  RL11_AZOVD RecName: Full=50S ribosomal protein L11;
   33::139     7e-30  50%  141 aa  RK11_CYAPA RecName: Full=50S ribosomal protein L11, cyanelle;
    3::142     9e-30  46%  142 aa  RL11_THICR RecName: Full=50S ribosomal protein L11;
    3::139     9e-30  46%  141 aa  RL11_THEM4 RecName: Full=50S ribosomal protein L11;
    3::139     9e-30  45%  141 aa  RL11_CHLAD RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIBY RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIBT RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIBS RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIBC RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIB5 RecName: Full=50S ribosomal protein L11;
    3::141     9e-30  48%  142 aa  RL11_ACIB3 RecName: Full=50S ribosomal protein L11;
    5::144     1e-29  45%  144 aa  RL11_RHOE4 RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_PHYAS RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  142 aa  RL11_PARL1 RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISW6 RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISMO RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISMH RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISMF RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISMC RecName: Full=50S ribosomal protein L11;
    3::140     1e-29  47%  141 aa  RL11_LISIN RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELPY RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELPS RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELPJ RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELPH RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELPG RecName: Full=50S ribosomal protein L11;
    3::139     1e-29  47%  141 aa  RL11_HELP2 RecName: Full=50S ribosomal protein L11;
    3::145     1e-29  48%  145 aa  RL11_COXBU RecName: Full=50S ribosomal protein L11;
    3::145     1e-29  48%  145 aa  RL11_COXBR RecName: Full=50S ribosomal protein L11;
    3::145     1e-29  48%  145 aa  RL11_COXB2 RecName: Full=50S ribosomal protein L11;
    3::145     1e-29  48%  145 aa  RL11_COXB1 RecName: Full=50S ribosomal protein L11;
    3::141     1e-29  48%  142 aa  RL11_ACIAD RecName: Full=50S ribosomal protein L11;
    3::142     1e-29  47%  143 aa  RL11_PSEPF RecName: Full=50S ribosomal protein L11;
    3::141     1e-29  46%  142 aa  RL11_PSEHT RecName: Full=50S ribosomal protein L11;
    3::142     1e-29  47%  143 aa  RL11_NITMU RecName: Full=50S ribosomal protein L11;
    3::145     1e-29  47%  145 aa  RL11_COXBN RecName: Full=50S ribosomal protein L11;
    2::140     2e-29  45%  147 aa  RL11_THETH RecName: Full=50S ribosomal protein L11;
    2::140     2e-29  45%  147 aa  RL11_THET8 RecName: Full=50S ribosomal protein L11;
    2::140     2e-29  45%  147 aa  RL11_THET2 RecName: Full=50S ribosomal protein L11;
    3::140     2e-29  45%  142 aa  RL11_RHORT RecName: Full=50S ribosomal protein L11;
    3::139     2e-29  45%  141 aa  RL11_PROM5 RecName: Full=50S ribosomal protein L11;
    3::139     2e-29  59%  141 aa  RL11_OPITP RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  47%  144 aa  RL11_FRATW RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  47%  144 aa  RL11_FRATT RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  47%  144 aa  RL11_FRATN RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  47%  144 aa  RL11_FRATM RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  47%  144 aa  RL11_FRAT1 RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  45%  142 aa  RL11_STRMK RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  45%  142 aa  RL11_STRM5 RecName: Full=50S ribosomal protein L11;
    3::141     2e-29  46%  141 aa  RL11_SILPO RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  47%  143 aa  RL11_PSEU2 RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  47%  143 aa  RL11_PSESM RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  47%  143 aa  RL11_PSEFS RecName: Full=50S ribosomal protein L11;
    3::142     2e-29  47%  143 aa  RL11_PSEF5 RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  46%  144 aa  RL11_FRATO RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  46%  144 aa  RL11_FRATH RecName: Full=50S ribosomal protein L11;
    1::143     2e-29  46%  144 aa  RL11_FRATF RecName: Full=50S ribosomal protein L11;
    1::142     2e-29  45%  143 aa  RL11_BORGA RecName: Full=50S ribosomal protein L11;
    1::142     2e-29  45%  143 aa  RL11_BORAP RecName: Full=50S ribosomal protein L11;
    3::140     3e-29  46%  143 aa  RL11_ZYMMO RecName: Full=50S ribosomal protein L11;
    3::142     3e-29  47%  143 aa  RL11_PSE14 RecName: Full=50S ribosomal protein L11;
    3::139     3e-29  45%  141 aa  RL11_PROM9 RecName: Full=50S ribosomal protein L11;
   29::139     3e-29  51%  142 aa  RL11_MYCCT RecName: Full=50S ribosomal protein L11;
    3::140     3e-29  47%  142 aa  RL11_MARMM RecName: Full=50S ribosomal protein L11;
    2::148     3e-29  49%  148 aa  RL11_ANASK RecName: Full=50S ribosomal protein L11;
    2::148     3e-29  49%  148 aa  RL11_ANADE RecName: Full=50S ribosomal protein L11;
    2::148     3e-29  49%  148 aa  RL11_ANAD2 RecName: Full=50S ribosomal protein L11;
    5::143     4e-29  45%  144 aa  RL11_NOCFA RecName: Full=50S ribosomal protein L11;
    1::145     4e-29  46%  145 aa  RL11_FRAP2 RecName: Full=50S ribosomal protein L11;
   34::141     4e-29  53%  141 aa  RL11_CHLPN RecName: Full=50S ribosomal protein L11;
    3::139     4e-29  50%  141 aa  RL11_CAMC1 RecName: Full=50S ribosomal protein L11;
    1::142     4e-29  46%  143 aa  RL11_BORBZ RecName: Full=50S ribosomal protein L11;
    1::142     4e-29  46%  143 aa  RL11_BORBU RecName: Full=50S ribosomal protein L11;
   32::139     4e-29  50%  141 aa  RL11B_BACHD RecName: Full=50S ribosomal protein L11-2;
    3::142     6e-29  46%  142 aa  RL11_TOLAT RecName: Full=50S ribosomal protein L11;
    3::140     6e-29  46%  141 aa  RL11_ONYPE RecName: Full=50S ribosomal protein L11;
    3::140     6e-29  57%  141 aa  RL11_LACJO RecName: Full=50S ribosomal protein L11;
    3::139     6e-29  46%  142 aa  RL11_DESAP RecName: Full=50S ribosomal protein L11;
    3::139     6e-29  50%  141 aa  RL11_CAMC5 RecName: Full=50S ribosomal protein L11;
    3::142     7e-29  45%  142 aa  RL11_RHISN RecName: Full=50S ribosomal protein L11;
    3::142     7e-29  47%  143 aa  RL11_DECAR RecName: Full=50S ribosomal protein L11;
    3::139     7e-29  45%  141 aa  RL11_CHLSY RecName: Full=50S ribosomal protein L11;
    3::139     7e-29  45%  141 aa  RL11_CHLAA RecName: Full=50S ribosomal protein L11;
    3::141     7e-29  46%  142 aa  RL11_AERS4 RecName: Full=50S ribosomal protein L11;
    3::141     7e-29  46%  142 aa  RL11_AERHH RecName: Full=50S ribosomal protein L11;
    3::142     9e-29  45%  142 aa  RL11_XYLFT RecName: Full=50S ribosomal protein L11;
   33::143     9e-29  55%  144 aa  RL11_RICBR RecName: Full=50S ribosomal protein L11;
   33::143     9e-29  55%  144 aa  RL11_RICB8 RecName: Full=50S ribosomal protein L11;
   29::139     9e-29  50%  142 aa  RL11_MYCMS RecName: Full=50S ribosomal protein L11;
    3::142     1e-28  45%  142 aa  RL11_XYLFA RecName: Full=50S ribosomal protein L11;
    3::142     1e-28  45%  142 aa  RL11_SHESR RecName: Full=50S ribosomal protein L11;
    3::142     1e-28  45%  142 aa  RL11_SHESM RecName: Full=50S ribosomal protein L11;
    3::142     1e-28  45%  142 aa  RL11_SHESA RecName: Full=50S ribosomal protein L11;
    3::142     1e-28  46%  143 aa  RL11_AZOSE RecName: Full=50S ribosomal protein L11;
   33::142     1e-28  52%  145 aa  RL11_AQUAE RecName: Full=50S ribosomal protein L11;
    3::141     1e-28  46%  142 aa  RL11_ACTSZ RecName: Full=50S ribosomal protein L11;
    3::142     2e-28  45%  142 aa  RL11_SHEON RecName: Full=50S ribosomal protein L11;
    3::142     2e-28  47%  142 aa  RL11_METSB RecName: Full=50S ribosomal protein L11;
    3::142     2e-28  46%  143 aa  RL11_METCA RecName: Full=50S ribosomal protein L11;
    3::141     2e-28  46%  141 aa  RL11_DINSH RecName: Full=50S ribosomal protein L11;
    3::141     2e-28  48%  142 aa  RL11_DICNV RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  45%  141 aa  RL11_WOLSU RecName: Full=50S ribosomal protein L11;
    3::142     3e-28  44%  142 aa  RL11_SINMW RecName: Full=50S ribosomal protein L11;
    3::141     3e-28  46%  142 aa  RL11_SHEWM RecName: Full=50S ribosomal protein L11;
    3::141     3e-28  46%  142 aa  RL11_SHEPA RecName: Full=50S ribosomal protein L11;
    3::141     3e-28  45%  142 aa  RL11_SHEAM RecName: Full=50S ribosomal protein L11;
    3::143     3e-28  47%  143 aa  RL11_RHIE6 RecName: Full=50S ribosomal protein L11;
    9::140     3e-28  45%  141 aa  RL11_PHYMT RecName: Full=50S ribosomal protein L11;
    3::142     3e-28  42%  145 aa  RL11_HYDS0 RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  48%  141 aa  RL11_CAMJR RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  48%  141 aa  RL11_CAMJJ RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  48%  141 aa  RL11_CAMJE RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  48%  141 aa  RL11_CAMJD RecName: Full=50S ribosomal protein L11;
    3::139     3e-28  48%  141 aa  RL11_CAMJ8 RecName: Full=50S ribosomal protein L11;
    3::140     3e-28  48%  140 aa  RL11_CAMHC RecName: Full=50S ribosomal protein L11;
    3::141     4e-28  46%  142 aa  RL11_SHESH RecName: Full=50S ribosomal protein L11;
    3::141     4e-28  46%  142 aa  RL11_SHELP RecName: Full=50S ribosomal protein L11;
    3::142     4e-28  43%  142 aa  RL11_RHIME RecName: Full=50S ribosomal protein L11;
    3::147     4e-28  47%  149 aa  RL11_METPB RecName: Full=50S ribosomal protein L11;
    3::147     4e-28  47%  149 aa  RL11_METEP RecName: Full=50S ribosomal protein L11;
    3::147     4e-28  47%  149 aa  RL11_METC4 RecName: Full=50S ribosomal protein L11;
    3::142     4e-28  46%  142 aa  RL11_HAES2 RecName: Full=50S ribosomal protein L11;
    3::142     4e-28  46%  142 aa  RL11_HAES1 RecName: Full=50S ribosomal protein L11;
    3::140     4e-28  43%  140 aa  RL11_DESDG RecName: Full=50S ribosomal protein L11;
    3::141     5e-28  46%  142 aa  RL11_SHEHH RecName: Full=50S ribosomal protein L11;
    3::141     5e-28  46%  142 aa  RL11_SHEFN RecName: Full=50S ribosomal protein L11;
    3::140     5e-28  45%  141 aa  RL11_AYWBP RecName: Full=50S ribosomal protein L11;
   36::144     6e-28  50%  144 aa  RL11_SACEN RecName: Full=50S ribosomal protein L11;
    3::142     6e-28  46%  143 aa  RL11_NITEU RecName: Full=50S ribosomal protein L11;
    3::142     6e-28  46%  143 aa  RL11_METPP RecName: Full=50S ribosomal protein L11;
    3::141     6e-28  46%  142 aa  RL11_HAEIN RecName: Full=50S ribosomal protein L11;
    3::141     6e-28  46%  142 aa  RL11_HAEIE RecName: Full=50S ribosomal protein L11;
    3::141     6e-28  46%  142 aa  RL11_HAEI8 RecName: Full=50S ribosomal protein L11;
    3::140     6e-28  45%  140 aa  RL11_ENTFA RecName: Full=50S ribosomal protein L11;
    3::139     6e-28  47%  141 aa  RL11_CAMLR RecName: Full=50S ribosomal protein L11;
    3::140     8e-28  41%  150 aa  RL11_AZOPC RecName: Full=50S ribosomal protein L11;
    3::141     1e-27  46%  142 aa  RL11_SHESW RecName: Full=50S ribosomal protein L11;
    3::141     1e-27  46%  142 aa  RL11_SHEPC RecName: Full=50S ribosomal protein L11;
    3::137     1e-27  54%  142 aa  RL11_PARUW RecName: Full=50S ribosomal protein L11;
    3::150     1e-27  47%  150 aa  RL11_JANSC RecName: Full=50S ribosomal protein L11;
   36::142     1e-27  51%  144 aa  RL11_FRAAA RecName: Full=50S ribosomal protein L11;
    3::139     1e-27  46%  141 aa  RL11_CAMFF RecName: Full=50S ribosomal protein L11;
    2::148     1e-27  47%  148 aa  RL11_ANADF RecName: Full=50S ribosomal protein L11;
    3::140     1e-27  44%  141 aa  RL11_PELUB RecName: Full=50S ribosomal protein L11;
    3::140     1e-27  43%  141 aa  RL11_ARCB4 RecName: Full=50S ribosomal protein L11;
    3::143     1e-27  46%  143 aa  RL11_AGRRK RecName: Full=50S ribosomal protein L11;
    3::142     2e-27  45%  142 aa  RL11_YERE8 RecName: Full=50S ribosomal protein L11;
    3::141     2e-27  44%  142 aa  RL11_SHEDO RecName: Full=50S ribosomal protein L11;
    3::143     2e-27  46%  143 aa  RL11_RHIEC RecName: Full=50S ribosomal protein L11;
    3::141     2e-27  46%  142 aa  RL11_HAEIG RecName: Full=50S ribosomal protein L11;
   34::141     2e-27  52%  141 aa  RL11_CHLMU RecName: Full=50S ribosomal protein L11;
    1::142     2e-27  44%  143 aa  RL11_BLOPB RecName: Full=50S ribosomal protein L11;
    3::142     2e-27  45%  142 aa  RL11_VIBVY RecName: Full=50S ribosomal protein L11;
    3::141     2e-27  42%  141 aa  RL11_RHOBA RecName: Full=50S ribosomal protein L11;
    3::142     2e-27  45%  143 aa  RL11_METFK RecName: Full=50S ribosomal protein L11;
    3::142     3e-27  45%  142 aa  RL11_PHOLL RecName: Full=50S ribosomal protein L11;
    3::141     3e-27  44%  142 aa  RL11_PASMU RecName: Full=50S ribosomal protein L11;
    3::149     3e-27  45%  149 aa  RL11_METS4 RecName: Full=50S ribosomal protein L11;
    3::143     4e-27  45%  143 aa  RL11_RHILW RecName: Full=50S ribosomal protein L11;
    3::143     4e-27  45%  143 aa  RL11_RHIL3 RecName: Full=50S ribosomal protein L11;
   33::139     4e-27  50%  141 aa  RL11_COPPD RecName: Full=50S ribosomal protein L11;
   34::141     4e-27  52%  141 aa  RL11_CHLTB RecName: Full=50S ribosomal protein L11;
   34::141     4e-27  52%  141 aa  RL11_CHLT2 RecName: Full=50S ribosomal protein L11;
   33::140     4e-27  45%  141 aa  RK11_CYACA RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::141     5e-27  45%  142 aa  RL11_SHEB9 RecName: Full=50S ribosomal protein L11;
    3::141     5e-27  45%  142 aa  RL11_SHEB8 RecName: Full=50S ribosomal protein L11;
    3::141     5e-27  45%  142 aa  RL11_SHEB2 RecName: Full=50S ribosomal protein L11;
    3::141     5e-27  46%  142 aa  RL11_PROMH RecName: Full=50S ribosomal protein L11;
   34::141     5e-27  52%  141 aa  RL11_CHLTR RecName: Full=50S ribosomal protein L11;
   34::141     5e-27  52%  141 aa  RL11_CHLTA RecName: Full=50S ribosomal protein L11;
    3::142     9e-27  46%  143 aa  RL11_PSEAE RecName: Full=50S ribosomal protein L11;
    3::142     9e-27  46%  143 aa  RL11_PSEAB RecName: Full=50S ribosomal protein L11;
    3::142     9e-27  46%  143 aa  RL11_PSEA8 RecName: Full=50S ribosomal protein L11;
    3::142     9e-27  46%  143 aa  RL11_PSEA7 RecName: Full=50S ribosomal protein L11;
    3::140     9e-27  43%  142 aa  RL11_BEII9 RecName: Full=50S ribosomal protein L11;
    3::143     9e-27  45%  143 aa  RL11_AGRT5 RecName: Full=50S ribosomal protein L11;
    3::141     1e-26  45%  142 aa  RL11_SODGM RecName: Full=50S ribosomal protein L11;
    3::141     1e-26  44%  142 aa  RL11_PECCP RecName: Full=50S ribosomal protein L11;
    3::149     2e-26  45%  149 aa  RL11_XANP2 RecName: Full=50S ribosomal protein L11;
    2::148     2e-26  47%  148 aa  RL11_MYXXD RecName: Full=50S ribosomal protein L11;
    3::141     2e-26  45%  142 aa  RL11_MAGSM RecName: Full=50S ribosomal protein L11;
   33::137     2e-26  50%  138 aa  RK11_CYAME RecName: Full=50S ribosomal protein L11, chloroplastic;
    3::142     2e-26  45%  142 aa  RL11_VIBVU RecName: Full=50S ribosomal protein L11;
    3::141     3e-26  44%  142 aa  RL11_SERP5 RecName: Full=50S ribosomal protein L11;
    3::140     3e-26  41%  141 aa  RL11_PROMT RecName: Full=50S ribosomal protein L11;
    3::140     3e-26  41%  141 aa  RL11_PROM1 RecName: Full=50S ribosomal protein L11;
    3::141     3e-26  43%  142 aa  RL11_ERWCT RecName: Full=50S ribosomal protein L11;
   33::139     3e-26  51%  141 aa  RL11_SULNB RecName: Full=50S ribosomal protein L11;
    3::139     3e-26  45%  141 aa  RL11_SULDN RecName: Full=50S ribosomal protein L11;
    3::141     3e-26  44%  142 aa  RL11_SERMA RecName: Full=50S ribosomal protein L11;
    3::142     3e-26  45%  143 aa  RL11_RALPJ RecName: Full=50S ribosomal protein L11;
    3::142     3e-26  44%  143 aa  RL11_PSYWF RecName: Full=50S ribosomal protein L11;
    3::149     3e-26  46%  149 aa  RL11_METNO RecName: Full=50S ribosomal protein L11;
    3::141     3e-26  45%  142 aa  RL11_ENTS8 RecName: Full=50S ribosomal protein L11;
    3::142     4e-26  44%  143 aa  RL11_RALSO RecName: Full=50S ribosomal protein L11;
    1::146     4e-26  42%  146 aa  RL11_CORJK RecName: Full=50S ribosomal protein L11;
    3::141     6e-26  44%  144 aa  RL11_RHOCS RecName: Full=50S ribosomal protein L11;
    3::142     6e-26  45%  143 aa  RL11_RALME RecName: Full=50S ribosomal protein L11;
    3::142     6e-26  45%  143 aa  RL11_RALEH RecName: Full=50S ribosomal protein L11;
    3::142     6e-26  45%  143 aa  RL11_CUPTR RecName: Full=50S ribosomal protein L11;
    3::140     6e-26  53%  140 aa  RL11_BRAHW RecName: Full=50S ribosomal protein L11;
    3::142     7e-26  44%  143 aa  RL11_RALEJ RecName: Full=50S ribosomal protein L11;
    3::142     7e-26  45%  144 aa  RL11_NEIMB RecName: Full=50S ribosomal protein L11;
    3::142     7e-26  45%  143 aa  RL11_JANMA RecName: Full=50S ribosomal protein L11;
    3::141     1e-25  43%  141 aa  RL11_ROSDO RecName: Full=50S ribosomal protein L11;
   29::137     1e-25  50%  147 aa  RL11_MYCA5 RecName: Full=50S ribosomal protein L11;
    3::150     2e-25  45%  150 aa  RL11_RHOS5 RecName: Full=50S ribosomal protein L11;
    5::144     2e-25  41%  144 aa  RL11_COREF RecName: Full=50S ribosomal protein L11;
    1::141     2e-25  40%  142 aa  RL11_LEPIN RecName: Full=50S ribosomal protein L11;
    1::141     2e-25  40%  142 aa  RL11_LEPIC RecName: Full=50S ribosomal protein L11;
    3::141     2e-25  43%  144 aa  RL11_GLUOX RecName: Full=50S ribosomal protein L11;
    3::141     2e-25  43%  144 aa  RL11_GLUDA RecName: Full=50S ribosomal protein L11;
    3::142     3e-25  43%  143 aa  RL11_PSYA2 RecName: Full=50S ribosomal protein L11;
   29::137     3e-25  49%  193 aa  RL11_MYCS5 RecName: Full=50S ribosomal protein L11;
    3::141     3e-25  43%  142 aa  RL11_KLEP3 RecName: Full=50S ribosomal protein L11;
    3::149     3e-25  42%  149 aa  RL11_AZOC5 RecName: Full=50S ribosomal protein L11;
    3::142     4e-25  44%  142 aa  RL11_VIBFM RecName: Full=50S ribosomal protein L11;
    3::142     4e-25  44%  142 aa  RL11_VIBF1 RecName: Full=50S ribosomal protein L11;
    3::142     4e-25  43%  143 aa  RL11_PSEMY RecName: Full=50S ribosomal protein L11;
    3::142     4e-25  43%  144 aa  RL11_MARMS RecName: Full=50S ribosomal protein L11;
    1::141     4e-25  40%  142 aa  RL11_LEPBL RecName: Full=50S ribosomal protein L11;
    1::141     4e-25  40%  142 aa  RL11_LEPBJ RecName: Full=50S ribosomal protein L11;
    3::141     4e-25  43%  142 aa  RL11_ERWT9 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SHISS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SHIF8 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SHIDS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SHIBS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SHIB3 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALTY RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALTI RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALSV RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALPK RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALPC RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALPA RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALNS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALHS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALG2 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALEP RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALDC RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALCH RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALAR RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_SALA4 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_KLEP7 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ESCF3 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  42%  142 aa  RL11_ENT38 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOUT RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOSM RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOSE RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOLU RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOLI RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOLC RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOL6 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOL5 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOHS RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECODH RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECOBW RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO8A RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO81 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO7I RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO5E RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO57 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO55 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO45 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO27 RecName: Full=50S ribosomal protein L11;
    3::141     5e-25  43%  142 aa  RL11_ECO24 RecName: Full=50S ribosomal protein L11;
    3::142     6e-25  42%  143 aa  RL11_PSYCK RecName: Full=50S ribosomal protein L11;
    3::141     6e-25  43%  142 aa  RL11_CITK8 RecName: Full=50S ribosomal protein L11;
    3::142     8e-25  42%  142 aa  RL11_XANAC RecName: Full=50S ribosomal protein L11;
    3::142     8e-25  43%  142 aa  RL11_VIBPA RecName: Full=50S ribosomal protein L11;
    3::142     8e-25  43%  142 aa  RL11_VIBHB RecName: Full=50S ribosomal protein L11;
    3::140     8e-25  42%  143 aa  RL11_ERYLH RecName: Full=50S ribosomal protein L11;
    2::143     8e-25  42%  146 aa  RL11_BLOFL RecName: Full=50S ribosomal protein L11;
    3::142     1e-24  42%  142 aa  RL11_XANC5 RecName: Full=50S ribosomal protein L11;
   32::140     1e-24  46%  150 aa  RL11_UREU1 RecName: Full=50S ribosomal protein L11;
    3::141     1e-24  43%  142 aa  RL11_SHIFL RecName: Full=50S ribosomal protein L11;
    3::150     1e-24  44%  150 aa  RL11_RHOSK RecName: Full=50S ribosomal protein L11;
    3::150     1e-24  44%  150 aa  RL11_RHOS4 RecName: Full=50S ribosomal protein L11;
    8::140     1e-24  42%  146 aa  RL11_BUCBP RecName: Full=50S ribosomal protein L11;
    3::141     1e-24  43%  142 aa  RL11_SHEPW RecName: Full=50S ribosomal protein L11;
    5::144     1e-24  40%  144 aa  RL11_CORGB RecName: Full=50S ribosomal protein L11;
   33::141     2e-24  46%  152 aa  RL11_MYCGA RecName: Full=50S ribosomal protein L11;
    1::144     2e-24  52%  145 aa  RL11_RICAH RecName: Full=50S ribosomal protein L11;
    3::142     2e-24  42%  142 aa  RL11_PHOPR RecName: Full=50S ribosomal protein L11;
   32::140     3e-24  46%  150 aa  RL11_UREPA RecName: Full=50S ribosomal protein L11;
   32::140     3e-24  46%  150 aa  RL11_UREP2 RecName: Full=50S ribosomal protein L11;
    4::142     3e-24  42%  142 aa  RL11_MYCVP RecName: Full=50S ribosomal protein L11;
    3::147     3e-24  45%  149 aa  RL11_METRJ RecName: Full=50S ribosomal protein L11;
    3::141     4e-24  39%  142 aa  RL11_WIGBR RecName: Full=50S ribosomal protein L11;
    1::144     4e-24  51%  145 aa  RL11_RICFE RecName: Full=50S ribosomal protein L11;
    3::141     4e-24  41%  144 aa  RL11_GRABC RecName: Full=50S ribosomal protein L11;
    3::141     4e-24  42%  144 aa  RL11_ACICJ RecName: Full=50S ribosomal protein L11;
   34::144     5e-24  51%  145 aa  RL11_RICPU RecName: Full=50S ribosomal protein L11;
    3::142     5e-24  42%  142 aa  RL11_ALISL RecName: Full=50S ribosomal protein L11;
    3::142     7e-24  42%  143 aa  RL11_CHRVO RecName: Full=50S ribosomal protein L11;
   34::144     9e-24  50%  145 aa  RL11_RICRS RecName: Full=50S ribosomal protein L11;
   34::144     9e-24  50%  145 aa  RL11_RICRO RecName: Full=50S ribosomal protein L11;
   34::144     9e-24  50%  145 aa  RL11_RICCN RecName: Full=50S ribosomal protein L11;
   34::144     9e-24  50%  145 aa  RL11_RICAE RecName: Full=50S ribosomal protein L11;
    3::142     9e-24  42%  143 aa  RL11_PSEPW RecName: Full=50S ribosomal protein L11;
    3::142     9e-24  42%  143 aa  RL11_PSEPK RecName: Full=50S ribosomal protein L11;
    3::142     9e-24  42%  143 aa  RL11_PSEPG RecName: Full=50S ribosomal protein L11;
    3::142     9e-24  42%  143 aa  RL11_PSEP1 RecName: Full=50S ribosomal protein L11;
   30::138     9e-24  47%  197 aa  RL11_MYCPU RecName: Full=50S ribosomal protein L11;
    3::142     1e-23  42%  143 aa  RL11_PSEE4 RecName: Full=50S ribosomal protein L11;
    9::140     1e-23  39%  142 aa  RL11_LIBAS RecName: Full=50S ribosomal protein L11;
    3::142     2e-23  40%  142 aa  RL11_XANCB RecName: Full=50S ribosomal protein L11;
    4::142     2e-23  41%  142 aa  RL11_MYCA9 RecName: Full=50S ribosomal protein L11;
   10::145     2e-23  40%  145 aa  RL11_CORGL RecName: Full=50S ribosomal protein L11;
   35::143     2e-23  42%  155 aa  RL11_MYCPE RecName: Full=50S ribosomal protein L11;
    3::139     3e-23  42%  141 aa  RL11_SELRU RecName: Full=50S ribosomal protein L11;
    4::142     3e-23  40%  142 aa  RL11_MYCS2 RecName: Full=50S ribosomal protein L11;
    3::141     3e-23  42%  142 aa  RL11_HAEPS RecName: Full=50S ribosomal protein L11;
    3::142     5e-23  39%  142 aa  RL11_XANCP RecName: Full=50S ribosomal protein L11;
    3::142     5e-23  39%  142 aa  RL11_XANC8 RecName: Full=50S ribosomal protein L11;
    3::143     5e-23  44%  146 aa  RL11_TREPS RecName: Full=50S ribosomal protein L11;
    3::143     5e-23  44%  146 aa  RL11_TREPA RecName: Full=50S ribosomal protein L11;
    1::144     5e-23  53%  147 aa  RL11_CORU7 RecName: Full=50S ribosomal protein L11;
   34::144     6e-23  50%  145 aa  RL11_RICCK RecName: Full=50S ribosomal protein L11;
   35::139     6e-23  46%  197 aa  RL11_MYCMO RecName: Full=50S ribosomal protein L11;
   34::144     8e-23  50%  145 aa  RL11_RICM5 RecName: Full=50S ribosomal protein L11;
    4::142     8e-23  41%  142 aa  RL11_MYCUA RecName: Full=50S ribosomal protein L11;
    4::142     8e-23  41%  142 aa  RL11_MYCMM RecName: Full=50S ribosomal protein L11;
    3::143     8e-23  41%  143 aa  RL11_AGRVS RecName: Full=50S ribosomal protein L11;
    3::142     1e-22  39%  142 aa  RL11_XANOR RecName: Full=50S ribosomal protein L11;
    3::142     1e-22  39%  142 aa  RL11_XANOP RecName: Full=50S ribosomal protein L11;
    3::142     1e-22  39%  142 aa  RL11_XANOM RecName: Full=50S ribosomal protein L11;
    3::141     3e-22  41%  142 aa  RL11_MANSM RecName: Full=50S ribosomal protein L11;
   30::135     4e-22  42%  137 aa  RL11_MYCPN RecName: Full=50S ribosomal protein L11;
    3::141     7e-22  39%  142 aa  RL11_HAMD5 RecName: Full=50S ribosomal protein L11;
    3::141     7e-22  38%  142 aa  RL11_BUCAP RecName: Full=50S ribosomal protein L11;
   34::144     9e-22  48%  145 aa  RL11_RICPR RecName: Full=50S ribosomal protein L11;
    4::142     9e-22  38%  142 aa  RL11_MYCPA RecName: Full=50S ribosomal protein L11;
   30::135     9e-22  43%  137 aa  RL11_MYCGE RecName: Full=50S ribosomal protein L11;
    4::142     9e-22  38%  142 aa  RL11_MYCA1 RecName: Full=50S ribosomal protein L11;
   33::139     1e-21  42%  140 aa  RL11_SULMW RecName: Full=50S ribosomal protein L11;
   34::144     2e-21  47%  145 aa  RL11_RICTY RecName: Full=50S ribosomal protein L11;
    3::141     4e-21  41%  142 aa  RL11_PROVU RecName: Full=50S ribosomal protein L11;
    4::142     6e-21  38%  142 aa  RL11_MYCLE RecName: Full=50S ribosomal protein L11;
    4::142     6e-21  38%  142 aa  RL11_MYCLB RecName: Full=50S ribosomal protein L11;
    3::142     1e-20  39%  142 aa  RL11_BUCAT RecName: Full=50S ribosomal protein L11;
    3::142     1e-20  39%  142 aa  RL11_BUCAI RecName: Full=50S ribosomal protein L11;
    3::142     1e-20  39%  142 aa  RL11_BUCA5 RecName: Full=50S ribosomal protein L11;
    3::146     2e-20  42%  148 aa  RL11_HYPNA RecName: Full=50S ribosomal protein L11;
    3::141     6e-20  38%  142 aa  RL11_EDWI9 RecName: Full=50S ribosomal protein L11;
   29::141     1e-17  34%  158 aa  RL11_UNCMA RecName: Full=50S ribosomal protein L11P;
   29::141     2e-17  39%  163 aa  RL11_HALSA RecName: Full=50S ribosomal protein L11P;
   29::141     2e-17  39%  163 aa  RL11_HALS3 RecName: Full=50S ribosomal protein L11P;
   30::141     2e-17  37%  157 aa  RL11_ARCFU RecName: Full=50S ribosomal protein L11P;
   30::141     5e-17  40%  165 aa  RL11_THEGJ RecName: Full=50S ribosomal protein L11P;
    3::139     8e-17  37%  145 aa  RM11_RECAM RecName: Full=60S ribosomal protein L11, mitochondrial;
   30::143     1e-16  39%  159 aa  RL11_METM7 RecName: Full=50S ribosomal protein L11P;
   30::143     1e-16  39%  159 aa  RL11_METM6 RecName: Full=50S ribosomal protein L11P;
   30::143     1e-16  37%  159 aa  RL11_METVS RecName: Full=50S ribosomal protein L11P;
   29::141     3e-16  35%  161 aa  RL11_METMA RecName: Full=50S ribosomal protein L11P;
   29::141     3e-16  35%  161 aa  RL11_METAC RecName: Full=50S ribosomal protein L11P;
   30::141     4e-16  40%  163 aa  RL11_THEON RecName: Full=50S ribosomal protein L11P;
   31::144     4e-16  38%  164 aa  RL11_PYRHO RecName: Full=50S ribosomal protein L11P;
   31::141     4e-16  39%  164 aa  RL11_PYRFU RecName: Full=50S ribosomal protein L11P;
   29::144     4e-16  40%  162 aa  RL11_HALMA RecName: Full=50S ribosomal protein L11P;AltName:
   29::136     5e-16  38%  161 aa  RL11_METBU RecName: Full=50S ribosomal protein L11P;
   30::139     7e-16  38%  159 aa  RL11_METMP RecName: Full=50S ribosomal protein L11P;
   30::143     7e-16  38%  159 aa  RL11_METM5 RecName: Full=50S ribosomal protein L11P;
   30::143     7e-16  36%  166 aa  RL11_METKA RecName: Full=50S ribosomal protein L11P;
   30::143     9e-16  35%  161 aa  RL11_METJA RecName: Full=50S ribosomal protein L11P;
   31::141     2e-15  38%  164 aa  RL11_PYRAB RecName: Full=50S ribosomal protein L11P;
   29::141     2e-15  35%  161 aa  RL11_METBF RecName: Full=50S ribosomal protein L11P;
   29::141     2e-15  35%  163 aa  RL11_NATPD RecName: Full=50S ribosomal protein L11P;
   30::143     3e-15  35%  170 aa  RL11_DESK1 RecName: Full=50S ribosomal protein L11P;
   30::141     5e-15  37%  165 aa  RL11_PYRKO RecName: Full=50S ribosomal protein L11P;
   29::141     6e-15  34%  158 aa  RL11_HALLT RecName: Full=50S ribosomal protein L11P;
   32::143     1e-14  31%  146 aa  RL11_WOLPM RecName: Full=50S ribosomal protein L11;
   31::141     1e-14  35%  160 aa  RL11_METST RecName: Full=50S ribosomal protein L11P;
   29::141     1e-14  31%  158 aa  RL11_METB6 RecName: Full=50S ribosomal protein L11P;
   30::143     3e-14  33%  156 aa  RL11_THEAC RecName: Full=50S ribosomal protein L11P;
   29::141     5e-14  29%  157 aa  RL11_METLZ RecName: Full=50S ribosomal protein L11P;
   30::139     7e-14  33%  160 aa  RL11_META3 RecName: Full=50S ribosomal protein L11P;
   30::143     9e-14  33%  159 aa  RL11_NITMS RecName: Full=50S ribosomal protein L11P;
   36::142     1e-13  38%  144 aa  RM19_SCHPO RecName: Full=60S ribosomal protein L19,
   47::141     1e-13  36%  159 aa  RL11_HALVO RecName: Full=50S ribosomal protein L11P;AltName:
   30::141     1e-13  33%  160 aa  RL11_METS3 RecName: Full=50S ribosomal protein L11P;
   29::158     1e-13  29%  158 aa  RL11_METHJ RecName: Full=50S ribosomal protein L11P;
   34::156     2e-13  36%  158 aa  RM19_YEAST RecName: Full=54S ribosomal protein L19,
   29::144     2e-13  38%  157 aa  RL11_HALWD RecName: Full=50S ribosomal protein L11P;
   31::141     2e-13  33%  160 aa  RL11_METTH RecName: Full=50S ribosomal protein L11P;
   30::143     6e-13  31%  168 aa  RL11_HYPBU RecName: Full=50S ribosomal protein L11P;
   30::143     1e-12  31%  170 aa  RL11_SULAC RecName: Full=50S ribosomal protein L11P;
   29::140     1e-12  31%  159 aa  RL11_METTP RecName: Full=50S ribosomal protein L11P;
   48::157     6e-12  33%  196 aa  RM11_DROME RecName: Full=39S ribosomal protein L11, mitochondrial; 
   31::140     8e-12  34%  159 aa  RL11_KORCO RecName: Full=50S ribosomal protein L11P;
   30::141     1e-11  29%  158 aa  RL11_METPE RecName: Full=50S ribosomal protein L11P;
   29::139     2e-11  28%  158 aa  RL11_METMJ RecName: Full=50S ribosomal protein L11P;
   32::142     4e-11  28%  155 aa  RL11_PICTO RecName: Full=50S ribosomal protein L11P;
   44::173     5e-11  31%  192 aa  RM11_HUMAN RecName: Full=39S ribosomal protein L11, mitochondrial; 
   30::143     5e-11  28%  170 aa  RL11_SULIM RecName: Full=50S ribosomal protein L11P;
   44::173     7e-11  31%  192 aa  RM11_BOVIN RecName: Full=39S ribosomal protein L11, mitochondrial; 
   30::143     2e-10  28%  170 aa  RL11_SULIY RecName: Full=50S ribosomal protein L11P;
   30::143     2e-10  28%  170 aa  RL11_SULIL RecName: Full=50S ribosomal protein L11P;
   30::143     2e-10  28%  170 aa  RL11_SULIK RecName: Full=50S ribosomal protein L11P;
   30::143     2e-10  28%  170 aa  RL11_SULIA RecName: Full=50S ribosomal protein L11P;
   30::143     3e-10  27%  170 aa  RL11_SULSO RecName: Full=50S ribosomal protein L11P;
   30::143     4e-10  27%  170 aa  RL11_SULIN RecName: Full=50S ribosomal protein L11P;
   30::153     6e-10  29%  170 aa  RL11_SULTO RecName: Full=50S ribosomal protein L11P;
   40::143     6e-10  27%  160 aa  RL11_NANEQ RecName: Full=50S ribosomal protein L11P;
   30::141     1e-09  28%  141 aa  RL11_ACIAM RecName: Full=50S ribosomal protein L11P;Flags:
    9::81      2e-09  38%  108 aa  RL11_AERPE RecName: Full=50S ribosomal protein L11P;
   44::155     3e-09  29%  203 aa  RM11_RAT RecName: Full=39S ribosomal protein L11, mitochondrial;   
   47::160     3e-09  31%  195 aa  RM11_CAEEL RecName: Full=Probable 39S ribosomal protein L11,
   30::143     5e-09  26%  158 aa  RL11_THEVO RecName: Full=50S ribosomal protein L11P;
   44::155     6e-09  29%  192 aa  RM11_MOUSE RecName: Full=39S ribosomal protein L11, mitochondrial; 
   62::144     5e-08  28%  168 aa  RL11_METS5 RecName: Full=50S ribosomal protein L11P;
   54::141     3e-07  27%  167 aa  RL11_PYRAE RecName: Full=50S ribosomal protein L11P;
   50::146     2e-05  33%  165 aa  RL12_CAEEL RecName: Full=60S ribosomal protein L12;
   50::146     2e-05  33%  165 aa  RL12_CAEBR RecName: Full=60S ribosomal protein L12;
   43::139     3e-04  25%  157 aa  RL12_CHLRE RecName: Full=60S ribosomal protein L12;Flags: Fragment;
   52::150     5e-04  23%  166 aa  RL123_ARATH RecName: Full=60S ribosomal protein L12-3;
   52::150     5e-04  23%  166 aa  RL122_ARATH RecName: Full=60S ribosomal protein L12-2;
   52::150     5e-04  23%  166 aa  RL121_ARATH RecName: Full=60S ribosomal protein L12-1;
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAEKKQTGFIKLQIXXXXXXXXXXXXXXXXXXXVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
RL11_STRSF      --KKKVTGLIKLQIKXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFV
RL11_STRLA      --KKKVTGLIKLQIKXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRTFTFI
RL11_CHLPB      ---KKVVGFIKLQIXXXXXXXXXXXXXXLGQKGVNIMEFCKQFNAKTQSQSGTIIPVVITVYSDKSFTFI
RL11_CLOB8      ---KKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGYIIPVVITVYQDRSFSFI
RL11_STRVG      --KKKVTGLIKLQIKXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGMVVPVEITVYDDRSFTFI
RL11_LEIXX      --KKKVTGLIKLQXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFV
RL11_NOCSJ      --KKKIAALVKVQLQXXXXXXXXXXXXXXXXHGVNIMEFCKAYNAQTESMRGNVIPVEITIYEDRSFTFI
RL11_CLOPS      ---KKVTGMIKLQLPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADKAGLIIPVVITVYQDRSFSFI
RL11_CLOPE      ---KKVTGMIKLQLPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADKAGLIIPVVITVYQDRSFSFI
RL11_CLOP1      ---KKVTGMIKLQLPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADKAGLIIPVVITVYQDRSFSFI
RL11_STRVN      --KKKVTGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFI
RL11_STRLI      --KKKVTGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFI
RL11_STRCO      --KKKVTGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFI
RL11_CLOTE      ---KKVTGMIKLQLAAGKASPAPPVGPALGQHGVNIMAFCKEFNEKTAKQAGLIIPVVITVYQDRSFSFI
RL11_STRGR      --KKKVTGLIKLQIXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFV
RL11_STRGG      --KKKVTGLIKLQIXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFV
RL11_CLOBB      ---KKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOBA      ---KKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_MICLC      --KKKVTGLIKLXXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATESQRGNVVPVEITVYEDRSFTFV
RL11_GEOSM      ---KKITGYIKLQVPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFTFI
RL11_GEOBB      ---KKITGYIKLQVPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFTFI
RL11_STRAW      --KKKVTGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFI
RL11_PELPB      ---KKVLGFIKLQIXXXXXXXXXXXXXXLGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYSDKSFTFI
RL11_CLOBM      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOBL      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOBK      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOBJ      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOBH      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOB6      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_CLOB1      ---KKVVGMIKLQLPAGKASPAPPVGPALGQHGVNIMGFCKEFNAKTANQAGLIIPVVITVYQDRSFSFI
RL11_TRIEI      ---KKVVAVIKLAITAGKANPSPPIGPALGQHGVNIMAFCKEYNAKTADQAGTVVPVEISVYEDRSFTFV
RL11_PROA2      ---KKVVGFIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQSQAGTIIPVVITVFSDKSFTFI
RL11_SYNJA      ---KKLVAVVKLAIQAGKATPAPPIGPALGQHGVNIMAFCKEYNAKTADQAGMVVPVEISIYEDRSFTFV
RL11_GEOTN      ---KKVIKIVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_GEOSF      ---KKITGYIKLQVPAGKANPAPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFTFV
RL11_GEOKA      ---KKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_CLOD6      ---KKVIGQIKLQIPAGKATPAPPVGPALGQHGVNIMGFTKEFNAKTADQAGMIIPVVITVYQDRSFSFI
RL11_EXISA      ---KKVSKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVVITVYEDRSFTFI
RL11_ACIC1      --KKKITAVIKLQINAGQATPAPPIGPALGQHGVNIMEFCKQYNAATESQRGNVVPVEITVYEDRSFTFV
RL11_KINRD      --KKKVAGLIKLQIKAGQATPAPPIGPALGQHGVNIMEFCKAYNAQTESQRGNVIPVEITVYEDRSFTFI
RL11_GEOUR      ---KKITGYIKLQIPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQAEEGTITPVVITVFADRSFSFI
RL11_GEOSW      ---KKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_CHLT3      ---KKIVGYIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQPQAGMIIPVVITVFSDKSFTFV
RL11_SYNJB      ---KKLVAVVKLAIQAGKATPAPPIGPALGQHGVNIMAFCKEYNAKTADQAGMVVPVEISIFEDRSFTFV
RL11_HALOH      ---KKVIGKIKLQIPAGKANPAPPVGPALGQHGVNIMEFCKAFNAKTQDQAGMIIPVEITVYADRSFDFI
RL11_CHLTE      ---KKITGFIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYSDKSFTFV
RL11_SYMTH      ---KKVTAVIKLALPAGKATPAPPVGPALGAHGVNIMAFCKEYNERTKDQVGLVIPVEITVYEDRSFTFI
RL11_PROAC      ---------------------------------VNIMEFCKAYNAQTEGQRGNIVPVEITIYEDRTFSFV
RL11_FINM2      ---KKVQAIVKLQIPAGKATPAPPVGTALGPHGVNIMQFTKEFNAKTQDQMGMIIPVVMTVYQDRSFTFI
RL11_CYAP8      ---KKVVAMIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTADQAGMVIPVEISVFEDRSFTFV
RL11_OCEIH      ---KKVIKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGMIIPVEITVFEDRSFTFI
RL11_BACSK      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEITVFEDRSFTFI
RL11A_BACHD     ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEITVFEDRSFTFV
RL11_BACWK      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACST      ---------------------------------VNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACLD      ---KKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEISVYEDRSFTFI
RL11_BACHK      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACCZ      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACCN      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC7      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC4      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC3      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC2      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC1      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACC0      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACAN      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACAC      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_BACAA      ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_CLOK5      ---KKVVGMIKLQLPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTVKQEGLIIPVVITVYQDRSFSFV
RL11_BACSU      ---KKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISVYEDRSFTFI
RL11_BACA2      ---KKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISVYEDRSFTFI
RL11_ALKMQ      ---KKVVGQIKLQIPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADQAGMIIPVIISVYQDRSYTFI
RL11_THEEB      ---KKVVAVIKLAIQAGKANPAPPIGPALGQHGVNIMMFCKEYNARTADQVGMVVPVEISVYEDRSFTFV
RL11_STACT      ---KKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFI
RL11_MICAN      ---KKVVAIIKLALPAGKANPAPPVGPALGQHGVNIMAFCKDYNAKTADQAGMIIPVEISVFEDRSFTFV
RL11_GEOSL      ---KKITGYIKLQIPAAKANPSPPIGPALGQHGVNIMEFCKAFNAKTQADEGTIIPVVITVYADRSFTFI
RL11_FRASN      --KKKITALIKLQINAGKATPAPPVGPALGQHGVNIMEFCKQYNAATESQTGNVVPVEITVYDDRSFTFV
RL11_CLOAB      ---KKVVGLIKLQLPAGKATPAPPVGPALGQHGVNIMAFCKEYNAKTANQAGFTIPVVITVYQDRSFSFI
RL11_CHLP8      ---KKITGFIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVFSDKSFTFV
RL11_ACAM1      ---------------------------------VNIMMFCKEYNAKTSDQAGLVVPVEISVYEDRSFTFI
RL11_PELLD      ---KKVIGFIKLQIXXXXXXXXXXXXXXLGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVFSDKSFTFI
RL11_BREBN      ---KKVIRVIKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTESEVGMIIPVEITVFEDRSFTFI
RL11A_BACCR     ---KKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFI
RL11_ARTAT      --KKKVTGLIKLXXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFI
RL11_GEOMG      ---KKITGYIKLQIPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQGDEGTITPVVITVYADRSFSFI
RL11_EXIS2      ---KKVMKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVVITVFEDRSFTFI
RL11_CYAP7      ---KKIVAIIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNGKTSDQVGMVIPVEISVFEDRSFTFV
RL11_CYAP4      ---KKVVAIIKLAITAGKANPAPPIGPALGQHGVNIMMFCKEYNARTADQAGLVIPVEISVYEDRSFTFI
RL11_ANAVT      ---KKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISVYEDRSFTFV
RL11_ANASP      ---KKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISVYEDRSFTFV
RL11_CLONN      ---KKVVGMIKLQLPAGKATPAPPVGPALGQHGVNIMAFCKEYNAKTANQAGMTIPVIISVYQDRSFSFI
RL11_GEOLS      ---KKITGYIKLQIPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFSFI
RL11_CYAA5      ---KKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTSDQAGMVIPVEISVFEDRSFTFV
RL11_LYSSC      ---KKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISVFEDRSFTFI
RL11_ARTS2      --KKKVTGLIKLXXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFI
RL11_ARTCA      --KKKVTGLIKLXXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFI
RL11_PELPD      ---KKITGYIKLQVPAGKANPAPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFTFI
RL11_STAAW      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAT      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAS      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAR      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAN      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAM      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAAB      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAA9      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAA8      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAA3      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAA2      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_STAA1      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_TROWT      MADKKVVGVIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQKGNVIPVEISVYEDRSFTFV
RL11_TROW8      MADKKVVGVIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQKGNVIPVEISVYEDRSFTFV
RL11_THENN      ---KKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
RL11_PROVI      ---KKVIGFIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYTDKSFTFI
RL11_GLOVI      ---KKVSAKIKLALPAGKANPAPPVGPALGQHGVNIMMFCKEYNARTADQVGMVIPVEITVFEDRSFTFV
RL11_SYNP2      ---------------------------------VNIMAFCKEYNAKTSDQAGMIIPVEISVYEDRSFTFI
RL11_STAHJ      ---KKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFI
RL11_STAES      ---KKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFI
RL11_STAEQ      ---KKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFI
RL11_THEAB      ---KKVVAQVRLQLEAGKATPAPPVGPALGQRGVNLMEFCKKFNAATADKAGMIIPVIITVYEDRSFTFI
RL11_DICTD      ---KKVVGKVKLQLPAGKATPAPPVGPALGQYGVNIMEFCKAYNAATAGQEGMIIPVEITIYEDRSFTFV
RL11_DICT6      ---KKVVGKVKLQLPAGKATPAPPVGPALGQYGVNIMEFCKAYNAATAGQEGMIIPVEITIYEDRSFTFV
RL11_DESHY      ---KKVVGLVKLAINAGKANPAPPVGPALGQHGVNIMAFCKEYNERTKDQAGLIIPVEITVYEDRSFTFI
RL11_DESHD      ---KKVVGLVKLAINAGKANPAPPVGPALGQHGVNIMAFCKEYNERTKDQAGLIIPVEITVYEDRSFTFI
RL11_CHLL2      ---KKIIGFIKLQIXXXXXXXXXXXXXXLGQKGVNIMEFCKQFNAKTQSEAGMITPVVITVYSDKSFTFV
RL11_ALHEH      ---KKVSAYIKLQVGAGKANPSPPVGPALGQHGVNIMEFCKAFNAQTQEEAGLPVPVVITVYNDRSFTFI
RL11_STAAC      ---KKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFI
RL11_NATTJ      ---KKVAQVIKLQIPAGKATPAPPVGPALGQHGVNIMSFCKEFNEQTANQEGMLIPVEITVYEDRSFTFI
RL11_LACPL      ---KKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFI
RL11_CHLCH      ---KKVIGFIKLQIXXXXXXXXXXXXXXXXQKGVNIMEFCKQFNAKTQADAGTIIPVVITVYSDKSFTFI
RL11_PELCD      ---KKVVGLIKLQIPAGKANPSPPVGPALGQHGVNIMEFCKAFNAKTQAQDGMIIPVVITVFADRSFSFI
RL11_THEPX      ---KKVAAVVKIQLPAGKATPAPPVGTALGPHGVNIMAFCKEFNERTAKDAGLIIPVVITIYADRSFSFI
RL11_THEP3      ---KKVAAVVKIQLPAGKATPAPPVGTALGPHGVNIMAFCKEFNERTAKDAGLIIPVVITIYADRSFSFI
RL11_NOSP7      ---KKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISVFEDRSFTFV
RL11_MOOTA      ---KKVAAIVKLQVPAGKATPAPPVGPALGQHGVNIMAFVKEFNDRTASQAGLIIPVEITVYEDRSFTFI
RL11_CHRSD      ---KKVQAYIKLQVAAGKANPSPPVGPALGQHGVNIMEFCKAFNAETQDEPGLPTPVVITVYSDRSFTFI
RK11_PORYE      ---KKVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTADKSGLVIPVEISIYEDRSFTFI
RL11_CLOTH      ---KKVVGYIKLQIPAGKATPAPPVGPALGQHGVNIMAFCKEFNERTAKDAGLVIPVVITVYADRSFSFV
RL11_CHLPD      ---KKIIGFIKLQIXXXXXXXXXXXXXXLGQKGVNIMEFCKQFNAKTQAEAGMITPVVITVYSDKSFTFI
RL11_THESQ      ---KKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
RL11_THEMA      ---KKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
RL11_FLAJ1      ---KEISKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKPGKICPVQITVYKDKSFDFV
RL11_RUTMC      ---KKIESYIKLQVAAQEANPSPPVGPALGQHGVNIMEFCKAFNVKTQDDKGMKVPVVITVYSDRSFTFV
RL11_PETMO      ---KKLLRVVKLQLEAGKATPAPPVGPALGQYGVNLMEFCKKFNAATADQAGTLLPVEISVFEDRSFTFI
RL11_LACCB      ---KKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFV
RL11_LACC3      ---KKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFV
RL11_HERA2      ---KKVTAVVKLQLPAGKATPAPPVGPALGATGINIMAFCKDYNEKTSAQVGTIIPVEITVYSDRSFTYI
RL11_FRASC      ---------------------------------VNIMEFCKQYNAATESQAGNVVPVEITVYDDRSFTFV
RL11_EUBR3      ---KKVEGYIKLQIPAGKATPAPPVGPALGQHGVNIVEFTKQFNAKTADQGDLIIPVVITVYADRSFSFI
RL11_ALKOO      ---KKIVGQIKLQINAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADQAGLIIPVVISVYQDRSYSFI
RK11_PORPU      ---KKVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTADKTGLVIPVEISVYEDRSFSFI
RL11_STAS1      ---KKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEDAGLIIPVEISVYEDRSFTFI
RL11_LACF3      ---KKVANVVKLQIXXXXXXXXXXXXXXLGQAGINIMGFTKEFNARTADQKGMLIPVVITVYEDRSFDFI
RL11_DESRM      ---KKVAAIIKLQIPAGKATPAPPVGPALGQHGVNIMGFVKQYNEVTAAQAGLIIPVEITVYEDRSFTFV
RL11_DESAD      ---KKEIGKIKLQIPAGSANPSPPVGPALGQHGVNIMEFCKAFNAKTQDQKGMIIPVIITVYQDRSFSFI
RL11_THEP1      ---KKVTAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
RL11_HALHL      ---KKIEAYIKLQVPAGQANPSPPVGPALGQHGLNIMEFCKAFNAQTQEMEGGLIPVVITVYSDRSFTFV
RL11_CLOPH      ---KKVTGYIKLQIPAAKATPAPPVGPALGQHGVNIVQFTKEFNARTANQEGMIIPVVITVYADRSFSFI
RL11_BURM1      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_SYNE7      ---KKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKVGLVIPVEISVFEDRSFTFI
RL11_PRB01      ---KKVANILKLQIPAGGANPSPPVGPALGQVGVNIMDFCNAFNAETQSEKGMPLPVVITVYEDKSFTFV
RL11_FUSNN      ---KEVIQIIKLQLPAGKANPAPPVGPALGQHGVNIMEFCKAFNAKTQDKAGWIIPVEISVYSDRSFTFI
RL11_STRS2      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFI
RL11_LACSS      ---KKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGLLIPVVITVYEDRSFDFV
RL11_HAHCH      ---KKVNAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAKTQNEPGLPTPVVITVYSDRSFTFI
RL11_GEMAT      ---KKVTGFVKLQIPAGKANPAPPVGTALGPQGINIMGFCKEFNARTQG-GDMIIPVEVTIYADKSFTFI
RL11_DESDA      ---KKEVAKIKLQIPAGAANPSPPVGPALGQHGLNIMGFCKEFNARTQDQKGMIIPVVITVYADRSFTFI
RL11_CARHZ      ---KKVVAVVKLQIPAGKATPAPPVGPALGQHGVNIMAFVKEYNERTAQQAGMIIPVEITVYEDRSFTFV
RL11_BURTA      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURPS      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURP6      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURP1      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURP0      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURMS      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURMA      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURM9      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_BURM7      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAYADKSFTFV
RL11_THETN      ---KKVVAVVKIQLPAGKATPAPPVGTALGPHGVNIMAFCKEFNERTAKDAGLIIPVVITIYSDRSFSFI
RL11_SYNY3      ---KKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTADKPGMIIPVEISVFEDRSFTFI
RL11_STRPI      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_DESPS      ---KKAMAYIKLQIPAGKANPSPPVGPALGQHGVNIMEFCKGFNARTQSMGDTIVPVVITVYQDRSFSFI
RL11_DEIRA      ---KKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFI
RL11_STRZT      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRZP      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRZJ      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRR6      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRPS      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRPN      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRPJ      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRP7      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRP4      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRP2      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_PERMH      ---KKVVGTIELMIPAQQASPSPPVGPALGQHGVNIMEFVKSFNAATAEMKGTVVPVVITVYADRSFTFI
RL11_LACBA      ---KKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDRSFDFI
RL11_BURVG      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURCM      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURA4      ---KKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_SYNP6      ---KKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKVGLVIPVEISVFEDRSFTFI
RL11_STRSV      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_STRPZ      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPM      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPG      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPF      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPD      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPC      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRPB      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRP8      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRP6      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRP3      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRP1      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_SALTO      ---------------------------------VNIMEFCKSYNAQTESQRGDIVPAEISVYEDRTFTFV
RL11_SALAI      ---------------------------------VNIMEFCKSYNAQTESQRGDIVPAEISVYEDRTFTFV
RL11_LACRJ      ---KKVANIVKLQIXXXXXXXXXXXXXXLGQAGINIMGFTKEFNARTADQKGMLIPVVITVYEDRSFDFI
RL11_LACRD      ---KKVANIVKLQIXXXXXXXXXXXXXXLGQAGINIMGFTKEFNARTADQKGMLIPVVITVYEDRSFDFI
RL11_BURS3      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURCJ      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURCH      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURCC      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_BURCA      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGEPGLPVPVVITAFADKSFTFV
RL11_ALTMD      ---KKVSGIIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAKTESEKGAPVPVEITVYEDRSFTFE
RL11_STRGC      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFV
RL11_LACS1      ---KNVVNVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDRSFDFV
RL11_HAEDU      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESEKGLPIPVVITVYADRSFTFV
RL11_CLOCE      ---KKIAGYVKLQIPAGKATPAPPVGPALGQHGVNIMGFCKEFNERTAKDAGLVIPVVITVYADRSFSFI
RL11_BURP8      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQAEPGLPIPVVITAFADKSFTFV
RL11_ACTP7      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESEKGLPIPVVITVYADRSFTFV
RL11_ACTP2      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESEKGLPIPVVITVYADRSFTFV
RL11_THIDA      ---KKIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_THELT      ---KKVVAEVKLQLPAGKATPAPPVGPALGQRGVNIMEFCKRFNAETADKAGMILPVIITVYEDRSFSFV
RL11_SYNAS      ---KKVIANIKLQIKAGKATPSPPIGPALGQHGVNIMEFCKAYNALTQSQEGMVIPVVITVYADRSFSFV
RL11_STRU0      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVITVYEDKSFDFI
RL11_STRS7      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STREM      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRE4      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRAT      --KKKVTGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCRAYNAATESQRGWVIPVEITVYEDRSFTFI
RL11_LACAC      ---KKVINVVKLQIXXXXXXXXXXXXXXLGQAGINIVGFTKDFNARTADQKGMIIPVVITVYEDRSFEFI
RL11_PEDPA      ---KKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGLLIPVVITVYEDRSFDFV
RL11_MARAV      ---KKIEAYIKLQVAAGQANPSPPVGPALGQRGVNIMEFCKAFNAKTQGEPGLPIPTVITVYSDRSFTFI
RL11_LEGPL      ---KKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQEQGLPIPVVITVYSDRSFTFI
RL11_LEGPH      ---KKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQEQGLPIPVVITVYSDRSFTFI
RL11_LEGPC      ---KKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQEQGLPIPVVITVYSDRSFTFI
RL11_LEGPA      ---KKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQEQGLPIPVVITVYSDRSFTFI
RL11_IDILO      ---KKVSAIIKLQVAAGSANPSPPVGPALGQHGVNIMEFCKAFNAQTDSEKGAPVPVEITVFEDRSFTFI
RL11_DEIDV      ---KKITGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIFADRSFTFI
RL11_BORPD      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_STRTD      ---KKVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRT2      ---KKVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRT1      ---KKVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRSY      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFI
RL11_FERNB      ---------------------------------VNLMEFCKKFNAVTADKAGLLIPVIVTVYDDRSFTFI
RL11_DEIGD      ---KKVAGLVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFI
RL11_BURXL      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQAEPGLPIPVVITAFADKSFTFV
RL11_THISH      ---KKIDAYIKLQVKAGQANPSPPVGPALGQRGVNIMEFCKAFNAQTQGEPGLPIPVVITVYSDRSFTFI
RL11_SYNFM      MAKKVVTN-IKLQVPAGQANPSPPIGPALGQHGVNIMEFCKAFNARTQGQEGMIIPVVITVYADRSFTFI
RL11_ROSCS      ---KKVTGVVKLQLPAGKATPAPPVGPALGGYGINIMAFVKEYNEKTASQAGSIIPVEVTIYSDRSFTIT
RL11_HELMI      ---KKVVAVVKLQCPAGKANPAPPVGPALGQHGVNIMAFCKQYNEATAAQAGLIIPVEITVYEDRSFTFV
RL11_BORPA      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_BORBR      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_PSEA6      ---KKVTGIIKLQVAAGAANPSPPVGPALGQKGVNIMEFCKAFNAKTGDEKGSPVPVEITVYEDRSFTFE
RL11_LEPBP      MAAKKVVKQIKLQVEAGKANPAPPVGPALGQAGLNIMEFCKQFNERSKNQMGLKLPVVITVYSDRSFTFV
RL11_LEPBA      MAAKKVVKQIKLQVEAGKANPAPPVGPALGQAGLNIMEFCKQFNERSKNQMGLKLPVVITVYSDRSFTFV
RL11_LACLA      ---KQVEKLVKLQIPAGKATPAPPVGPALGQAGVNIMGFTKEFNARTADQAGMIIPVVISVYDDKSFTFI
RL11_CALS8      ---KKVLTQIKLQIPAGKATPAPPVGPALGQHGVNIMQFCKEFNERTAKDAGLIIPVVITVYSDRSFTFI
RL11_BORPE      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGMEGLPIPVVITAFADKSFTFI
RL11_BORA1      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_VARPS      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQSEPGLPLPVVITAFADKSFTFI
RL11_SULSY      ---KKVTGQVELMIPAQQAAPSPPVGPALGQHGVNIMEFVKSFNAATANMKGTIVPVVITIYSDRSFTFI
RL11_POLSQ      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQSEPGLPIPVVITAFADKSFTFI
RL11_POLSJ      ---KKIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAYADKSFTFI
RL11_LAWIP      ---KKELAKIKLQIPAGVANPSPPVGPALGQHGLNIMQFCKEFNARTQDQKGMIIPVVITAYADRSFTFI
RL11_LARHH      ---KKIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPIPVVITAYADKSFTFI
RL11_FLAPJ      ---KEVSKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKAGKVCPVQITVYKDKSFDFV
RL11_STRA5      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_STRA1      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_RHOPT      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_RHOPA      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_POLNA      ---KKIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAYADKSFTFI
RL11_PHEZH      ---KKILGYIKLQVPAGAATPSPPIGPALGQRGVNIMGFCKEFNARTEEQKGTPLPTVITVYQDKSFTFV
RL11_NITEC      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRQLNIMEFCKAFNAATQKEPGLPVPVVITAYADKSFTFV
RL11_LEPCP      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLKLPVVITAYADKSFTFI
RL11_CORDI      --KKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFX
RL11_SYNR3      ---KKVTAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_SYNPX      ---KKVTAVIKLALQAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGFVIPVEISVYEDRSFTFI
RL11_STRMU      ---KKVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFV
RL11_STRA3      ---KKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFI
RL11_POLNS      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQSEPGLPIPVVITAFADKSFTFI
RL11_LACLS      ---KQVEKLVKLQIPAGKATPAPPVGPALGQAGVNIMGFTKEFNARTADQAGMIIPVVISVYDDKSFTFI
RL11_LACLM      ---KQVEKLVKLQIPAGKATPAPPVGPALGQAGVNIMGFTKEFNARTADQAGMIIPVVISVYDDKSFTFI
RL11_BURPP      ---KKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQAEPGLPTPVVITAFADKSFTFV
RL11_SALRD      ---------IKLQIKGGQANPAPPIGPALGQHGVNIMEFCKAFNSRTEDRMGTLLPVEITVYADRSFDFI
RL11_ROSS1      ---KKVTGVVKLQLPAGKATPAPPVGPALGGYGINIMAFVKEYNEKTASQAGSVVPVEVTVYSDRSFTIT
RL11_RHOPB      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_PELTS      ---KRVAAIVKLQVPAGKATPAPPVGPALGQHGVNIMAFVKEYNERTAAQAGLIIPVEITVYEDRSFTFV
RL11_NITWN      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_GRAFK      ---KEVSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNGRTQDKQGKVLPVAITVYKDKSFDFV
RL11_CORK4      --KKKVSGFIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATEDQRGNVVPVEITVYEDRSFTFX
RL11_SYNPW      ---KKVTAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_PROMA      ---KKITAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_NITOC      ---KKIEAYIRLQVPAGQANPSPPVGPALGQRGVNIMEFCKTFNAQTQGEQGMPIPVVITVYSDRSFTFV
RL11_KOCRD      --KKKVAGLIKLQIQXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAATESQRGNIVPVEITVYEDRSFSFI
RL11_DEHSC      ---KKVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNERTASMVGTIVPAEITIYDDRSFTFI
RL11_AZOSB      ---KKIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGEPGLPIPVVITAFADKSFTFI
RL11_ALCBS      ---KKVQAYIKLQVAAGQANPSPPVGPALGQHGVNIMEFCKAFNAQTQQDAGAPVPVVITVYNDRSFTFT
RL11_RHOP2      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_PROMM      ---KKVVSVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGLVIPVEISVFEDRSFTFI
RL11_DESMR      ---KKITAKVKLQLPAGSANPSPPVGPALGQHGVNIMEFCKAFNAKTMEQKGTIIPALITIYADRSFTFI
RL11_DEHSB      ---KKVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNERTASMVGTIVPAEITIYDDRSFTFI
RL11_DEHE1      ---KKVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNDRTASMAGTIVPAEITIYDDRSFTFI
RL11_BDEBA      ---KKVTGMIKLQIPAGKANPAPPVGPALGQHGVNIMEFCKQFNARTQALGDSIIPIIITVYQDRSFTFI
RK11_PHATR      ---KKITALIKLALPASKATPAPPVGPALGQHGVNIAAFCKEYNARTNDKAGLIIPVEISVYEDRSYTFV
RL11_VESOH      ---KKIESYIKLQVAAQEANPSPPVGPALGQHGVNIMEFCKAFNSKTQENKGMKVPVVITVYSDRSFSFV
RL11_BACTN      ---KEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFV
RL11_BACFR      ---KEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFV
RL11_BACFN      ---KEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFV
RL11_ANATD      ---KKVLTQIKLQIPAGKATPAPPVGPALGQHGVNIMQFCKEFNERTAKDAGLIIPVVITVYSDRSFTFI
RK11_SPIOL      ---KKVIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPGFVIPVEITVFDDKSFTFI
RL11_THEFY      ---------------------------------VNIMEFCKQYNAATESQRGNIIPVEISIYEDRSFSFV
RL11_RHILO      ---KKIAGQLKLQVSAGSATPSPPIGPALGQRGINIMEFCKAFNAQTQEEKGSPVPVVITYYQDKSFTFV
RL11_SYNSC      ---KKVVAVIKLALDAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGYVIPVEISVFEDRSFTFI
RL11_LACDB      ---KKVINVVKLQIXXXXXXXXXXXXXXLGQAGINIVGFTKDFNARTADQKGMIIPVVITVYEDRSFDFV
RL11_LACDA      ---KKVINVVKLQIXXXXXXXXXXXXXXLGQAGINIVGFTKDFNARTADQKGMIIPVVITVYEDRSFDFV
RL11_CLAMS      --KKKVTGLIKLQIKXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAQTESQRGNVIPVEITVYEDRTFTFI
RL11_BACV8      ---KEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFV
RL11_ACIF5      ---KKITGYIKLQVKAAQANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITVFADKSFTFE
RL11_ACIF2      ---KKITGYIKLQVKAAQANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITVFADKSFTFE
RK11_ODOSI      ---KKITALIKLALPAGKATPAPPVGPALGQHGVNIAAFCKEYNAKTTDKTGLIIPVEISVYEDRSYTFI
RK11_ARATH      ---------------------------------VNIMAFCKDYNARTADKAGYIIPVEITVFDDKSFTFI
RL11_YERPG      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_SOLUE      ---KKVTAQVKLQIPAGKATPAPPVGTALGPQGVNIMDFCKAYNAKTKDQEGLIIPVVITIYSDRSFTFI
RL11_RHOPS      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_PROM4      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTQDKAGFVIPVEISVFEDRSFTFI
RL11_SYNS3      ---KKVVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGYVIPVEISVFEDRSFTFI
RL11_SPHWW      ---KKITGYIKLQVPAGKANPSPPIGPALGQRGVNIMDFCKAFNAQTGDEVGTPLPTIITVYADRSFSFV
RL11_PROMS      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_PROMP      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_PROM2      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_PROM0      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_MESSB      ---KKIAGQLKLQVPAGSATPSPPIGPALGQRGINIMEFCKAFNAQSQDEKGSPIPVVITYYQDKSFTFT
RL11_CLAM3      --KKKVTGLIKLQIKXXXXXXXXXXXXXXXQHGVNIMEFCKAYNAQTEAQRGNVIPVEITVYEDRTFTFI
RL11_NITHX      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_ACIBL      ---KKVTGQVKLQIAAGKATPAPPVGPALGQAQINIMEFCKQFNAKTKDLEGFTIPVVITVYNDRSFTFV
RK11_GUITH      ---KKVVAIIKLALEAGKATPAPPVGPALGQRGVNIVMFCKDYNARTADKAGLIIPVEITVYEDKSYTFV
RL11_YERPY      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPS      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPP      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPN      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPE      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPB      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERPA      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_YERP3      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESEKGLPIPVVITVYSDRSFTFV
RL11_SYNS9      ---KKVVAVIKLALQAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGLVIPVEISVFEDRSFTFI
RL11_METI4      ---KEVSAIVRLQIPAGQANPAPPVGPALGQHGVNIMAFCKEFNAATQKEAGNILPVVITIYKDKTFTFV
RL11_KOSOT      ---------------------------------VNIMDFCKKFNAVTADKPGMVFPAVITVYADRSFTFE
RL11_BRAJA      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVIITIYADRSFTFE
RL11_BARQU      ---KKSIGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEEKGAPIPVIITYYQDKSFTFS
RL11B_BACCR     ---KKVLKVVKIQLPAGKANPAPPVGTVLGPTGVNIMMVCKEYNALTQGQAGMIIPAEITIYEDRSFSMK
RL11_SYNWW      ---RKVLGKISLQIAAGKATPAPPVGPALGQYGVNIMGFCKEYNARTANQAGYIVPVEITVFEDRSFTFV
RL11_OLICO      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEKNTPIPVVITIYADRSFTFE
RL11_NAUPA      ---KKVVEVLKLQIPAGKANPSPPVGPALGQRGINIMEFCKAFNEKTKDMMGFTIPVEITVFSDRSFTFI
RL11_MYCSS      --KKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFX
RL11_MYCSK      --KKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFX
RL11_CYTH3      ---KEITGYVKLQIKGGAANPSPPVGPALGSKGLNIMEFCKQFNARTQDKPGVLLPVLITVYTDKSFDFV
RL11_BIFLO      --KKKVSALIKLQIQXXXXXXXXXXXXXXXXXXVNIMDFCKAYNAQTQDKMGQVIPVEITVYEDRSFTFV
RL11_BIFLD      --KKKVSALIKLQIQXXXXXXXXXXXXXXXXXXVNIMDFCKAYNAQTQDKMGQVIPVEITVYEDRSFTFV
RL11_TERTT      ---KKIEAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAQTQGEPGSPVPVVISVYSDRSFTFA
RL11_RUBXD      ---------------------------------VNIGEFVRQFNDATRDRMGQLIPVEITVYEDRSFTFV
RL11_DELAS      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFI
RL11_CELJU      ---KKVTAYVKLQVAAGKANPSPPVGPALGQHGVNIMEFCKAFNAQTQGMEGAPVPVIISVYSDRSFTFV
RL11_SACD2      ---KKVEAYIKLQVAAGKANPSPPVGPALGQKGVNIMEFCKAFNAQTQGEPGSPVPVVISVYSDRSFTFT
RL11_CHLFF      MSNKKVIKLIKLQIPGGKANXXXXXXXXXXXXXVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFI
RL11_BRUO2      ---KKVAGQLKLQIPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRASO      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_BRASB      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_BARHE      ---KKSIGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEEKGAPIPVIITYYQDKSFTFS
RL11_BARBK      ---KKNAGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEEKGAPIPVVITYYQDKSFTFS
RL11_RHOP5      ---KKVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKNFNAQTQEEKNTPIPVVITIYADRSFTFE
RL11_RHOFD      ---KKIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFV
RL11_LEUMM      ---KKVVNVVKLQIAAAKATPAPPVGPALGQAGINIAQFTKEFNARTADQAGSIIPVEISVFDDRSFEFV
RL11_HELHP      ---KKVVGELKLQIPAGKANPSPPVGPALGQRSVNIMEFCKAFNERTKDMGDFNIPVIITIYQDKSFTFI
RL11_BRUSU      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUSI      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUME      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUMB      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUC2      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUAB      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUA2      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_BRUA1      ---KKVAGQLKLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVLITYYQDKSFTFV
RL11_PSEU5      ---KKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNARTQGQEGLPTPVIITVYSDRSFTFE
RL11_PARD8      ---KEVAGQIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNAKTQDKAGKILPVVITYYADKSFDFV
RL11_NEIG2      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGESGLPIPVVITAFADKSFTFV
RL11_NEIG1      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGESGLPIPVVITAFADKSFTFV
RL11_DIAST      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFV
RL11_CORA7      --KKKVTGLIKLQIEXXXXXXXXXXXXXXXXXXVNIMEFCKAYNAATESQRGNVVPVEITVYEDRSFDFX
RL11_BIFLI      --KKKVSALIKLQIQXXXXXXXXXXXXXXXXXXVNIMDFCKAYNAQTQDKMGQVIPVEITVYEDRSFTFV
RL11_ACISJ      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFV
RL11_THERP      ---KKVKAIVKLQLPAGKATPAPPVGPALGQHGVPIMNFVKEYNEKTAHLAGQIIPVVVTIYEDRSFTFV
RL11_COLP3      ---KKVQALIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAKTDSEKGAPVPVVITVYSDRSFTFE
RL11_BART1      ---KKSIGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEEKGAPIPVVITYYQDKSFTFS
RL11_OCHA4      ---KKIAGQLKLQVAAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEEKGSPIPVVITYYQDKSFTFV
RL11_DESVM      ---KKEVAKIKLQIPAGAANPSPPVGPALGQHGLNIMEFCKTFNAKTMEQKGMITPVVITVYSDRSFTFI
RL11_DESAA      ---KKVLAMVKLQVQAGKANPSPPIGPALGQHGVNIMEFCKAFNARTADQEGMVIPVVLTVYQDRSFSFI
RL11_CHLAB      MSNKKVIKLIKLQIPGGKANXXXXXXXXXXXXXVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFI
RL11_BEUC1      --KKKVTGLIKLXXXXXXXXXXXXXXXXLGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFI
RK11_GRATL      ---KKLIGLVKLALNAGKATPAPPVGPALGQYGANIVMFCKEYNARTANKVGLVIPVEISIYEDRSFCFI
RL11_VEREI      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFI
RL11_PARDP      ---KKVVGSLKLQIKAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQEEQGAPVPVVITYYADKSFTFE
RL11_NOVAD      ---KKIEGYIKLQVAAGDAKPAPPIGPALGQRGVNIMEFCKQFNAATQEEKGTPLPTVITVYADRSFTFV
RL11_MYCSJ      --KKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFX
RL11_MYCGI      --KKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFX
RL11_NEIM0      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQSEPGLPIPVVITAFADKSFTFV
RL11_MYCTU      --KKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFX
RL11_MYCTA      --KKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFX
RL11_MYCBT      --KKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFX
RL11_MYCBP      --KKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFX
RL11_MYCBO      --KKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFX
RL11_DESAH      ---KKVMALIKLQVEAGKANPSPPIGPALGQHGVNIMDFCKAFNARTANDAGSIIPVVITVYQDRSFTFI
RL11_NEIMF      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGEPGLPIPVVITAFADKSFTFV
RL11_NEIMA      ---KKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGEPGLPIPVVITAFADKSFTFV
RL11_DESVV      ---KKEVAKIKLQIPAGAANPSPPVGPALGQHGLNIMAFCKEFNAKTMEQKGMITPVVITVYADRSFSFI
RL11_DESVH      ---KKEVAKIKLQIPAGAANPSPPVGPALGQHGLNIMAFCKEFNAKTMEQKGMITPVVITVYADRSFSFI
RL11_DESOH      ---KKVTGQIKLQVTAGKANPSPPIGPALGQHGVNIMDFCKAFNARTADQEGMIIPVVITVYADKSFSFI
RL11_CHLCV      MSNKKVIKLIKLQIPGGKANXXXXXXXXXXXXXVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFI
RL11_BIFAA      --KKKVSALLKLQIQXXXXXXXXXXXXXXXXXXVNIMDFCKQYNAATQDKMGQVIPVEITVYEDRSFTFI
RL11_PORGI      ---KEVAGQIKLQIKGGAANPSPPVGPALGAKGINIMEFCKQFNARTQDKAGKVLPVVITYYADKSFDFI
RL11_PORG3      ---KEVAGQIKLQIKGGAANPSPPVGPALGAKGINIMEFCKQFNARTQDKAGKVLPVVITYYADKSFDFI
RL11_NITSB      ---KKVVDQFKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNEKTKDMMGFNIPVVITVYSDRSFTFV
RL11_HERAR      ---KKIIGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGMPIPVVITAFADKSFTFV
RL11_CAUSK      ---KKILGYIKLQVKAGSATPSPPIGPALGQRGVNIMGFCKEFNARTENEKGTPLPTVITVYQDKSFTFV
RL11_VIBCM      ---KKVEAYVKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNARTESEKGLPIPVVITVYSDRSFTFE
RL11_VIBCH      ---KKVEAYVKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNARTESEKGLPIPVVITVYSDRSFTFE
RL11_VIBC3      ---KKVEAYVKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNARTESEKGLPIPVVITVYSDRSFTFE
RL11_CAUCR      ---KKILGYIKLQVKAGSATPSPPIGPALGQRGVNIMGFCKEFNARTENEKGTPLPTVITVYQDKSFTFI
RL11_CAUCN      ---KKILGYIKLQVKAGSATPSPPIGPALGQRGVNIMGFCKEFNARTENEKGTPLPTVITVYQDKSFTFI
RL11_AMOA5      ---KEIVGYLKLQVKGGEAKPAPPVGPALGSKGLNIMEFCKQFNARTQDKQGQILPVLITIYQDKTFDFV
RL11_ACIAC      ---KKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGEPGLPLPVVITAFADKSFTFI
RK11_THAPS      ---KKITALIKLALPAGKATPAPPVGPALGQHGVNIAAFCKEYNARTTEKMGLIIPVEISVYEDRSYTFI
RL11_TREDE      MAKKKVVTQIKLQCPAGKATPAPPIGPALGPHGVSAPQFVQQFNDRTKSEPGLVIPVVITVYADKSFTFI
RL11_SILST      ---KKLVGSMKLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTADEPGAPCPTVITYYQDKSFTMD
RL11_SPHAL      ---KKISGYIKLQVPAGTANPSPPLGPALGQRGVNIMEFCKAFNAATDGEKGTPTPTIITVYADKSFSFV
RL11_RHOSR      --KKKLAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVVPVEISVYEDRTFDFX
RL11_RHOOB      --KKKLAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVVPVEISVYEDRTFDFX
RL11_MESFL      ---------------------------------INMPEFTKQFNDATKDRAGDVVPVVITAYDDKSFDFI
RL11_BAUCH      ---KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKIFNLQTENEKGLPIPVIITVYSDRSFTFI
RL11_AKKM8      ---KEITKIIKLQINAGAANPSPPVGPALGQAGVNIMAFCKEFNAATQKQAGDLLPTVITVYKDKSFSFI
RL11_SORC5      ---KKVTGYVKLQLPAGKANPSPPVGPALGQHGVNIMAFCKDFNSRTAAQGDLIIPVVITVYSDRSFTFI
RL11_HELAH      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_AZOVD      ---KKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNARTQGEPGLPTPVIITVYSDRSFTFE
RK11_CYAPA      ---------------------------------VSSVNFCKEYNAKTADKGGLVIPAEITVYDDRSYSFV
RL11_THICR      ---KKIEAYIKLQVPAGNANPSPPVGPALGQHGVNIMEFCKAFNAQTQSMEKNLVPVVITVFNDRSFTFI
RL11_THEM4      ---KKVVAQVRLQLEAGKATPAPPVGPALGQRGVNLMEFCKKFNAATADKAGMIIPVIITVYEDRSFTFI
RL11_CHLAD      ---KKLVAVVKLQLPAGKATPAPPVGPALGQYGINIMAFVKEYNEKSASQAGSIVPVEISIYSDRSFVAR
RL11_ACIBY      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_ACIBT      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_ACIBS      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_ACIBC      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_ACIB5      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_ACIB3      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEPGLPIPVVITVYNDKSFTFI
RL11_RHOE4      --KKKLAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVVPVEISVYEDRTFDFX
RL11_PHYAS      ---KKVVKMVKLQIPAGKANPAPPVGPALGQAQVNIPSFCSQFNETTKDQMGFIIPVIISVYEDRTFTFV
RL11_PARL1      ---KKIEGYIKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAATQKEQGMPIPVVITAFSDRSFTFA
RL11_LISW6      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_LISMO      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_LISMH      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_LISMF      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_LISMC      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_LISIN      ---KKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFI
RL11_HELPY      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_HELPS      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_HELPJ      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_HELPH      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_HELPG      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_HELP2      ---KKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFI
RL11_COXBU      ---KKITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNEKGLPTPVIITVYADRTFSFI
RL11_COXBR      ---KKITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNEKGLPTPVIITVYADRTFSFI
RL11_COXB2      ---KKITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNEKGLPTPVIITVYADRTFSFI
RL11_COXB1      ---KKITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNEKGLPTPVIITVYADRTFSFI
RL11_ACIAD      ---KKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKEVGLPIPVVITVYNDKSFTFI
RL11_PSEPF      ---KKITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGEAGLPTPVIITVYSDRSFTFE
RL11_PSEHT      ---KKVEALIKLQVNAGMANPSPPVGPALGQHGVNIMEFCKAFNARTESEKGAPVPVVISVYGDRSFTFD
RL11_NITMU      ---KKIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAATQKMEGLPVPVVITAYADKSFTFT
RL11_COXBN      ---KKITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNEKGLPTPVIITVYADRTFSFI
RL11_THETH      ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
RL11_THET8      ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
RL11_THET2      ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
RL11_RHORT      ---KKIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAATQGEPGMPIPVVITAYGDRTFTYI
RL11_PROM5      ---KKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFI
RL11_OPITP      ---KKIQGYIRLXXXXXXXXXXXXXXXXXXXXXXNIMAFCKDFNARTKDQNGMILPVVITVYTDKSFTFI
RL11_FRATW      MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGEPGMPIPVEISVYSDRSFTFE
RL11_FRATT      MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGEPGMPIPVEISVYSDRSFTFE
RL11_FRATN      MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGEPGMPIPVEISVYSDRSFTFE
RL11_FRATM      MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGEPGMPIPVEISVYSDRSFTFE
RL11_FRAT1      MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGEPGMPIPVEISVYSDRSFTFE
RL11_STRMK      ---KKVVGYIKLQVKAGQANPSPPVGPALGQRGLNIMEFCKAFNAATQKEPGLPVPVIITAYSDRTFTFI
RL11_STRM5      ---KKVVGYIKLQVKAGQANPSPPVGPALGQRGLNIMEFCKAFNAATQKEPGLPVPVIITAYSDRTFTFI
RL11_SILPO      ---KKLIGTLKLQVPAGKANPSPPVGPALGQRGINIMEFCKAFNAKTADMEGAPCPTVISYYQDKSFTMD
RL11_PSEU2      ---KKITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGEPGLPTPVIITVYSDRSFTFE
RL11_PSESM      ---KKITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGEPGLPTPVIITVYSDRSFTFE
RL11_PSEFS      ---KKITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGEPG<