[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56128.1

[Show Plain Result]


## Summary of Sequence Search
    1::61
    1::61      1e-25  72%   61 aa  RS14Z_SYNAS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-25  70%   61 aa  RS14Z_THEFY RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-25  72%   61 aa  RS14Z_HERA2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-24  67%   61 aa  RS14Z_ACIC1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-24  70%   61 aa  RS14Z_SYNFM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-24  70%   61 aa  RS14Z_NOCFA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-24  69%   61 aa  RS14Z_DESHY RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-24  69%   61 aa  RS14Z_DESHD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-24  69%   61 aa  RS14Z_CARHZ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  72%   61 aa  RS14Z_STRMU RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  66%   61 aa  RS14Z_RUBXD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  69%   61 aa  RS14Z_FINM2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  70%   61 aa  RS14Z_STRT2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  70%   61 aa  RS14Z_STRT1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-23  67%   61 aa  RS14Z_NOCSJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  69%   61 aa  RS14Z_NITSB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  67%   61 aa  RS14Z_MYCUA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  67%   61 aa  RS14Z_MYCMM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  67%   61 aa  RS14Z_MYCLE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  67%   61 aa  RS14Z_MYCLB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-23  67%   61 aa  RS14Z_FRASN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  67%   61 aa  RS14Z_NATTJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  67%   61 aa  RS14Z_MYCPA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  67%   61 aa  RS14Z_MYCA1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  67%   61 aa  RS14Z_LACRJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  67%   61 aa  RS14Z_LACRD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  69%   61 aa  RS14Z_HELMI RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  69%   61 aa  RS14Z_GEOTN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  69%   61 aa  RS14Z_GEOSW RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-23  69%   61 aa  RS14Z_GEOKA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-23  70%   61 aa  RS14Z_STRSV RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-23  70%   61 aa  RS14Z_STRGC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-23  67%   61 aa  RS14Z_HALOH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  66%   61 aa  RS14Z_LACF3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  66%   61 aa  RS14Z_DESOH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_CLOCE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACWK RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACHK RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACCZ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACCR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACCN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC7 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC4 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACC0 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACAN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACAH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACAC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-23  67%   61 aa  RS14Z_BACAA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-23  67%   61 aa  RS14Z_THETH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-23  67%   61 aa  RS14Z_THET8 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-23  67%   61 aa  RS14Z_THET2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  67%   61 aa  RS14Z_STRTD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  66%   61 aa  RS14Z_MYCTU RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  66%   61 aa  RS14Z_MYCTA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  66%   61 aa  RS14Z_MYCBT RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  66%   61 aa  RS14Z_MYCBP RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  66%   61 aa  RS14Z_MYCBO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  69%   61 aa  RS14Z_STRA5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  69%   61 aa  RS14Z_STRA3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  69%   61 aa  RS14Z_STRA1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  64%   61 aa  RS14Z_MYCS2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  67%   61 aa  RS14Z_MAGSM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  67%   61 aa  RS14Z_LACS1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-22  67%   61 aa  RS14Z_BACST RecName: Full=30S ribosomal protein S14 type
    1::61      1e-22  67%   61 aa  RS14Z_ANOFW RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  70%   61 aa  RS14Z_RHOBA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  70%   61 aa  RS14Z_LACLS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  70%   61 aa  RS14Z_LACLM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  70%   61 aa  RS14Z_LACLA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  70%   61 aa  RS14Z_KOSOT RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  64%   61 aa  RS14Z_KINRD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-22  64%   61 aa  RS14Z_CLOTH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-22  67%   61 aa  RS14Z_PELCD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-22  64%   61 aa  RS14Z_GEOSF RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-22  64%   61 aa  RS14Z_DESMR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-22  64%   61 aa  RS14Z_BEUC1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-22  67%   61 aa  RS14Z_ARCB4 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  67%   61 aa  RS14Z_STRS7 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  67%   61 aa  RS14Z_STREM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  67%   61 aa  RS14Z_STRE4 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  64%   61 aa  RS14Z_PROAC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  64%   61 aa  RS14Z_GEOUR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  64%   61 aa  RS14Z_GEOSL RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-22  64%   61 aa  RS14Z_GEOMG RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  64%   61 aa  RS14Z_PETMO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  66%   61 aa  RS14Z_NAUPA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  67%   61 aa  RS14Z_MOOTA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  66%   61 aa  RS14Z_LACBA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  62%   61 aa  RS14Z_GEOLS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  62%   61 aa  RS14Z_FRASC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  64%   61 aa  RS14Z_DESAP RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  66%   61 aa  RS14Z_CAMLR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-22  66%   61 aa  R14Z1_BACLD RecName: Full=30S ribosomal protein S14 type Z 1;
    1::61      7e-22  61%   61 aa  RS14Z_FRAAA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-22  66%   61 aa  RS14Z_DESRM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-22  66%   61 aa  RS14Z_BREBN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_PEDPA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_MYCPE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_GEOSM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_GEOBB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  67%   61 aa  RS14Z_ENTFA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_CALS8 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-22  64%   61 aa  RS14Z_ANATD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRU0 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRPM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRPG RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRPF RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRPD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRPC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRP8 RecName: Full=30S ribosomal protein S14 type
    1::61      1e-21  67%   61 aa  RS14Z_STRP6 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRP3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  67%   61 aa  RS14Z_STRP1 RecName: Full=30S ribosomal protein S14 type
    1::61      1e-21  61%   61 aa  RS14Z_PELPD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  64%   61 aa  RS14Z_DESVV RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  64%   61 aa  RS14Z_DESVM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  64%   61 aa  RS14Z_DESVH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  64%   61 aa  RS14Z_COPPD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-21  64%   61 aa  RS14Z_CAMFF RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14_BACSU RecName: Full=30S ribosomal protein S14;AltName:
    1::61      2e-21  66%   61 aa  RS14Z_MYXXD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_HELPJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  66%   61 aa  RS14Z_DEIGD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_BACA2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISW6 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISMO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISMH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISMF RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISMC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_LISIN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  66%   61 aa  RS14Z_CAMHC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-21  64%   61 aa  RS14Z_BACSK RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  64%   61 aa  RS14Z_SULNB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_LACPL RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMC1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_LACC3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMJR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMJJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMJE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMJD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  62%   61 aa  RS14Z_CAMJ8 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-21  64%   61 aa  RS14Z_BACHD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  64%   61 aa  RS14Z_OCEIH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  62%   61 aa  RS14Z_HELPY RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  62%   61 aa  RS14Z_HELPS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  62%   61 aa  RS14Z_HELPH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  62%   61 aa  RS14Z_HELPG RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  64%   61 aa  RS14Z_EUBE2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  66%   61 aa  RS14Z_DICT6 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  61%   61 aa  RS14Z_DESDG RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  61%   61 aa  RS14Z_DESDA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  64%   61 aa  RS14Z_BIFA0 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  64%   61 aa  RS14Z_ALKMQ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  61%   61 aa  RS14Z_ACIF5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-21  61%   61 aa  RS14Z_ACIF2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-21  61%   61 aa  RS14Z_DESAA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-21  62%   61 aa  RS14Z_CAMC5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  62%   61 aa  RS14Z_MACCJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  64%   61 aa  RS14Z_DICTD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  64%   61 aa  RS14Z_CHLSY RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  64%   61 aa  RS14Z_CHLAA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  62%   61 aa  RS14Z_BACP2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-21  64%   61 aa  R14Z2_BACLD RecName: Full=30S ribosomal protein S14 type Z 2;
    1::61      1e-20  59%   61 aa  RS14Z_CLOD6 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-20  61%   61 aa  RS14Z_BORT9 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-20  61%   61 aa  RS14Z_BORHD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-20  61%   61 aa  RS14Z_BORAP RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-20  62%   61 aa  RS14Z_UNCTG RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-20  66%   61 aa  RS14Z_STRPZ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_CLOPS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_CLOPE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_CLOP1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  61%   61 aa  RS14Z_ELUMP RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  61%   61 aa  RS14Z_DEIDV RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  57%   61 aa  RS14Z_DEHSC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  57%   61 aa  RS14Z_DEHSB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  57%   61 aa  RS14Z_DEHE1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_BORGA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_BORBZ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  59%   61 aa  RS14Z_BORBU RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  62%   61 aa  RS14Z_BIFLO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  62%   61 aa  RS14Z_BIFLI RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  62%   61 aa  RS14Z_BIFLD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-20  61%   61 aa  RS14Z_ALKOO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_UREU1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_UREPA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_UREP2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_TREPS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_TREPA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  62%   61 aa  RS14Z_SYMTH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-20  59%   61 aa  RS14Z_ROSS1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-20  61%   61 aa  RS14Z_SULDN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-20  59%   61 aa  RS14Z_LACDB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-20  59%   61 aa  RS14Z_LACDA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-20  57%   61 aa  RS14Z_CLOAB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-20  59%   61 aa  RS14Z_BORRA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-20  59%   61 aa  RS14Z_BORDL RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-20  56%   61 aa  RS14Z_THETN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-20  61%   61 aa  RS14Z_THESQ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-20  61%   61 aa  RS14Z_THEP1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-20  61%   61 aa  RS14Z_THENN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-19  59%   61 aa  RS14Z_THEMA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-19  54%   61 aa  RS14Z_THEPX RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-19  54%   61 aa  RS14Z_THEP3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-19  59%   61 aa  RS14Z_FERNB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-19  57%   61 aa  RS14Z_TREDE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-19  61%   61 aa  RS14Z_STAES RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-19  61%   61 aa  RS14Z_STAEQ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-19  57%   61 aa  RS14Z_ROSCS RecName: Full=30S ribosomal protein S14 type Z;
    1::62      3e-19  61%   62 aa  RS14Z_PERMH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-19  54%   61 aa  RS14Z_MYCS5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-19  56%   61 aa  RS14Z_CLOB6 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-19  54%   61 aa  RS14Z_CLONN RecName: Full=30S ribosomal protein S14 type Z;
   16::61      6e-19  74%   61 aa  RS14Z_SALTO RecName: Full=30S ribosomal protein S14 type Z;
   16::61      6e-19  74%   61 aa  RS14Z_SALAI RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-19  56%   61 aa  RS14Z_MYCA5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      6e-19  56%   61 aa  RS14Z_LEPBA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAHJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAW RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAT RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAS RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAR RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAAB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAA9 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAA8 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAA3 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAA2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_STAA1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  59%   61 aa  RS14Z_MYCPU RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  56%   61 aa  RS14Z_CLOBB RecName: Full=30S ribosomal protein S14 type Z;
    1::61      7e-19  56%   61 aa  RS14Z_CLOBA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  59%   61 aa  RS14Z_THEYD RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_THELT RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOBM RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOBL RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOBK RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOBJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOBH RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-19  56%   61 aa  RS14Z_CLOB1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-18  59%   61 aa  RS14Z_MYCGA RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-18  54%   61 aa  RS14Z_THEAB RecName: Full=30S ribosomal protein S14 type Z;
    1::62      2e-18  57%   62 aa  RS14Z_SULSY RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-18  54%   61 aa  RS14Z_CLOB8 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-18  54%   61 aa  RS14Z_THEM4 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      3e-18  59%   61 aa  RS14Z_ANADF RecName: Full=30S ribosomal protein S14 type Z;
   16::61      4e-18  72%   61 aa  RS14Z_STRGG RecName: Full=30S ribosomal protein S14 type Z;
   16::61      4e-18  72%   61 aa  RS14Z_STRCO RecName: Full=30S ribosomal protein S14 type Z;
   16::61      4e-18  72%   61 aa  RS14Z_STRAW RecName: Full=30S ribosomal protein S14 type Z;
    1::61      4e-18  59%   61 aa  RS14Z_STAS1 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-18  57%   61 aa  RS14Z_SPICI RecName: Full=30S ribosomal protein S14 type Z;
    1::61      5e-18  54%   61 aa  RS14Z_MYCMO RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-18  59%   61 aa  RS14Z_MYCPN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-18  56%   61 aa  RS14Z_MYCAP RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-18  57%   61 aa  RS14Z_ANASK RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-18  57%   61 aa  RS14Z_ANADE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      8e-18  57%   61 aa  RS14Z_ANAD2 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-17  59%   61 aa  RS14Z_MYCGE RecName: Full=30S ribosomal protein S14 type Z;
    1::61      1e-17  51%   61 aa  RS14Z_MYCCT RecName: Full=30S ribosomal protein S14 type Z;
    1::62      2e-17  59%   62 aa  RS14Z_SPIKU RecName: Full=30S ribosomal protein S14 type Z;
    1::63      2e-17  64%   63 aa  RS14Z_GLOVI RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-17  51%   61 aa  RS14Z_MESFL RecName: Full=30S ribosomal protein S14 type Z;
   16::61      5e-17  67%   61 aa  RS14Z_SACEN RecName: Full=30S ribosomal protein S14 type Z;
   16::61      5e-17  67%   61 aa  RS14Z_MYCVP RecName: Full=30S ribosomal protein S14 type Z;
   16::61      5e-17  67%   61 aa  RS14Z_MYCGI RecName: Full=30S ribosomal protein S14 type Z;
   16::61      5e-17  65%   61 aa  RS14Z_MYCA9 RecName: Full=30S ribosomal protein S14 type Z;
   16::61      7e-17  67%   61 aa  RS14Z_MYCSS RecName: Full=30S ribosomal protein S14 type Z;
   16::61      7e-17  67%   61 aa  RS14Z_MYCSK RecName: Full=30S ribosomal protein S14 type Z;
   16::61      7e-17  67%   61 aa  RS14Z_MYCSJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-17  49%   61 aa  RS14Z_LEPIN RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-17  49%   61 aa  RS14Z_LEPIC RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-17  49%   61 aa  RS14Z_LEPBJ RecName: Full=30S ribosomal protein S14 type Z;
    1::62      2e-16  54%   62 aa  RS14Z_HYDS0 RecName: Full=30S ribosomal protein S14 type Z;
   16::61      2e-16  63%   61 aa  RS14Z_DESPS RecName: Full=30S ribosomal protein S14 type Z;
   16::61      2e-16  63%   61 aa  RS14Z_RHOE4 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-16  52%   61 aa  RS14Z_MYCHJ RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-16  52%   61 aa  RS14Z_MYCH7 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      2e-16  52%   61 aa  RS14Z_MYCH2 RecName: Full=30S ribosomal protein S14 type Z;
   16::61      3e-16  65%   61 aa  RS14Z_STACT RecName: Full=30S ribosomal protein S14 type Z;
   16::61      3e-16  63%   61 aa  RS14Z_RHOSR RecName: Full=30S ribosomal protein S14 type Z;
   16::61      3e-16  63%   61 aa  RS14Z_RHOOB RecName: Full=30S ribosomal protein S14 type Z;
   58::101     3e-16  73%  101 aa  RS14_NOVAD RecName: Full=30S ribosomal protein S14;
   19::61      4e-16  70%   61 aa  RS14Z_BIFAA RecName: Full=30S ribosomal protein S14 type Z;
    1::62      6e-16  56%   62 aa  RS14Z_AQUPY RecName: Full=30S ribosomal protein S14 type Z;
    1::62      6e-16  56%   62 aa  RS14Z_AQUAE RecName: Full=30S ribosomal protein S14 type Z;
   58::101     1e-15  75%  101 aa  RS14_SPHWW RecName: Full=30S ribosomal protein S14;
   58::101     3e-15  70%  101 aa  RS14_ZYMMO RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRR6 RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRPS RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRPN RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRPI RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRP4 RecName: Full=30S ribosomal protein S14;
    1::89      4e-15  64%   89 aa  RS14_STRP2 RecName: Full=30S ribosomal protein S14;
   47::89      4e-15  65%   89 aa  RS14Z_SALRD RecName: Full=30S ribosomal protein S14 type Z;
   58::101     5e-15  73%  101 aa  RS14_SPHAL RecName: Full=30S ribosomal protein S14;
   20::61      8e-15  67%   61 aa  RS14Z_DESAD RecName: Full=30S ribosomal protein S14 type Z;
   58::101     2e-14  68%  101 aa  RS14_JANMA RecName: Full=30S ribosomal protein S14;
   46::101     3e-14  59%  101 aa  RS14_SYNJA RecName: Full=30S ribosomal protein S14;
   50::101     3e-14  58%  101 aa  RS14_CHLPN RecName: Full=30S ribosomal protein S14;
   44::102     4e-14  51%  102 aa  RS14_WOLPM RecName: Full=30S ribosomal protein S14;
   58::101     5e-14  68%  101 aa  RS14_BORPD RecName: Full=30S ribosomal protein S14;
   44::102     7e-14  51%  102 aa  RS14_WOLPP RecName: Full=30S ribosomal protein S14;
   46::101     7e-14  57%  101 aa  RS14_SYNJB RecName: Full=30S ribosomal protein S14;
   58::101     9e-14  68%  101 aa  RS14_RALSO RecName: Full=30S ribosomal protein S14;
   58::101     9e-14  68%  101 aa  RS14_RALPJ RecName: Full=30S ribosomal protein S14;
    1::89      9e-14  64%   89 aa  RS14_LISMF RecName: Full=30S ribosomal protein S14;
   58::101     9e-14  64%  101 aa  RS14_ERYLH RecName: Full=30S ribosomal protein S14;
   46::89      9e-14  66%   89 aa  RS14_DEIRA RecName: Full=30S ribosomal protein S14;
   59::101     9e-14  63%  101 aa  RS14_CHLCV RecName: Full=30S ribosomal protein S14;
   58::101     9e-14  66%  101 aa  RS14_AZOSB RecName: Full=30S ribosomal protein S14;
    1::61      9e-14  46%   61 aa  RS14Z_CLOK5 RecName: Full=30S ribosomal protein S14 type Z;
    1::61      9e-14  46%   61 aa  RS14Z_CLOK1 RecName: Full=30S ribosomal protein S14 type Z;
   57::101     1e-13  62%  101 aa  RS14_METPB RecName: Full=30S ribosomal protein S14;
   57::101     1e-13  62%  101 aa  RS14_METEP RecName: Full=30S ribosomal protein S14;
   58::101     1e-13  68%  101 aa  RS14_BORPE RecName: Full=30S ribosomal protein S14;
   58::101     1e-13  68%  101 aa  RS14_BORPA RecName: Full=30S ribosomal protein S14;
   58::101     1e-13  68%  101 aa  RS14_BORBR RecName: Full=30S ribosomal protein S14;
   47::89      1e-13  67%   89 aa  RS14_BACA2 RecName: Full=30S ribosomal protein S14;
   39::101     1e-13  56%  101 aa  RS14_AZOSE RecName: Full=30S ribosomal protein S14;
   43::101     2e-13  54%  101 aa  RS14_ORITI RecName: Full=30S ribosomal protein S14;
   43::101     2e-13  54%  101 aa  RS14_ORITB RecName: Full=30S ribosomal protein S14;
   57::101     2e-13  62%  101 aa  RS14_METRJ RecName: Full=30S ribosomal protein S14;
   58::101     2e-13  66%  101 aa  RS14_HERAR RecName: Full=30S ribosomal protein S14;
   59::101     2e-13  60%  101 aa  RS14_CHLFF RecName: Full=30S ribosomal protein S14;
   59::101     2e-13  60%  101 aa  RS14_CHLAB RecName: Full=30S ribosomal protein S14;
   57::100     2e-13  66%  100 aa  RS14_SYNPX RecName: Full=30S ribosomal protein S14;
   49::101     2e-13  63%  101 aa  RS14_SACEN RecName: Full=30S ribosomal protein S14;
   59::101     2e-13  67%  101 aa  RS14_RHOCS RecName: Full=30S ribosomal protein S14;
   58::101     2e-13  66%  101 aa  RS14_RALME RecName: Full=30S ribosomal protein S14;
   58::101     2e-13  66%  101 aa  RS14_RALEJ RecName: Full=30S ribosomal protein S14;
   58::101     2e-13  66%  101 aa  RS14_RALEH RecName: Full=30S ribosomal protein S14;
   46::89      2e-13  64%   89 aa  RS14_LISIN RecName: Full=30S ribosomal protein S14;
   58::101     2e-13  66%  101 aa  RS14_CUPTR RecName: Full=30S ribosomal protein S14;
   50::101     2e-13  56%  101 aa  RS14_CHLMU RecName: Full=30S ribosomal protein S14;
   47::89      2e-13  65%   89 aa  RS14B_BACSU RecName: Full=Alternate 30S ribosomal protein S14;
   42::100     3e-13  56%  100 aa  RS14_THEEB RecName: Full=30S ribosomal protein S14;
   57::100     3e-13  66%  100 aa  RS14_SYNPW RecName: Full=30S ribosomal protein S14;
   46::101     3e-13  59%  101 aa  RS14_NEOSM RecName: Full=30S ribosomal protein S14;
   37::89      3e-13  59%   89 aa  RS14_LISW6 RecName: Full=30S ribosomal protein S14;
   58::101     3e-13  57%  101 aa  RS14_CHLTR RecName: Full=30S ribosomal protein S14;
   58::101     3e-13  57%  101 aa  RS14_CHLTB RecName: Full=30S ribosomal protein S14;
   58::101     3e-13  57%  101 aa  RS14_CHLTA RecName: Full=30S ribosomal protein S14;
   58::101     3e-13  57%  101 aa  RS14_CHLT2 RecName: Full=30S ribosomal protein S14;
   58::101     3e-13  64%  101 aa  RS14_BUCCC RecName: Full=30S ribosomal protein S14;
   40::100     3e-13  56%  100 aa  RR14_CHLAT RecName: Full=30S ribosomal protein S14, chloroplastic;
   38::100     5e-13  54%  100 aa  RS14_SYNS9 RecName: Full=30S ribosomal protein S14;
   57::100     5e-13  64%  100 aa  RS14_SYNP2 RecName: Full=30S ribosomal protein S14;
    1::89      5e-13  62%   89 aa  RS14_LISMO RecName: Full=30S ribosomal protein S14;
   47::89      5e-13  65%   89 aa  RS14_CYTH3 RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURVG RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURS3 RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURM1 RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURCM RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURCJ RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURCH RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURCC RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURCA RecName: Full=30S ribosomal protein S14;
   58::101     5e-13  64%  101 aa  RS14_BURA4 RecName: Full=30S ribosomal protein S14;
   57::100     6e-13  66%  100 aa  RS14_PROM3 RecName: Full=30S ribosomal protein S14;
   47::89      6e-13  63%   89 aa  RS14_FLAPJ RecName: Full=30S ribosomal protein S14;
   45::101     6e-13  56%  101 aa  RS14_BUCAI RecName: Full=30S ribosomal protein S14;
   59::101     6e-13  63%  101 aa  RS14_ALCBS RecName: Full=30S ribosomal protein S14;
   44::102     8e-13  47%  102 aa  RS14_WOLTR RecName: Full=30S ribosomal protein S14;
   58::100     8e-13  65%  100 aa  RS14_SYNP6 RecName: Full=30S ribosomal protein S14;
   57::101     8e-13  60%  101 aa  RS14_RHOS5 RecName: Full=30S ribosomal protein S14;
   57::101     8e-13  60%  101 aa  RS14_RHOS4 RecName: Full=30S ribosomal protein S14;
   57::101     8e-13  60%  101 aa  RS14_RHOS1 RecName: Full=30S ribosomal protein S14;
   57::100     8e-13  64%  100 aa  RS14_PROM4 RecName: Full=30S ribosomal protein S14;
   59::101     8e-13  63%  101 aa  RS14_POLSQ RecName: Full=30S ribosomal protein S14;
   59::101     8e-13  63%  101 aa  RS14_POLNS RecName: Full=30S ribosomal protein S14;
   58::101     8e-13  59%  101 aa  RS14_METS4 RecName: Full=30S ribosomal protein S14;
    1::89      8e-13  61%   89 aa  RS14_LACCB RecName: Full=30S ribosomal protein S14;
    1::89      8e-13  61%   89 aa  RS14_LACC3 RecName: Full=30S ribosomal protein S14;
   40::89      8e-13  62%   89 aa  RS14_GRAFK RecName: Full=30S ribosomal protein S14;
   37::89      8e-13  59%   89 aa  RS14_FLAJ1 RecName: Full=30S ribosomal protein S14;
   58::101     8e-13  61%  101 aa  RS14_BUCAP RecName: Full=30S ribosomal protein S14;
   40::100     8e-13  56%  100 aa  RR14_CHLVU RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::101     1e-12  61%  101 aa  RS14_POLSJ RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_POLNA RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  62%  101 aa  RS14_ALTMD RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  64%  101 aa  RS14_ACIAC RecName: Full=30S ribosomal protein S14;
   57::100     1e-12  64%  100 aa  RR14_MESVI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::101     1e-12  58%  101 aa  RS14_VIBVY RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_VIBVU RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_VIBPA RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_VIBHB RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_VIBFM RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_VIBF1 RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SODGM RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  56%  101 aa  RS14_SILST RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALTY RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALTI RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALSV RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALPK RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALPB RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALPA RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALNS RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALHS RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALDC RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALCH RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_SALA4 RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  56%  101 aa  RS14_PSEA6 RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_PHOLL RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_ERWCT RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_ENTS8 RecName: Full=30S ribosomal protein S14;
   45::101     1e-12  55%  101 aa  RS14_ENT38 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURXL RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURTA RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURPS RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURPP RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURP8 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURP6 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURP1 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURP0 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURMS RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURMA RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURM9 RecName: Full=30S ribosomal protein S14;
   58::101     1e-12  61%  101 aa  RS14_BURM7 RecName: Full=30S ribosomal protein S14;
   57::101     1e-12  58%  101 aa  RS14_ALISL RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  59%  101 aa  RS14_VEREI RecName: Full=30S ribosomal protein S14;
   58::100     2e-12  65%  100 aa  RS14_SYNSC RecName: Full=30S ribosomal protein S14;
   58::100     2e-12  65%  100 aa  RS14_SYNS3 RecName: Full=30S ribosomal protein S14;
   38::100     2e-12  52%  100 aa  RS14_SYNR3 RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  61%  101 aa  RS14_SINMW RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  58%  101 aa  RS14_SHEWM RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  58%  101 aa  RS14_SHESH RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  61%  101 aa  RS14_RHIME RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  58%  101 aa  RS14_PARDP RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  62%  101 aa  RS14_METCA RecName: Full=30S ribosomal protein S14;
   59::101     2e-12  63%  101 aa  RS14_HALHL RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  61%  101 aa  RS14_CELJU RecName: Full=30S ribosomal protein S14;
   45::101     2e-12  53%  101 aa  RS14_BUCBP RecName: Full=30S ribosomal protein S14;
   40::100     2e-12  53%  100 aa  RR14_SCEOB RecName: Full=30S ribosomal protein S14, chloroplastic;
   45::100     2e-12  55%  100 aa  RR14_PSINU RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-12  53%  100 aa  RR14_CHLRE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::101     2e-12  56%  101 aa  RS14_SILPO RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  58%  101 aa  RS14_SHEPW RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  61%  101 aa  RS14_RUTMC RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  59%  101 aa  RS14_RHILW RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  59%  101 aa  RS14_RHIL3 RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  59%  101 aa  RS14_RHIEC RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  59%  101 aa  RS14_RHIE6 RecName: Full=30S ribosomal protein S14;
   58::100     2e-12  65%  100 aa  RS14_PROMM RecName: Full=30S ribosomal protein S14;
   57::101     2e-12  60%  101 aa  RS14_GRABC RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  64%  101 aa  RS14_DELAS RecName: Full=30S ribosomal protein S14;
   58::101     2e-12  64%  101 aa  RS14_ACISJ RecName: Full=30S ribosomal protein S14;
   40::100     2e-12  53%  100 aa  RR14_PSEAK RecName: Full=30S ribosomal protein S14, chloroplastic;
   45::101     3e-12  53%  101 aa  RS14_YERPY RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPS RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPP RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPN RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPG RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPE RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPB RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERPA RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERP3 RecName: Full=30S ribosomal protein S14;
   45::101     3e-12  53%  101 aa  RS14_YERE8 RecName: Full=30S ribosomal protein S14;
   40::101     3e-12  50%  101 aa  RS14_SHEAM RecName: Full=30S ribosomal protein S14;
   58::101     3e-12  61%  101 aa  RS14_SACD2 RecName: Full=30S ribosomal protein S14;
   57::101     3e-12  56%  101 aa  RS14_JANSC RecName: Full=30S ribosomal protein S14;
   57::101     3e-12  53%  101 aa  RS14_DINSH RecName: Full=30S ribosomal protein S14;
   47::89      3e-12  60%   89 aa  RS14_BACLD RecName: Full=30S ribosomal protein S14;
   47::89      3e-12  65%   89 aa  RS14_ACHLI RecName: Full=30S ribosomal protein S14;
   58::100     3e-12  63%  100 aa  RR14_OSTTA RecName: Full=30S ribosomal protein S14, chloroplastic;
   45::101     4e-12  53%  101 aa  RS14_WIGBR RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHISS RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHIFL RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHIF8 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHIDS RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHIBS RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHIB3 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHEPA RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_SHEHH RecName: Full=30S ribosomal protein S14;
   58::101     4e-12  57%  101 aa  RS14_RHORT RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_PROMH RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  60%  101 aa  RS14_NEIMF RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  60%  101 aa  RS14_NEIMB RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  60%  101 aa  RS14_NEIMA RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  60%  101 aa  RS14_NEIM0 RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  60%  101 aa  RS14_NEIG1 RecName: Full=30S ribosomal protein S14;
   59::101     4e-12  63%  101 aa  RS14_METFK RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_KLEP3 RecName: Full=30S ribosomal protein S14;
   58::101     4e-12  57%  101 aa  RS14_IDILO RecName: Full=30S ribosomal protein S14;
   45::89      4e-12  56%   89 aa  RS14_EXIS2 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ESCF3 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOUT RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOSM RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOSE RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOLU RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOLI RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOLC RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOL6 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOL5 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOK1 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECOHS RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECODH RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO8A RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO7I RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO5E RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO57 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO45 RecName: Full=30S ribosomal protein S14;
   45::101     4e-12  53%  101 aa  RS14_ECO24 RecName: Full=30S ribosomal protein S14;
   58::101     4e-12  57%  101 aa  RS14_AGRT5 RecName: Full=30S ribosomal protein S14;
   40::100     4e-12  53%  100 aa  RR14_THAPS RecName: Full=30S ribosomal protein S14, chloroplastic;
   56::100     4e-12  62%  100 aa  RR14_OEDCA RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     4e-12  57%  100 aa  RR14_ASTLO RecName: Full=Plastid 30S ribosomal protein S14;
   57::101     5e-12  56%  101 aa  RS14_SHESR RecName: Full=30S ribosomal protein S14;
   57::101     5e-12  56%  101 aa  RS14_SHESM RecName: Full=30S ribosomal protein S14;
   57::101     5e-12  56%  101 aa  RS14_SHESA RecName: Full=30S ribosomal protein S14;
   57::101     5e-12  56%  101 aa  RS14_SHEON RecName: Full=30S ribosomal protein S14;
   57::101     5e-12  56%  101 aa  RS14_SHELP RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  53%  101 aa  RS14_SHEFN RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  53%  101 aa  RS14_SHEB9 RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  53%  101 aa  RS14_SHEB8 RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  53%  101 aa  RS14_SHEB5 RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  55%  101 aa  RS14_SALAR RecName: Full=30S ribosomal protein S14;
   58::101     5e-12  55%  101 aa  RS14_PARL1 RecName: Full=30S ribosomal protein S14;
   57::101     5e-12  58%  101 aa  RS14_MARMS RecName: Full=30S ribosomal protein S14;
   45::89      5e-12  60%   89 aa  RS14_LACRJ RecName: Full=30S ribosomal protein S14;
   45::89      5e-12  60%   89 aa  RS14_LACRD RecName: Full=30S ribosomal protein S14;
   45::101     5e-12  55%  101 aa  RS14_CITK8 RecName: Full=30S ribosomal protein S14;
   59::101     5e-12  65%  101 aa  RS14_CHRVO RecName: Full=30S ribosomal protein S14;
   58::101     7e-12  59%  101 aa  RS14_VESOH RecName: Full=30S ribosomal protein S14;
   47::101     7e-12  57%  101 aa  RS14_OPITP RecName: Full=30S ribosomal protein S14;
   57::100     7e-12  61%  100 aa  RS14_MICAN RecName: Full=30S ribosomal protein S14;
   45::101     7e-12  53%  101 aa  RS14_MANSM RecName: Full=30S ribosomal protein S14;
   45::101     7e-12  55%  101 aa  RS14_BLOFL RecName: Full=30S ribosomal protein S14;
   45::99      7e-12  53%   99 aa  RS14_BACTN RecName: Full=30S ribosomal protein S14;
   40::101     7e-12  50%  101 aa  RS14_AERS4 RecName: Full=30S ribosomal protein S14;
   40::101     7e-12  50%  101 aa  RS14_AERHH RecName: Full=30S ribosomal protein S14;
   57::100     7e-12  64%  100 aa  RS14_ACAM1 RecName: Full=30S ribosomal protein S14;
   46::89      9e-12  57%   89 aa  RS14_STAS1 RecName: Full=30S ribosomal protein S14;
   57::101     9e-12  51%  101 aa  RS14_ROSDO RecName: Full=30S ribosomal protein S14;
   47::89      9e-12  58%   89 aa  RS14_PARD8 RecName: Full=30S ribosomal protein S14;
   50::101     9e-12  58%  101 aa  RS14_COREF RecName: Full=30S ribosomal protein S14;
   50::101     9e-12  56%  101 aa  RS14_CORDI RecName: Full=30S ribosomal protein S14;
   57::101     9e-12  58%  101 aa  RS14_COLP3 RecName: Full=30S ribosomal protein S14;
   45::99      9e-12  53%   99 aa  RS14_BACFR RecName: Full=30S ribosomal protein S14;
   45::99      9e-12  53%   99 aa  RS14_BACFN RecName: Full=30S ribosomal protein S14;
   47::101     9e-12  57%  101 aa  RS14_ALHEH RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  51%  101 aa  RS14_SHEDO RecName: Full=30S ribosomal protein S14;
   47::89      1e-11  56%   89 aa  RS14_PORGI RecName: Full=30S ribosomal protein S14;
   47::89      1e-11  56%   89 aa  RS14_PORG3 RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_PASMU RecName: Full=30S ribosomal protein S14;
    1::89      1e-11  64%   89 aa  RS14_LEUCK RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAES2 RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAES1 RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAEIN RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAEIG RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAEIE RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_HAEI8 RecName: Full=30S ribosomal protein S14;
   59::102     1e-11  61%  102 aa  RS14_DICNV RecName: Full=30S ribosomal protein S14;
   50::101     1e-11  58%  101 aa  RS14_CORU7 RecName: Full=30S ribosomal protein S14;
   59::101     1e-11  58%  101 aa  RS14_CAUCR RecName: Full=30S ribosomal protein S14;
   46::89      1e-11  59%   89 aa  RS14_BACP2 RecName: Full=30S ribosomal protein S14;
   47::101     1e-11  51%  101 aa  RS14_ANAPZ RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_ACTPJ RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_ACTP7 RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  53%  101 aa  RS14_ACTP2 RecName: Full=30S ribosomal protein S14;
   40::100     1e-11  51%  100 aa  RR14_LEPTE RecName: Full=30S ribosomal protein S14, chloroplastic;
   59::101     1e-11  60%  101 aa  RS14_THIDA RecName: Full=30S ribosomal protein S14;
   59::101     1e-11  60%  101 aa  RS14_THICR RecName: Full=30S ribosomal protein S14;
   63::100     1e-11  68%  100 aa  RS14_SYNY3 RecName: Full=30S ribosomal protein S14;
   57::101     1e-11  53%  101 aa  RS14_SHESW RecName: Full=30S ribosomal protein S14;
   57::101     1e-11  53%  101 aa  RS14_SHEPC RecName: Full=30S ribosomal protein S14;
   58::101     1e-11  57%  101 aa  RS14_RHOFD RecName: Full=30S ribosomal protein S14;
   59::101     1e-11  56%  101 aa  RS14_RHILO RecName: Full=30S ribosomal protein S14;
   45::101     1e-11  51%  101 aa  RS14_PSEHT RecName: Full=30S ribosomal protein S14;
   58::100     1e-11  60%  100 aa  RS14_PROMS RecName: Full=30S ribosomal protein S14;
   57::100     1e-11  61%  100 aa  RS14_PROMP RecName: Full=30S ribosomal protein S14;
   57::99      1e-11  63%   99 aa  RS14_PROMA RecName: Full=30S ribosomal protein S14;
   58::100     1e-11  60%  100 aa  RS14_PROM9 RecName: Full=30S ribosomal protein S14;
   58::100     1e-11  60%  100 aa  RS14_PROM2 RecName: Full=30S ribosomal protein S14;
   59::101     1e-11  60%  101 aa  RS14_NITEC RecName: Full=30S ribosomal protein S14;
   41::101     1e-11  53%  101 aa  RS14_MYCS2 RecName: Full=30S ribosomal protein S14;
   57::100     1e-11  61%  100 aa  RS14_CYAP7 RecName: Full=30S ribosomal protein S14;
   57::101     1e-11  53%  101 aa  RS14_CAUSK RecName: Full=30S ribosomal protein S14;
   58::101     1e-11  57%  101 aa  RS14_ACTSZ RecName: Full=30S ribosomal protein S14;
   58::100     1e-11  56%  100 aa  RS14Z_LEGPL RecName: Full=30S ribosomal protein S14 type Z;
   58::100     1e-11  56%  100 aa  RS14Z_LEGPH RecName: Full=30S ribosomal protein S14 type Z;
   58::100     1e-11  56%  100 aa  RS14Z_LEGPA RecName: Full=30S ribosomal protein S14 type Z;
   58::100     1e-11  65%  100 aa  RR14_NEPOL RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::89      2e-11  63%   89 aa  RS14_STREM RecName: Full=30S ribosomal protein S14;
   45::89      2e-11  60%   89 aa  RS14_CHLP8 RecName: Full=30S ribosomal protein S14;
   59::101     2e-11  58%  101 aa  RS14_BARBK RecName: Full=30S ribosomal protein S14;
   57::99      2e-11  56%   99 aa  RS14_BACV8 RecName: Full=30S ribosomal protein S14;
   45::101     2e-11  53%  101 aa  RS14_SERP5 RecName: Full=30S ribosomal protein S14;
   45::89      2e-11  58%   89 aa  RS14_PROA2 RecName: Full=30S ribosomal protein S14;
   45::89      2e-11  58%   89 aa  RS14_PELLD RecName: Full=30S ribosomal protein S14;
   56::101     2e-11  57%  101 aa  RS14_METPP RecName: Full=30S ribosomal protein S14;
    1::89      2e-11  64%   89 aa  RS14_LEUMM RecName: Full=30S ribosomal protein S14;
   45::101     2e-11  53%  101 aa  RS14_ERWT9 RecName: Full=30S ribosomal protein S14;
   45::89      2e-11  60%   89 aa  RS14_CHLTE RecName: Full=30S ribosomal protein S14;
   43::100     2e-11  52%  100 aa  RR14_RHDSA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-11  64%  100 aa  RR14_PHYPA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-11  57%  100 aa  RS14_TRIEI RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPM RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPG RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPF RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPD RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPC RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRPB RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRP8 RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRP6 RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRP3 RecName: Full=30S ribosomal protein S14;
   47::89      3e-11  63%   89 aa  RS14_STRP1 RecName: Full=30S ribosomal protein S14;
   57::101     3e-11  56%  101 aa  RS14_PSEAE RecName: Full=30S ribosomal protein S14;
   57::101     3e-11  56%  101 aa  RS14_PSEAB RecName: Full=30S ribosomal protein S14;
   57::101     3e-11  56%  101 aa  RS14_PSEA8 RecName: Full=30S ribosomal protein S14;
   57::101     3e-11  56%  101 aa  RS14_PSEA7 RecName: Full=30S ribosomal protein S14;
    1::89      3e-11  64%   89 aa  RS14_PROVI RecName: Full=30S ribosomal protein S14;
   58::100     3e-11  60%  100 aa  RS14_PROMT RecName: Full=30S ribosomal protein S14;
   58::100     3e-11  60%  100 aa  RS14_PROM1 RecName: Full=30S ribosomal protein S14;
   58::100     3e-11  58%  100 aa  RS14_PROM0 RecName: Full=30S ribosomal protein S14;
   58::101     3e-11  52%  101 aa  RS14_MARMM RecName: Full=30S ribosomal protein S14;
   58::101     3e-11  61%  101 aa  RS14_KINRD RecName: Full=30S ribosomal protein S14;
   57::101     3e-11  56%  101 aa  RS14_GLUOX RecName: Full=30S ribosomal protein S14;
   45::101     3e-11  53%  101 aa  RS14_BUCAK RecName: Full=30S ribosomal protein S14;
   59::101     3e-11  56%  101 aa  RS14_BARHE RecName: Full=30S ribosomal protein S14;
   40::100     3e-11  54%  100 aa  RR14_ZYGCR RecName: Full=30S ribosomal protein S14, chloroplastic;
   59::101     4e-11  56%  101 aa  RS14_XANP2 RecName: Full=30S ribosomal protein S14;
   40::101     4e-11  48%  101 aa  RS14_MYCVP RecName: Full=30S ribosomal protein S14;
   58::101     4e-11  55%  101 aa  RS14_MESSB RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATW RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATT RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATO RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATN RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATM RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATH RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRATF RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRAT1 RecName: Full=30S ribosomal protein S14;
   57::101     4e-11  58%  101 aa  RS14_FRAP2 RecName: Full=30S ribosomal protein S14;
   50::101     4e-11  56%  101 aa  RS14_CORJK RecName: Full=30S ribosomal protein S14;
   45::89      4e-11  58%   89 aa  RS14_CHLPD RecName: Full=30S ribosomal protein S14;
   45::89      4e-11  58%   89 aa  RS14_CHLL2 RecName: Full=30S ribosomal protein S14;
   57::100     4e-11  61%  100 aa  RR14_CHAGL RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::89      6e-11  57%   89 aa  RS14_PEDPA RecName: Full=30S ribosomal protein S14;
   56::101     6e-11  57%  101 aa  RS14_LEPCP RecName: Full=30S ribosomal protein S14;
   63::101     6e-11  62%  101 aa  RS14_GLUDA RecName: Full=30S ribosomal protein S14;
   45::89      6e-11  56%   89 aa  RS14_CHLCH RecName: Full=30S ribosomal protein S14;
   59::101     6e-11  56%  101 aa  RS14_BARQU RecName: Full=30S ribosomal protein S14;
   58::101     6e-11  57%  101 aa  RS14_ACICJ RecName: Full=30S ribosomal protein S14;
   45::99      6e-11  55%   99 aa  RR14_PINKO RecName: Full=30S ribosomal protein S14,
   45::100     6e-11  50%  100 aa  RR14_ODOSI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     6e-11  61%  100 aa  RR14_MARPO RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     6e-11  61%  100 aa  RR14_ANGEV RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::101     7e-11  60%  101 aa  RS14_RICPR RecName: Full=30S ribosomal protein S14;
   57::101     7e-11  56%  101 aa  RS14_PHEZH RecName: Full=30S ribosomal protein S14;
   40::101     7e-11  47%  101 aa  RS14_MYCGI RecName: Full=30S ribosomal protein S14;
   64::101     7e-11  66%  101 aa  RS14_DECAR RecName: Full=30S ribosomal protein S14;
   46::89      7e-11  59%   89 aa  RS14_AKKM8 RecName: Full=30S ribosomal protein S14;
   40::100     7e-11  49%  100 aa  RR14_PHATR RecName: Full=30S ribosomal protein S14, chloroplastic;
   45::101     9e-11  53%  101 aa  RS14_STRGG RecName: Full=30S ribosomal protein S14;
   57::101     9e-11  60%  101 aa  RS14_RICTY RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  60%  101 aa  RS14_RHOSR RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  58%  101 aa  RS14_PSYCK RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  58%  101 aa  RS14_PSYA2 RecName: Full=30S ribosomal protein S14;
   57::101     9e-11  53%  101 aa  RS14_PSEU5 RecName: Full=30S ribosomal protein S14;
   57::101     9e-11  56%  101 aa  RS14_PSEF5 RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  60%  101 aa  RS14_NOCFA RecName: Full=30S ribosomal protein S14;
   50::101     9e-11  58%  101 aa  RS14_MYCUA RecName: Full=30S ribosomal protein S14;
   50::101     9e-11  58%  101 aa  RS14_MYCMM RecName: Full=30S ribosomal protein S14;
   46::101     9e-11  54%  101 aa  RS14_MYCA9 RecName: Full=30S ribosomal protein S14;
   40::89      9e-11  58%   89 aa  RS14_LACSS RecName: Full=30S ribosomal protein S14;
   68::101     9e-11  71%  101 aa  RS14_CORGL RecName: Full=30S ribosomal protein S14;
   68::101     9e-11  71%  101 aa  RS14_CORGB RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUSU RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUSI RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUO2 RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUME RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUC2 RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUAB RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUA2 RecName: Full=30S ribosomal protein S14;
   59::101     9e-11  53%  101 aa  RS14_BRUA1 RecName: Full=30S ribosomal protein S14;
   48::101     1e-10  54%  101 aa  RS14_STRMK RecName: Full=30S ribosomal protein S14;
   57::101     1e-10  56%  101 aa  RS14_PSEMY RecName: Full=30S ribosomal protein S14;
   45::101     1e-10  49%  101 aa  RS14_PSEE4 RecName: Full=30S ribosomal protein S14;
   45::89      1e-10  56%   89 aa  RS14_PELPB RecName: Full=30S ribosomal protein S14;
   36::89      1e-10  52%   89 aa  RS14_OENOB RecName: Full=30S ribosomal protein S14;
   59::101     1e-10  51%  101 aa  RS14_OCHA4 RecName: Full=30S ribosomal protein S14;
   57::101     1e-10  60%  101 aa  RS14_MYCPA RecName: Full=30S ribosomal protein S14;
   46::89      1e-10  59%   89 aa  RS14_LACBA RecName: Full=30S ribosomal protein S14;
   59::101     1e-10  51%  101 aa  RS14_HYPNA RecName: Full=30S ribosomal protein S14;
   51::95      1e-10  53%   95 aa  RS14_FUSNN RecName: Full=30S ribosomal protein S14;
   46::89      1e-10  55%   89 aa  RS14_CHLT3 RecName: Full=30S ribosomal protein S14;
   57::101     1e-10  56%  101 aa  RS14_BRASB RecName: Full=30S ribosomal protein S14;
   47::89      1e-10  56%   89 aa  RS14_AZOPC RecName: Full=30S ribosomal protein S14;
   59::101     1e-10  56%  101 aa  RS14_AZOC5 RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  55%  101 aa  RS14_XYLFT RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  55%  101 aa  RS14_XYLFM RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  55%  101 aa  RS14_XYLF2 RecName: Full=30S ribosomal protein S14;
   59::101     2e-10  58%  101 aa  RS14_PSYWF RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  56%  101 aa  RS14_PSEU2 RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  56%  101 aa  RS14_PSESM RecName: Full=30S ribosomal protein S14;
   45::101     2e-10  47%  101 aa  RS14_PSEPK RecName: Full=30S ribosomal protein S14;
   45::101     2e-10  47%  101 aa  RS14_PSEP1 RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  56%  101 aa  RS14_PSE14 RecName: Full=30S ribosomal protein S14;
   59::101     2e-10  58%  101 aa  RS14_NITMU RecName: Full=30S ribosomal protein S14;
   59::101     2e-10  56%  101 aa  RS14_NITEU RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  51%  101 aa  RS14_CHRSD RecName: Full=30S ribosomal protein S14;
   45::89      2e-10  56%   89 aa  RS14_CHLPB RecName: Full=30S ribosomal protein S14;
   40::100     2e-10  49%  100 aa  RR14_OLTVI RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::101     2e-10  55%  101 aa  RS14_XYLFA RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  58%  101 aa  RS14_RICRS RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  58%  101 aa  RS14_RICRO RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  58%  101 aa  RS14_RICM5 RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  58%  101 aa  RS14_RICFE RecName: Full=30S ribosomal protein S14;
   57::101     2e-10  58%  101 aa  RS14_RICCN RecName: Full=30S ribosomal protein S14;
   43::101     2e-10  46%  101 aa  RS14_PSYIN RecName: Full=30S ribosomal protein S14;
   45::101     2e-10  47%  101 aa  RS14_PSEPW RecName: Full=30S ribosomal protein S14;
   45::101     2e-10  47%  101 aa  RS14_PSEPG RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  49%  101 aa  RS14_EHRRW RecName: Full=30S ribosomal protein S14;
   48::102     2e-10  49%  102 aa  RS14_EHRRG RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  49%  101 aa  RS14_EHRCR RecName: Full=30S ribosomal protein S14;
   47::101     2e-10  49%  101 aa  RS14_EHRCJ RecName: Full=30S ribosomal protein S14;
   46::89      2e-10  55%   89 aa  RS14_BACSK RecName: Full=30S ribosomal protein S14;
   56::100     2e-10  56%  100 aa  RR14_STIHE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-10  57%  100 aa  RR14_LOBMA RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::101     3e-10  51%  101 aa  RS14_XANOR RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANOP RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANOM RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANCP RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANCB RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANC8 RecName: Full=30S ribosomal protein S14;
   47::101     3e-10  51%  101 aa  RS14_XANAC RecName: Full=30S ribosomal protein S14;
   57::101     3e-10  60%  101 aa  RS14_STRAW RecName: Full=30S ribosomal protein S14;
   57::101     3e-10  58%  101 aa  RS14_RICAH RecName: Full=30S ribosomal protein S14;
   46::89      3e-10  52%   89 aa  RS14_OCEIH RecName: Full=30S ribosomal protein S14;
   57::100     3e-10  59%  100 aa  RS14_NOSP7 RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_MYXXD RecName: Full=30S ribosomal protein S14;
   47::89      3e-10  56%   89 aa  RS14_AMOA5 RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIBY RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIBT RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIBS RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIBC RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIB5 RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIB3 RecName: Full=30S ribosomal protein S14;
   59::101     3e-10  56%  101 aa  RS14_ACIAD RecName: Full=30S ribosomal protein S14;
   45::99      3e-10  53%   99 aa  RR14_PINTH RecName: Full=30S ribosomal protein S14,
   55::100     3e-10  57%  100 aa  RR14_GUITH RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     3e-10  49%  100 aa  RR14_EPIVI RecName: Full=Plastid 30S ribosomal protein S14;
   46::100     3e-10  53%  100 aa  RR14_CYAME RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-10  61%  100 aa  RR14_ANTFO RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::101     4e-10  51%  101 aa  RS14_XANC5 RecName: Full=30S ribosomal protein S14;
   57::101     4e-10  53%  101 aa  RS14_RICBR RecName: Full=30S ribosomal protein S14;
   57::101     4e-10  53%  101 aa  RS14_RICB8 RecName: Full=30S ribosomal protein S14;
   50::101     4e-10  56%  101 aa  RS14_MYCTU RecName: Full=30S ribosomal protein S14;
   50::101     4e-10  56%  101 aa  RS14_MYCTA RecName: Full=30S ribosomal protein S14;
   50::101     4e-10  56%  101 aa  RS14_MYCBP RecName: Full=30S ribosomal protein S14;
   50::101     4e-10  56%  101 aa  RS14_MYCBO RecName: Full=30S ribosomal protein S14;
   51::100     4e-10  56%  100 aa  RR14_GRATL RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::101     5e-10  57%  101 aa  RS14_RICCK RecName: Full=30S ribosomal protein S14;
   41::89      5e-10  55%   89 aa  RS14_PHYAS RecName: Full=30S ribosomal protein S14;
   41::89      5e-10  55%   89 aa  RS14_ONYPE RecName: Full=30S ribosomal protein S14;
   57::101     5e-10  51%  101 aa  RS14_NITHX RecName: Full=30S ribosomal protein S14;
    1::89      5e-10  56%   89 aa  RS14_LACPL RecName: Full=30S ribosomal protein S14;
   41::89      5e-10  55%   89 aa  RS14_AYWBP RecName: Full=30S ribosomal protein S14;
   57::100     5e-10  57%  100 aa  RR14_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S14;
   64::101     6e-10  58%  101 aa  RS14_PHOPR RecName: Full=30S ribosomal protein S14;
   59::101     6e-10  56%  101 aa  RS14_PARUW RecName: Full=30S ribosomal protein S14;
   57::101     6e-10  51%  101 aa  RS14_NITWN RecName: Full=30S ribosomal protein S14;
   59::101     6e-10  53%  101 aa  RS14_ARTS2 RecName: Full=30S ribosomal protein S14;
   40::100     6e-10  47%  100 aa  RR14_PORYE RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::101     8e-10  61%  101 aa  RS14_STRCO RecName: Full=30S ribosomal protein S14;
   37::89      8e-10  53%   89 aa  RS14_STRA5 RecName: Full=30S ribosomal protein S14;
   37::89      8e-10  53%   89 aa  RS14_STRA3 RecName: Full=30S ribosomal protein S14;
   37::89      8e-10  53%   89 aa  RS14_STRA1 RecName: Full=30S ribosomal protein S14;
   37::89      8e-10  55%   89 aa  RS14_LACS1 RecName: Full=30S ribosomal protein S14;
   63::100     8e-10  63%  100 aa  RS14_CYAP8 RecName: Full=30S ribosomal protein S14;
   57::101     8e-10  53%  101 aa  RS14_BRAJA RecName: Full=30S ribosomal protein S14;
   58::100     8e-10  56%  100 aa  RR14_PORPU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     8e-10  59%  100 aa  RR14_HUPLU RecName: Full=30S ribosomal protein S14, chloroplastic;
   63::100     8e-10  61%  100 aa  RR14_EMIHU RecName: Full=30S ribosomal protein S14, chloroplastic;
   63::101     1e-09  59%  101 aa  RS14_MAGSA RecName: Full=30S ribosomal protein S14;
   56::89      1e-09  65%   89 aa  RS14_LACLA RecName: Full=30S ribosomal protein S14;
   58::101     1e-09  55%  101 aa  RS14_HAHCH RecName: Full=30S ribosomal protein S14;
   40::100     1e-09  47%  100 aa  RR14_DAUCA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     1e-09  57%  100 aa  RR14_CERDE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     1e-09  57%  100 aa  RR14_ANEMR RecName: Full=30S ribosomal protein S14, plastid;
   46::89      1e-09  52%   89 aa  RS14_STAHJ RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAES RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAEQ RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAW RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAS RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAR RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAN RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAM RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAE RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAC RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAAB RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAA9 RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAA8 RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAA3 RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAA2 RecName: Full=30S ribosomal protein S14;
   46::89      1e-09  52%   89 aa  RS14_STAA1 RecName: Full=30S ribosomal protein S14;
   40::100     1e-09  47%  100 aa  RR14_PANGI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     1e-09  55%  100 aa  RR14_LOTJA RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     1e-09  47%  100 aa  RR14_LACSA RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     1e-09  47%  100 aa  RR14_HELAN RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     1e-09  47%  100 aa  RR14_GUIAB RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     1e-09  57%  100 aa  RR14_BARVE RecName: Full=30S ribosomal protein S14, chloroplastic;
   64::101     2e-09  55%  101 aa  RS14_VIBCH RecName: Full=30S ribosomal protein S14;
   64::101     2e-09  55%  101 aa  RS14_VIBC3 RecName: Full=30S ribosomal protein S14;
   47::101     2e-09  51%  101 aa  RS14_PROAC RecName: Full=30S ribosomal protein S14;
   58::101     2e-09  52%  101 aa  RS14_MARAV RecName: Full=30S ribosomal protein S14;
   59::101     2e-09  53%  101 aa  RS14_ARTAT RecName: Full=30S ribosomal protein S14;
   56::89      2e-09  65%   89 aa  RS142_ENTFA RecName: Full=30S ribosomal protein S14 2;
   56::89      2e-09  65%   89 aa  RS141_ENTFA RecName: Full=30S ribosomal protein S14 1;
   43::103     2e-09  49%  103 aa  RR14_WHEAT RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  47%  100 aa  RR14_TOBAC RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  51%  100 aa  RR14_STAPU RecName: Full=30S ribosomal protein S14, chloroplastic;
   56::100     2e-09  53%  100 aa  RR14_PLAOC RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  47%  100 aa  RR14_NICTO RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  47%  100 aa  RR14_NICSY RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  47%  100 aa  RR14_NANDO RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_LOLPR RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_HORVU RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-09  51%  100 aa  RR14_GOSHI RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-09  51%  100 aa  RR14_GOSBA RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-09  51%  100 aa  RR14_EUCGG RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     2e-09  47%  100 aa  RR14_CUSEX RecName: Full=30S ribosomal protein S14, plastid;
   46::100     2e-09  51%  100 aa  RR14_CARPA RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_BRADI RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     2e-09  56%  100 aa  RR14_ADICA RecName: Full=30S ribosomal protein S14, chloroplastic;
   56::99      2e-09  50%   99 aa  RT14_MARPO RecName: Full=Ribosomal protein S14, mitochondrial;
   59::101     2e-09  53%  101 aa  RS14_LEIXX RecName: Full=30S ribosomal protein S14;
   57::99      2e-09  56%   99 aa  RR14_WELMI RecName: Full=30S ribosomal protein S14,
   43::103     2e-09  49%  103 aa  RR14_SORBI RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_SACOF RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_SACHY RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_OLIPU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_NASOF RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_MANES RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     2e-09  49%  103 aa  RR14_MAIZE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_LEMMI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_CRUWA RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-09  51%  100 aa  RR14_CITSI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_BUXMI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_ARAHI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_AETGR RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-09  55%  100 aa  RR14_AETCO RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::101     3e-09  50%  101 aa  RS14_RHOP5 RecName: Full=30S ribosomal protein S14;
   59::101     3e-09  49%  101 aa  RS14_BEII9 RecName: Full=30S ribosomal protein S14;
   57::100     3e-09  55%  100 aa  RR14_SOLTU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_SOLLC RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_SOLBU RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     3e-09  49%  103 aa  RR14_ORYSJ RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     3e-09  49%  103 aa  RR14_ORYSI RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     3e-09  49%  103 aa  RR14_ORYSA RecName: Full=30S ribosomal protein S14, chloroplastic;
   43::103     3e-09  49%  103 aa  RR14_ORYNI RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_LEPVR RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     3e-09  46%  100 aa  RR14_JASNU RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     3e-09  47%  100 aa  RR14_IPOPU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_FAGEA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_DRANE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_CUCSA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_CAPBU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_ATRBE RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-09  55%  100 aa  RR14_ARATH RecName: Full=30S ribosomal protein S14, chloroplastic;
   45::101     4e-09  51%  101 aa  RS14_SALTO RecName: Full=30S ribosomal protein S14;
   59::101     4e-09  53%  101 aa  RS14_CLAMS RecName: Full=30S ribosomal protein S14;
   59::101     4e-09  53%  101 aa  RS14_CLAM3 RecName: Full=30S ribosomal protein S14;
   60::103     4e-09  55%  103 aa  RR14_AGRST RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::101     5e-09  47%  101 aa  RS14_RHOPT RecName: Full=30S ribosomal protein S14;
   68::101     5e-09  62%  101 aa  RS14_BAUCH RecName: Full=30S ribosomal protein S14;
   59::101     7e-09  51%  101 aa  RS14_RENSM RecName: Full=30S ribosomal protein S14;
   57::100     7e-09  55%  100 aa  RR14_LIRTU RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     7e-09  55%  100 aa  RR14_CUSRE RecName: Full=Plastid 30S ribosomal protein S14;
   47::100     9e-09  43%  100 aa  RT14_VICFA RecName: Full=Ribosomal protein S14, mitochondrial;
   57::101     9e-09  47%  101 aa  RS14_RHOPB RecName: Full=30S ribosomal protein S14;
   59::101     9e-09  49%  101 aa  RS14_KOCRD RecName: Full=30S ribosomal protein S14;
   68::101     9e-09  62%  101 aa  RS14_BLOPB RecName: Full=30S ribosomal protein S14;
   58::100     9e-09  53%  100 aa  RR14_SOYBN RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     9e-09  53%  100 aa  RR14_PHAVU RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     9e-09  49%  100 aa  RR14_PHAAO RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     9e-09  49%  100 aa  RR14_PELHO RecName: Full=30S ribosomal protein S14, chloroplastic;
   40::100     9e-09  46%  100 aa  RR14_COFAR RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     9e-09  53%  100 aa  RR14_CHLSC RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     9e-09  55%  100 aa  RR14_CALFG RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     9e-09  53%  100 aa  RR14_AMBTC RecName: Full=30S ribosomal protein S14, chloroplastic;
   62::101     1e-08  60%  101 aa  RS14_SALAI RecName: Full=30S ribosomal protein S14;
   63::100     1e-08  61%  100 aa  RS14_ANAVT RecName: Full=30S ribosomal protein S14;
   63::100     1e-08  61%  100 aa  RS14_ANASP RecName: Full=30S ribosomal protein S14;
   58::100     1e-08  53%  100 aa  RR14_NYMAL RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     1e-08  53%  100 aa  RR14_MORIN RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     1e-08  53%  100 aa  RR14_ILLOL RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::101     2e-08  42%  101 aa  RS14_OLICO RecName: Full=30S ribosomal protein S14;
   46::100     2e-08  49%  100 aa  RR14_OENPA RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-08  49%  100 aa  RR14_OENGL RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-08  49%  100 aa  RR14_OENEH RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-08  49%  100 aa  RR14_OENBI RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     2e-08  49%  100 aa  RR14_OENAR RecName: Full=30S ribosomal protein S14, chloroplastic;
   67::100     2e-08  65%  100 aa  RR14_EUGGR RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     2e-08  52%  100 aa  RR14_CHAVU RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     2e-08  53%  100 aa  RR14_ACOCL RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::99      2e-08  43%   99 aa  RT14_OENBE RecName: Full=Ribosomal protein S14, mitochondrial;
   59::101     2e-08  49%  101 aa  RS14_PELUB RecName: Full=30S ribosomal protein S14;
   46::100     2e-08  49%  100 aa  RR14_VITVI RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::101     2e-08  49%  101 aa  RR14_HELSJ RecName: Full=Plastid 30S ribosomal protein S14;
   57::101     3e-08  47%  101 aa  RS14_RHOPS RecName: Full=30S ribosomal protein S14;
   57::101     3e-08  47%  101 aa  RS14_RHOP2 RecName: Full=30S ribosomal protein S14;
   40::100     3e-08  44%  100 aa  RR14_CYACA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-08  52%  100 aa  RR14_CRYJA RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     3e-08  49%  100 aa  RR14_BIGNA RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     3e-08  49%  100 aa  RR14_CYCTA RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     3e-08  50%  100 aa  RR14_CICAR RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     4e-08  52%  100 aa  RR14_POPTR RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     4e-08  52%  100 aa  RR14_POPAL RecName: Full=30S ribosomal protein S14, chloroplastic;
   57::100     4e-08  52%  100 aa  RR14_PEA RecName: Full=30S ribosomal protein S14, chloroplastic;
   64::101     6e-08  55%  101 aa  RS14_STRM5 RecName: Full=30S ribosomal protein S14;
   57::101     7e-08  44%  101 aa  RS14_RHOPA RecName: Full=30S ribosomal protein S14;AltName:
   58::100     1e-07  51%  100 aa  RR14_SPIOL RecName: Full=30S ribosomal protein S14, chloroplastic;
   46::100     1e-07  47%  100 aa  RR14_DIOEL RecName: Full=30S ribosomal protein S14, chloroplastic;
   58::100     2e-07  51%  100 aa  RR14_PIPCE RecName: Full=30S ribosomal protein S14, chloroplastic;
   47::100     2e-07  41%  100 aa  RT14_BRANA RecName: Full=Ribosomal protein S14, mitochondrial;
   71::114     2e-07  48%  114 aa  RT02_ASHGO RecName: Full=40S ribosomal protein MRP2, mitochondrial;
   68::101     2e-07  56%  101 aa  RS14_HAEDU RecName: Full=30S ribosomal protein S14;
   62::105     3e-07  50%  105 aa  RT02_SCHPO RecName: Full=Probable 40S ribosomal protein mrp2,
   40::100     3e-07  42%  100 aa  RR14_CUSOB RecName: Full=30S ribosomal protein S14, plastid;
   40::100     3e-07  42%  100 aa  RR14_CUSGR RecName: Full=Plastid 30S ribosomal protein S14;
   86::128     6e-07  42%  128 aa  RT14_HUMAN RecName: Full=28S ribosomal protein S14, mitochondrial; 
   71::115     1e-06  49%  115 aa  RT02_YEAST RecName: Full=37S ribosomal protein MRP2,
   58::100     1e-06  49%  100 aa  RR14_DRIGR RecName: Full=30S ribosomal protein S14, chloroplastic;
   86::128     1e-06  42%  128 aa  RT14_BOVIN RecName: Full=28S ribosomal protein S14, mitochondrial; 
   56::95      1e-06  42%   95 aa  RS14_CARRU RecName: Full=30S ribosomal protein S14;
   73::101     2e-06  62%  101 aa  RS14_NITOC RecName: Full=30S ribosomal protein S14;
   76::101     2e-06  58%  101 aa  RS14_TROWT RecName: Full=30S ribosomal protein S14;
   76::101     2e-06  58%  101 aa  RS14_TROW8 RecName: Full=30S ribosomal protein S14;
   86::128     4e-06  44%  128 aa  RT14_MOUSE RecName: Full=28S ribosomal protein S14, mitochondrial; 
    1::46      9e-06  43%   53 aa  RS14_THEVO RecName: Full=30S ribosomal protein S14P;
    4::45      9e-06  45%   52 aa  RS14_PICTO RecName: Full=30S ribosomal protein S14P;
   42::99      1e-05  36%   99 aa  RT14_PROWI RecName: Full=Ribosomal protein S14, mitochondrial;
    1::46      3e-05  41%   53 aa  RS14_THEAC RecName: Full=30S ribosomal protein S14P;
   10::42      3e-05  55%   50 aa  RS14_METBU RecName: Full=30S ribosomal protein S14P;
    6::43      8e-05  50%   50 aa  RS14_METAC RecName: Full=30S ribosomal protein S14P;
    8::45      1e-04  50%   54 aa  RS14_AERPE RecName: Full=30S ribosomal protein S14P;
    5::43      1e-04  46%   50 aa  RS14_METTH RecName: Full=30S ribosomal protein S14P;
    8::43      1e-04  50%   50 aa  RS14_METMA RecName: Full=30S ribosomal protein S14P;
   18::45      3e-04  62%   54 aa  RS14_PYRAE RecName: Full=30S ribosomal protein S14P;
    2::38      3e-04  55%   62 aa  RL37_METKA RecName: Full=50S ribosomal protein L37e;
   16::52      4e-04  41%   53 aa  RT14_BIGNA RecName: Full=Ribosomal protein S14,
   11::40      4e-04  54%   47 aa  RS14_METST RecName: Full=30S ribosomal protein S14P;
    8::42      4e-04  52%   50 aa  RS14_METBF RecName: Full=30S ribosomal protein S14P;
   12::41      5e-04  54%   48 aa  RS14_METKA RecName: Full=30S ribosomal protein S14P;
    8::49      9e-04  45%   56 aa  RS14_PYRKO RecName: Full=30S ribosomal protein S14P;
    8::49      9e-04  45%   56 aa  RS14_PYRHO RecName: Full=30S ribosomal protein S14P;
    8::49      9e-04  45%   56 aa  RS14_PYRAB RecName: Full=30S ribosomal protein S14P;
    1::61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKKSMVAKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKASW
RS14Z_SYNAS     MAKKSLIAKAKREQKYSVRTYNRCSICGRPRAYYRKFGMCRICLRKLSSKGEIPGVIKSSW
RS14Z_THEFY     MAKKALIAKANRKPKFRVRAYTRCSRCGRPRAVFRKFGLCRICFREMAHRGELPGVTKASW
RS14Z_HERA2     MAKKSMIVKANRAPKFSTQGYNRCKRCGRPRAYMRKFGICRICFRELASQGLIPGVTKSSW
RS14Z_ACIC1     MAKKALIVKAQRKPKFAVRAYTRCNRCGRPHSVYRKFGLCRLCLREMAHRGELPGVTKSSW
RS14Z_SYNFM     MAKKSLIAKAKRTPKFGVRTYNRCPICGRPRAYLRKFGICRICFRSMALKGELPGVVKSSW
RS14Z_NOCFA     MAKKALVNKANRKPKFAVRAYTRCQRCGRPHAVYRKFGLCRVCLRDMAHKGELPGVHKSSW
RS14Z_DESHY     MAKKSMIVRNARQPKYAVRHHNRCKLCGRPHAYIRKFGICRICFRELAYKGELPGVKKASW
RS14Z_DESHD     MAKKSMIVRNARQPKYAVRHHNRCKLCGRPHAYIRKFGICRICFRELAYKGELPGVKKASW
RS14Z_CARHZ     MAKKSMIAKAQRPPKFKVRKYNRCKICGRPRAYLRDFGMCRICFRKLAHQGEIPGVKKASW
RS14Z_STRMU     MAKKSMVAKSKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVTKASW
RS14Z_RUBXD     MPRKALIAKQQRKQKYRTREYNRCQRCGRARAYYRKFGLCRICLRELAHEGKIPGVKKASW
RS14Z_FINM2     MAKKSMIAKQKRPAKFSTREYNRCKICGRPHGYLKKYGICRICFRELAYKGEIPGVRKASW
RS14Z_STRT2     MAKKSLIAKNKRPAKFSTQAYTRCERCGRPHSVYRKFKLCRVCFRELAHKGQIPGVTKASW
RS14Z_STRT1     MAKKSLIAKNKRPAKFSTQAYTRCERCGRPHSVYRKFKLCRVCFRELAHKGQIPGVTKASW
RS14Z_NOCSJ     MAKTALKVKAARKPKFAVRGYTRCQRCGRPKAVYRKFGLCRICLREMAHRGELPGVTKSSW
RS14Z_NITSB     MAKKSMIAKAKRKPKFKVRAYTRCRICGRPKSVYRDFGLCRICLRKMANEGLLPGVKKASW
RS14Z_MYCUA     MAKKALVNKAARKPKFAVRGYTRCSKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCMM     MAKKALVNKAARKPKFAVRGYTRCSKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCLE     MAKKALVNKAARKPKFTVRGYTRCSKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCLB     MAKKALVNKAARKPKFTVRGYTRCSKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_FRASN     MAKKALVEKAARKPKYAVRGYTRCQRCGRPRSVYRVFGLCRVCLRQMAHRGELPGVTKSSW
RS14Z_NATTJ     MARKSLIAKAKKRPKFKTRAYNRCKICGRSHAYLRKFGMCRICFRELAHEGKLPGVRKASW
RS14Z_MYCPA     MAKKALVNKAARKPKFAVRGYTRCNKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCA1     MAKKALVNKAARKPKFAVRGYTRCNKCGRPRAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_LACRJ     MAKKSMIAKCNRPAKFSSREYTRCARCGRPHSVYRKFHLCRICLRELAHKGQIPGLKKASW
RS14Z_LACRD     MAKKSMIAKCNRPAKFSSREYTRCARCGRPHSVYRKFHLCRICLRELAHKGQIPGLKKASW
RS14Z_HELMI     MAKTSMIVKQSRTPKFRVRAHNRCKICGRPHAYMRKFGMCRICFRNLAYKGEIPGVTKASW
RS14Z_GEOTN     MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
RS14Z_GEOSW     MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
RS14Z_GEOKA     MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
RS14Z_STRSV     MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVTKASW
RS14Z_STRGC     MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVTKASW
RS14Z_HALOH     MTRKALMEKAKKEPKYSTRKVNRCKRCGRARGYMRKFDLCRICFRELAHKGEIPGVKKASW
RS14Z_LACF3     MAKKSMIAKSERPAKFSTQEYTRCERCGRPHSVYRKFHLCRICLRDLAHKGQIPGMKKASW
RS14Z_DESOH     MARTSLVVKASREPKFSARKYNRCPICGRPRAFIRKFGICRICFRSMASMGKLPGVTKSSW
RS14Z_CLOCE     MAKKAMIIKQQRTPKFSTRAYNRCKICGRPHAYIRKFGICRLCFRQLAYKGQIPGVKKASW
RS14Z_BACWK     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACHK     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACCZ     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACCR     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACCN     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC7     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC4     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC3     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC2     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC1     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACC0     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACAN     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACAH     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACAC     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_BACAA     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_THETH     MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
RS14Z_THET8     MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
RS14Z_THET2     MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
RS14Z_STRTD     MAKKSLIAKNKRPAKFSTQAYTRCERCGRPHSVYRKFKLCRVCFRQLAHRGQIPGVTKASW
RS14Z_MYCTU     MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCTA     MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCBT     MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCBP     MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCBO     MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_STRA5     MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTKASW
RS14Z_STRA3     MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTKASW
RS14Z_STRA1     MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFQLCRVCFRDLAYKGQVPGVTKASW
RS14Z_MYCS2     MAKKALVHKANKKPKFAVRAYTRCNKCGRPHSVYRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MAGSM     MAKTSMVNKANSKPKFAVRSYNRCQRCGRPRGYLRKFKMCRLCVRQLALRGEIPGVTKASW
RS14Z_LACS1     MAKKSQIAKNKRPAKFSTQEYTRCERCGRPHSVYRKFKLCRVCLRDLAHKGQIPGMKKASW
RS14Z_BACST     MAKKSMIIKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
RS14Z_ANOFW     MAKKSMIAKQKRTPKFKVQAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_RHOBA     MASKSKVAKALRTPKFSTRKENRCKFCGRPRSVYRKFGLCRICFRENANAGLIPGVRKSSW
RS14Z_LACLS     MAKKSMVVKNQRPAKFSTQAYTRCERCGRPHSVYRKFKLCRICLRELAYKGQLPGVKKASW
RS14Z_LACLM     MAKKSMVVKNQRPAKFSTQAYTRCERCGRPHSVYRKFKLCRICLRELAYKGQLPGVKKASW
RS14Z_LACLA     MAKKSMVVKNQRPAKFSTQAYTRCERCGRPHSVYRKFKLCRICLRELAYKGQLPGVKKASW
RS14Z_KOSOT     MAKKSMVAKWKRGSKYKVRKYNRCHICGRPRAVYREFGLCRVCFRKLASEGKLPGVKKASW
RS14Z_KINRD     MAKTALITKAARKPKFKVRGYTRCQRCGRPHAVFRKFGLCRICVREMAHAGELPGVTKSSW
RS14Z_CLOTH     MAKKSLIVKQQRKPKYRTRAYNRCKLCGRPHAYMRKFGICRLCFRDLAYKGQIPGVRKASW
RS14Z_PELCD     MAKKSMMIKAARSNKFKVRKYNRCPLCGRPRAYYRKFDMCRICLRKLALEGKLPGVIKSSW
RS14Z_GEOSF     MAKTSMIIKAQRGSKFKVREYNRCPLCGRPRAYYRKFDMCRICLRKLASSGQIPGVIKSSW
RS14Z_DESMR     MARKSLMVKASRKPKFSTRAYNRCPICGRPRAYLRKFGVCRICFRNMSLTGEMPGVRKSSW
RS14Z_BEUC1     MAKTALIQKANSKPKFGVRAYTRCNRCGRPRSVYRKFGLCRICLREMALAGQLPGVTKSSW
RS14Z_ARCB4     MAKKSMIAKQQRTPKFAVRAYTRCSVCGRPHSVYRDFGLCRVCLRKMANEGLLPGVRKASW
RS14Z_STRS7     MAKKSMIAKNKRPAKYSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STREM     MAKKSMIAKNKRPAKYSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRE4     MAKKSMIAKNKRPAKYSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_PROAC     MAKTALKVKAARKPKFGVRAYTRCQRCGRPHSVYRKFGLCRICLREMAHAGQLPGVTKSSW
RS14Z_GEOUR     MAKTSMIIKAQRGSKFKVREYNRCPLCGRPRAYYRKFDMCRICLRKLASAGQIPGVIKSSW
RS14Z_GEOSL     MAKTSMIIKAQRGSKFKVREYNRCPLCGRPRAYYRKFDMCRICLRKLASAGQIPGVIKSSW
RS14Z_GEOMG     MAKTSMIIKAQRGSKFKVREYNRCPLCGRPRAYYRKFDMCRICLRKLASTGQIPGVIKSSW
RS14Z_PETMO     MAKKALIEKSKRTPKYKTREYSRCKVCGRPRAVYREFGLCRICFREQALEGKLPGVKKASW
RS14Z_NAUPA     MAKKSMIAKAKRKPKFKVRAYTRCSICGRVHSVYRDFGICRICLRKMANEGLLPGVKKASW
RS14Z_MOOTA     MAKKSLRVKQARPQKFKVRAYNRCLRCGRPHGYMRKFGLCRICFRELAYKGELPGIVKASW
RS14Z_LACBA     MAKKSQIAKNKRPAKFSTQAYTRCERCGRPHSVYQKFHLCRICLRELAHKGQIPGMKKASW
RS14Z_GEOLS     MAKVSMINKSQRTPKFKVRQHNRCPVCGRPKAFYRKFQMCRICLRKYASAGQIPGVIKSSW
RS14Z_FRASC     MAKKALIEKSNRKPKYAVRGYTRCQRCGRSRSVYRGFGLCRVCLRQMAHRGELPGVTKSSW
RS14Z_DESAP     MAKKSLIEKANRPPAFRVRQYNRCKLCGRPRAYMRKFGVCRICFRSLCYRGQIPGVRKASW
RS14Z_CAMLR     MAKKSMIAKAARKPKFSVRGYTRCQICGRPHSVYRDFGICRVCLRKMANEGLIPGLKKASW
R14Z1_BACLD     MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_FRAAA     MAKKALIEKSNRKPKYAVRGYTRCQRCGRSRSVYRVFGLCRVCLRQMAHRGELPGITKSSW
RS14Z_DESRM     MAKKSMINKANAPQKFTVRGHNRCKLCGRPHGYMRKFGICRICFRELAYRGEIPGVKKASW
RS14Z_BREBN     MAKKSMIIKQQREPKFAVRAYTRCERCGRPHSVLRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_PEDPA     MAKKSLVVKSERPAKFSTQTYTRCERCGRPHSVYRKFHLCRICLRELAHEGQIPGMKKASW
RS14Z_MYCPE     MAKKSLIVKQKKHPKFKVRAYTRCERCGRPRAVIRKFGICRLCFRDLAYKGAIPGVKKASW
RS14Z_GEOSM     MAKTSMIIKAQRGNKFKVRERNRCPLCGRPRAYYRKFDMCRICLRKLSNLGQVPGVIKSSW
RS14Z_GEOBB     MAKTSMIIKAQRGNKFKVRERNRCPLCGRPRAYYRKFDMCRICLRKLSNLGQVPGVIKSSW
RS14Z_ENTFA     MAKKSMIAKNKRPAKHSTQAYTRCERCGRPHSVYRKFHLCRICFRELAYKGQIPGVKKASW
RS14Z_CALS8     MARKALIIKQQRPQKFSTRYYNRCKICGRPRAYLRKFGVCRLCFRKLAHNGEIPGVKKASW
RS14Z_ANATD     MARKALIIKQQRPQKFSTRYYNRCKICGRPRAYLRKFGVCRLCFRKLAHNGEIPGVKKASW
RS14Z_STRU0     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRPM     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRPG     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRPF     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRPD     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRPC     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRP8     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRP6     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRP3     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_STRP1     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_PELPD     MAKVSMIIKSQRKPKFKVQQHNRCEVCGRPKAFYRKFRMCRICLRKYASIGQIPGVIKSSW
RS14Z_DESVV     MSRTSLEVKAQRKPKFSARAYNRCPICGRPRAYLRKFGLCRICFRNMALRGELPGVRKSSW
RS14Z_DESVM     MSRTSLEVKAQRKPKFSARAYNRCPVCGRPRAYMRKFGLCRICFRNMALRGELPGVRKSSW
RS14Z_DESVH     MSRTSLEVKAQRKPKFSARAYNRCPICGRPRAYLRKFGLCRICFRNMALRGELPGVRKSSW
RS14Z_COPPD     MARKALKIKAEKEPKFSTRKYTRCKICGRSRAVYRDFGICRLCLRELAHKGSIPGLKKASW
RS14Z_CAMFF     MAKKSMIAKAARKPKFSARGYTRCQICGRPHSVYKDFGICRVCLRKMANEGLIPGLKKASW
RS14_BACSU      MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_MYXXD     MAKLSKIAQAKRKPKFSVRQYNRCPLCGRPRAFLRKFKMCRICLRNRALRGEVTGVTKSSW
RS14Z_HELPJ     MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMASEGLIPGLRKASW
RS14Z_DEIGD     MANTSKVVKAARGHKFAVQNYNRCSRCGRARGYYRFFGMCRICIRELAHKGELPGVKKASW
RS14Z_BACA2     MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISW6     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISMO     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISMH     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISMF     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISMC     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_LISIN     MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_CAMHC     MAKKSMIAKANRPAKFSSRAYTRCKICGRPHSVYRDFGICRVCLRKLANEGLIPGLKKASW
RS14Z_BACSK     MAKKSMIAKQKRTPKYNVQAYTRCERCGRPHSVLRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_SULNB     MAKKSMIAKQQRKAKFSTQAYTRCNICGRPHSVYRDFGLCRVCLRKMANEGLIPGMRKASW
RS14Z_LACPL     MAKKSQIAKQKRGAKFNVQNYTRCERCGRPHSVYRKFHLCRICLRDLAHKGQIPGMKKASW
RS14Z_CAMC1     MAKKSMIAKAARKPKFAVRGYTRCQICGRPHSVYKDFGICRVCLRKMANEGLIPGLKKASW
RS14Z_LACC3     MAKKSMIAKNNRPAKFAVQEYTRCQRCGRPHSVYRKFKLCRICLRELAHAGQIPGMRKASW
RS14Z_CAMJR     MAKKSMIAKAARKPKFKVRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKKASW
RS14Z_CAMJJ     MAKKSMIAKAARKPKFKVRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKKASW
RS14Z_CAMJE     MAKKSMIAKAARKPKFKVRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKKASW
RS14Z_CAMJD     MAKKSMIAKAARKPKFKVRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKKASW
RS14Z_CAMJ8     MAKKSMIAKAARKPKFKVRAYTRCQICGRPHSVYRDFGICRVCLRKMGNEGLIPGLKKASW
RS14Z_BACHD     MAKKSMIAKQKRTQKYKVREYTRCERCGRPHSVMRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_OCEIH     MAKKSMIAKQKRPQKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_HELPY     MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKASW
RS14Z_HELPS     MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKASW
RS14Z_HELPH     MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKASW
RS14Z_HELPG     MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKASW
RS14Z_EUBE2     MAKTSMKVKQQRAPKFSTRAYTRCTICGRPHSVLRKYGICRICFRELAYKGQIPGVKKASW
RS14Z_DICT6     MAKKSQIVKWLKPKKYKVREYNRCRICGRPRGYIRKFGLCRLCFRELALKGELPGVRKASW
RS14Z_DESDG     MSRTSLEVKAKRKPKFSARAYNRCPICGRPRGYMRKFGICRICFRNMSLRGELPGVRKSSW
RS14Z_DESDA     MSRTSLEVKAKRKPKFSARAYNRCPLCGRPRAFLRQFGICRICFRNMALRGELPGVRKSSW
RS14Z_BIFA0     MAKTCLKVKALRKPKFKVRAYTRCMVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW
RS14Z_ALKMQ     MAKKSLKIKQARTQKYSTREYSRCKICGRPHAYLRKFGVCRICFRELAYKGQIPGVRKASW
RS14Z_ACIF5     MAKKSLIAKSERTPKFKVRAYHRCKLCGRSRGYYRKFGLCRLCFRKHASAGSIPGIVKASW
RS14Z_ACIF2     MAKKSLIAKSERTPKFKVRAYHRCKLCGRSRGYYRKFGLCRLCFRKHASAGSIPGIVKASW
RS14Z_DESAA     MARKSLCVKAQRTPKFKVRTYNRCPLCGRPRGYMRKFGICRICFRNMASEGLLPGVIKSSW
RS14Z_CAMC5     MAKKSMIAKAARAPKFKVRGYTRCQICGRPHSVYKDFGICRVCLRKMANEGLIPGLKKASW
RS14Z_MACCJ     MAKKSMIAKQQRKQKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
RS14Z_DICTD     MAKKSQIVKWLKPKKYKVREYNRCRICGRPRGYIRKFGLCRLCFRELALKGEIPGVRKASW
RS14Z_CHLSY     MAKKSWIVRAQRPPKFSVRAYNRCKICGRSRAYIRKFGMCRICFREHALKGLIPGVVKSSW
RS14Z_CHLAA     MAKKSWIVRAQRPPKFSVRAYNRCKICGRSRAYIRKFGMCRICFREHALKGLIPGVVKSSW
RS14Z_BACP2     MAKKSMIAKQQRKQKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
R14Z2_BACLD     MAKTSMIVKQKREQKFKVREYTRCERCGRPHSVIRKFKLCRICFRELAYKGHIPGVKKASW
RS14Z_CLOD6     MARKAMVVKQQRKQKYATREYTRCTICGRPHSVLKKFGICRICFRELAYKGQIPGVRKASW
RS14Z_BORT9     MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFGMCRICFRNHASAGLIPGVSKSSW
RS14Z_BORHD     MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFGMCRICFRNHASAGLIPGVSKSSW
RS14Z_BORAP     MAKKSMIIKALRKPKYKTRQNNRCKLCGRPRGYLRDFCMCRICFRKYASEGLIPGVSKSSW
RS14Z_UNCTG     MATTSAEAKMRKPQKFATRYRNRCRLCGRPRGYYRDFGICRICLRKLAYNGEIPGVTKSSW
RS14Z_STRPZ     MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVSRKFKLCRVCFRELAYKGQIPGVVKASW
RS14Z_CLOPS     MARKAMIEKWKKEPKYKTRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRKASW
RS14Z_CLOPE     MARKAMIEKWKKEPKYKTRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRKASW
RS14Z_CLOP1     MARKAMIEKWKKEPKYKTRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRKASW
RS14Z_ELUMP     MATKAWVAKMAKPQKFAVRYHNRCQVCGRPRGYYRDFGLCRICLRKMAHQGLIPGVRKSSW
RS14Z_DEIDV     MANTSKVVKAARGHKFAVQNYSRCSRCGRARGYYRFFGMCRICIREMAHKGELPGVKKSSW
RS14Z_DEHSC     MAKTSKIVQSQRASKFKVQHHNRCSRCGRPRGYINRFGLCRICFRELALQGQIPGVRKSSW
RS14Z_DEHSB     MAKTSKIVQSQRASKFKVQHHNRCSRCGRPRGYINRFGLCRICFRELALQGQIPGVRKSSW
RS14Z_DEHE1     MAKTSKIVQSQRASKFKVQHHNRCSRCGRPRGYINRFGLCRICFRELALQGQIPGVRKSSW
RS14Z_BORGA     MAKKSMIIRALRKPKYKTRQNNRCKLCGRPRGYLRDFCMCRICFRKYASQGLIPGVSKSSW
RS14Z_BORBZ     MAKKSMIIRALRKPKYKTRQNNRCKLCGRPRGYLRDFCMCRICFRKYASEGLIPGVSKSSW
RS14Z_BORBU     MAKKSMIIRALRKPKYKTRQNNRCKLCGRPRGYLRDFCMCRICFRKYASEGLIPGVSKSSW
RS14Z_BIFLO     MAKTALKNKAAGKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW
RS14Z_BIFLI     MAKTALKNKAAGKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW
RS14Z_BIFLD     MAKTALKNKAAGKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW
RS14Z_ALKOO     MAKTSLKVKQQRTQKYQTREYSRCKICGRPHAYLRKFGICRICFRELAYKGQIPGVKKASW
RS14Z_UREU1     MAKKSLIAKQKKHQKFAVREYTRCVRCGRPHAVNRKFGVCRLCFRDLAYAGAIPGIKKASW
RS14Z_UREPA     MAKKSLIAKQKKHQKFAVREYTRCVRCGRPHAVNRKFGVCRLCFRDLAYAGAIPGIKKASW
RS14Z_UREP2     MAKKSLIAKQKKHQKFAVREYTRCVRCGRPHAVNRKFGVCRLCFRDLAYAGAIPGIKKASW
RS14Z_TREPS     MATVAMINKAKATPKYATRRYNRCGVCGRPRGYMRRFQLCRLCFRKLASEGQIPGVTKSSW
RS14Z_TREPA     MATVAMINKAKATPKYATRRYNRCGVCGRPRGYMRRFQLCRLCFRKLASEGQIPGVTKSSW
RS14Z_SYMTH     MAKTSLKVKAARPQKFKVRAYNRCKLCGRPRAYMRKFGLCRHCFRKLAHEGQIPGIRKASW
RS14Z_ROSS1     MARKALIVKAQRPQKYKVRAYNRCKICGRPRAYMRKFGMCRICFREHALRGLIPGVTKSSW
RS14Z_SULDN     MAKKSMIVKAAREPKFKVRGYTRCQICGRPHSVIRDFGICRVCFRKMANEGLIPGVRKSSW
RS14Z_LACDB     MAKTSQKVRNHRPAKFSSREYTRCERCGRPHSVYRKFGLCRICLKELGHKGQIPGLKKASW
RS14Z_LACDA     MAKTSQKVRNHRPAKFSSREYTRCERCGRPHSVYRKFGLCRICLKELGHKGQIPGLKKASW
RS14Z_CLOAB     MARKALIEKWKKEPKYSTRAYTRCKICGRPHSVLKKYGICRICFRELAYKGEIPGCRKASW
RS14Z_BORRA     MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFSMCRICFRNHASAGLIPGVSKSSW
RS14Z_BORDL     MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFSMCRICFRNHASAGLIPGVSKSSW
RS14Z_THETN     MARKALIVKQQKPQKYKTREYNRCKICGRPRAYLRKFGMCRLCFRKYAHQGMIPGVKKASW
RS14Z_THESQ     MAKKAMIERWKKPKKYKVREYTRCHICGRPRAVYREFGLCRVCFRKLALEGKLPGVRKASW
RS14Z_THEP1     MAKKAMIERWKKPKKYKVREYTRCHICGRPRAVYREFGLCRVCFRKLALEGKLPGVRKASW
RS14Z_THENN     MAKKAMIERWKKPKKYKVREYTRCHICGRPRAVYREFGLCRVCFRKLALEGKLPGVRKASW
RS14Z_THEMA     MAKKAMIERWKKPKKYKVREYTRCHICGRPRAVYREFGLCRICFRKLALEGKLPGVRKASW
RS14Z_THEPX     MARKALIVKQQKPQKYKTREYNRCKICGRPHAYLRKFGMCRICFRKYAHQGMIPGVKKASW
RS14Z_THEP3     MARKALIVKQQKPQKYKTREYNRCKICGRPHAYLRKFGMCRICFRKYAHQGMIPGVKKASW
RS14Z_FERNB     MAKKSMVERWKKPKKFKVREYTRCSICGRVHSVYREFGICRVCFRKMANEGKLPGVRKASW
RS14Z_TREDE     MATVAKINQANRKAKYPTRQYNRCKVCGRPRGYLRKFKMCRVCFRKLASEGQIPGVTKSSW
RS14Z_STAES     MAKTSMVAXXXXXXXFAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAEQ     MAKTSMVAXXXXXXXFAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_ROSCS     MARKALMVKAQRPQKYTVRAYNRCKICGRSRAYMRKFGMCRICFREHALRGLIPGVTKSSW
RS14Z_PERMH     MARKALWAKSLKEPKFKTRKHARCPLCGRPRGYLRQFDMCRICFRERALRGEIPGVKKASW
RS14Z_MYCS5     MARKALIEKAKKHPKFSSRAYTRCELCGRPHSVLRKYKICRICFRNLAHEGKIPGVKKASW
RS14Z_CLOB6     MARKALIEKWNKTPKYSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLONN     MARKAMIEKWKKTPKYSTRAYTRCRICGRPHSVLKKYGICRICFRELAYRGQIPGCKKASW
RS14Z_SALTO     ---------------FSVRAYTRCQRCGRPKAVYRKFGLCRVCIREMAHRGELPGVSKASW
RS14Z_SALAI     ---------------FSVRAYTRCQRCGRPKAVYRKFGLCRVCIREMAHRGELPGVSKASW
RS14Z_MYCA5     MARKSLMVKAERQPKFKVRKYTRCQICGRVHAVLRKYKICRICFRELAHEGKIPGVKKASW
RS14Z_LEPBA     MAKKSMMERHAKEQKFKVREYNRCPLCGRSRAYLRRFDMCRLCFRDLASKAQIPGVKKSSW
RS14Z_STAHJ     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAW     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAT     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAS     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAR     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAN     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAM     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAE     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAC     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAAB     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAA9     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAA8     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAA3     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAA2     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_STAA1     MAKTSMVAXXXXXXXYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_MYCPU     MAKKSLKVKAARVAKFSTRAYTRCQLCGRPHAVLRKFEICRICFRKLAHEGKIPGLKKASW
RS14Z_CLOBB     MARKAIIEKWSKTPKYKTRAYTRCRICGRPHAVLRKYGVCRICFRELAYKGEIPGCRKASW
RS14Z_CLOBA     MARKAIIEKWSKTPKYKTRAYTRCRICGRPHAVLRKYGVCRICFRELAYKGEIPGCRKASW
RS14Z_THEYD     MARKSKIERAKYPAKFKVRVRNRCKMCGRSRGYLRDFGLCRICFRFLANSGKIPGVVKASW
RS14Z_THELT     MPRKGIIERWKRPKKFKVREYTRCSVCGRPKAVYREFGLCRVCFRKMALEGKLPGVKKASW
RS14Z_CLOBM     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOBL     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOBK     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOBJ     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOBH     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOB1     MARKALIEKWNKTPKHSTRAYTRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_MYCGA     MAKTSLKIKQARHAKFKVRAYTRCKRCGRPHAVYRKFGICRLCFRHLAYNGSLPGVKKSSW
RS14Z_THEAB     MARKGLVERWKKPKKFKTREYTRCKICGRAHSVYREFGICRVCFRKMANEGKLPGVRKATW
RS14Z_SULSY     MARKCLLVKSFKKPKYSTRNKSRCPLCGRPRGYIRQFGMCRICFREKALRGEIPGVRKASW
RS14Z_CLOB8     MARKAIIEKWSKTPKYKTRAYTRCRICGRPHAVLKKYGVCRICFRELAYKGEIPGCRKASW
RS14Z_THEM4     MARKGLVERWKKPKKFKTREYTRCKICGRTHSVYREFGVCRVCFRKMANEGKLPGVRKATW
RS14Z_ANADF     MAKLSKMAQAKRKLKFPVRQYNRCPLCGRPRAFLRKFQMCRLCFRKRALQGEITGVIKSSW
RS14Z_STRGG     ---------------FGVRGYTRCQRCGRPHSVYRKFGLCRVCLREMAHRGELPGVTKSSW
RS14Z_STRCO     ---------------FGVRGYTRCQRCGRPHSVYRKFGLCRVCLREMAHRGELPGVTKSSW
RS14Z_STRAW     ---------------FGVRGYTRCQRCGRPHSVYRKFGLCRVCLREMAHRGELPGVTKSSW
RS14Z_STAS1     MAKTSMVAXXXXXXXXXVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_SPICI     MAKKSLKVKQQCHPKFKVRGYTRCGNCGRPHAVLHKFDLCRLCFRNLASKGQIPGVRKASW
RS14Z_MYCMO     MAKTSLKVKATRHPKYSARAYTRCQICGRPQAVLRKYKICRICFRKLAHEGKIPGMKKASW
RS14Z_MYCPN     MAKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKKASW
RS14Z_MYCAP     MAKSSLKAKQKKHAKFSTRAYTRCELCGRVHAVLRKYKICRICFRELAHQGKIPGMKKASW
RS14Z_ANASK     MAKLSKMAQATRKLKFPVRQYNRCPLCGRPRAFLRKFQMCRICFRKRALQGEITGVIKSSW
RS14Z_ANADE     MAKLSKMAQATRKLKFPVRQYNRCPLCGRPRAFLRKFQMCRICFRKRALQGEITGVIKSSW
RS14Z_ANAD2     MAKLSKMAQATRKLKFPVRQYNRCPLCGRPRAFLRKFQMCRICFRKRALQGEITGVIKSSW
RS14Z_MYCGE     MAKKSLKVKQSRPNKFSVRDYTRCLRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKKASW
RS14Z_MYCCT     MAKKSLKVKQAKHQKFNVRNYTRCNHCGRPHAVLKKFGICRLCFRKFAYEGQIPGIKKASW
RS14Z_SPIKU     MAKKSLKVKQQCHPKFKVRGYTRCNNCGRPHAVLRKFDLCRLCFRNLASKGQIPGVRKASW
RS14Z_GLOVI     -----MVEREKKRQKLDTRLHNRCWRCGRPRGYIRDFGLCRICFREMAHQGLLPGVVKASW
RS14Z_MESFL     MAKKSLKVKQAKHQKFGVRNYTRCNNCGRPHAVLKKFGICRLCFRKYAYEGQIPGIRKASW
RS14Z_SACEN     ---------------FKVRGYTRCQRCGRPRSVFRKFGLCRVCFREMAHAGELPGVSKSSW
RS14Z_MYCVP     ---------------FKVRGYTRCNRCGRPHAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCGI     ---------------FKVRGYTRCNRCGRPHAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCA9     ---------------FAVRAYTRCNRCGRPHAVFRKFGLCRICLREMAHAGELPGIHKSSW
RS14Z_MYCSS     ---------------FKVRGYTRCQRCGRPHAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCSK     ---------------FKVRGYTRCQRCGRPHAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_MYCSJ     ---------------FKVRGYTRCQRCGRPHAVFRKFGLCRICLREMAHAGELPGVQKSSW
RS14Z_LEPIN     MAKTSITVRHQRKKKFEVREYNRCPICGRSRGYLRRFDMCRICFRKLASGAQIPGVVKSSW
RS14Z_LEPIC     MAKTSITVRHQRKKKFEVREYNRCPICGRSRGYLRRFDMCRICFRKLASGAQIPGVVKSSW
RS14Z_LEPBJ     MAKTSITVRHQRKKKFEVREYNRCPICGRSRGYLRRFDMCRICFRKLASGAQIPGVVKSSW
RS14Z_HYDS0     MPRKAKVVKLKHFPKYATRQKNRCPICGRPRGFLRRFNMCRLCFREMALSGEITGVRKSSW
RS14Z_DESPS     ---------------FAVREYNRCPLCGRPRAFIRKFGICRICFRKLASSGEVTGVTKSSW
RS14Z_RHOE4     ---------------FAVRAYTRCQRCGRPHSVFRKFGLCRICVREMAHAGELPGVRKSSW
RS14Z_MYCHJ     MAKTSWKVKANRAPKFKVRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKKASW
RS14Z_MYCH7     MAKTSWKVKANRAPKFKVRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKKASW
RS14Z_MYCH2     MAKTSWKVKANRAPKFKVRAYTRCQLCGRSHSVLRKFRICRICFRVLAHQGRIPGIKKASW
RS14Z_STACT     ---------------FPVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
RS14Z_RHOSR     ---------------FAVRAYTRCQRCGRPHSVFRKFGLCRICVREMAHAGELPGVHKSSW
RS14Z_RHOOB     ---------------FAVRAYTRCQRCGRPHSVFRKFGLCRICVREMAHAGELPGVHKSSW
RS14_NOVAD      -----------------TRVRNRCNTTGRPRGYYRKFGLCRIELRDLANKGLIPGVTKSSW
RS14Z_BIFAA     ------------------RAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW
RS14Z_AQUPY     MPRKAKVAKLMYYPKWKSRKKNRCPICGRPRAFIRYFNMCRICFREHALRGDLPGVRKASW
RS14Z_AQUAE     MPRKAKVAKLMYYPKWKSRKKNRCPICGRPRAFIRYFNMCRICFREHALRGDLPGVRKASW
RS14_SPHWW      -----------------TRVRNRCEVTGRPRAYYRKFRLCRVQLRDLANKGLIPGVTKSSW
RS14_ZYMMO      -----------------TRVRNRCALTGRPRGYYRKFQLCRIQLRDLANKGLIPGVTKSSW
RS14_STRR6      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRPS      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRPN      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRPI      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRP4      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRP2      MAKKSMVAREAKRQKIPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14Z_SALRD     ------------------RQNNRCELCGRQRGYLRKFGVCRICFRELALEGKIPGIRKASW
RS14_SPHAL      -----------------TRIRNRCELTGRPRAYYRKFRLCRVQLRDLANKGLIPGVVKSSW
RS14Z_DESAD     -------------------EYNRCPICGRPRAFLRKYGICRICFREKALAGELPGVRKASW
RS14_JANMA      -----------------TRQRNRCTLTGRPRGTFRKFGLGRIKLREIAMRGEIPGMTKASW
RS14_SYNJA      -------AQLQKLPRASTRLRNRCWKTGRPRGYFRDFGLCRNSLREMAHRGLLPGVVKASW
RS14_CHLPN      --------KMKRDTS-PTRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGEIPGVIKASW
RS14_WOLPM      -AQNKLIKKLPRNSS-KTKIRNRCALTGRPRGVYRKFGLCRIVLRDLCSFGQIPGVTKSSW
RS14_BORPD      -----------------TRQRNRCVVTGRPRGVFRKFGLTRHKLREMAMKGEIPGITKASW
RS14_WOLPP      -AQSKLIKKLPRDSS-KIRIRNRCALTGRPRGVYRKFGLCRIVLRDLCSFGQVPGVTKSSW
RS14_SYNJB      -------AQLQKLPRASTRLRNRCWKTGRPRGYFRDFGLCRNSLREMAHRGLLPGVVKSSW
RS14_RALSO      -----------------TRQRNRCSITGRPRGTFRKFGLARNKLREIAFKGEIPGLTKASW
RS14_RALPJ      -----------------TRQRNRCSITGRPRGTFRKFGLARNKLREIAFKGEIPGLTKASW
RS14_LISMF      MAKKSKVAKHERQPRDSSRLHNRCELTGRPHGYMRKFGISRIRFRELAHQGQLPGVTKASW
RS14_ERYLH      -----------------TRVRNRCATTGRPRGYYRKFGINRIELRDLGNKGLIPGLTKSSW
RS14_DEIRA      -----------------TRLHNRCEFTGRPRGYVRFFGVSRIVLREMAHRGELPGVKKASW
RS14_CHLCV      ------------------RLHNRCLLTGRPRGYLRKFAISRICFREMASMGEIPGVIKASW
RS14_AZOSB      -----------------TRGRNRCSLTGRPRGVFRKFGLCRNKLREIAFRGEVPGMTKASW
RS14Z_CLOK5     MARKALIEXXXXXXXXXXXXXXRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14Z_CLOK1     MARKALIEXXXXXXXXXXXXXXRCRICGRPHAVLKKYGICRICFRELAYKGEIPGCKKASW
RS14_METPB      ----------------ATRIRNRCEMTGRPRAYYRKLGISRVALRELGNRGLIPGLVKSSW
RS14_METEP      ----------------ATRIRNRCEMTGRPRAYYRKLGISRVALRELGNRGLIPGLVKSSW
RS14_BORPE      -----------------TRQRNRCVVTGRPRGVFRKFGLTRHKLREMAMKGEVPGMTKASW
RS14_BORPA      -----------------TRQRNRCVVTGRPRGVFRKFGLTRHKLREMAMKGEVPGMTKASW
RS14_BORBR      -----------------TRQRNRCVVTGRPRGVFRKFGLTRHKLREMAMKGEVPGMTKASW
RS14_BACA2      ------------------RLHNRCTVTGRPRGYMRKFKLSRIAFRELAHKGRIPGVKKASW
RS14_AZOSE      --EERMVARLKLQPRNASRERNRCALTGRPRGVFRKFGLCRNKLRDLAFRGEVPGMTKASW
RS14_ORITI      ----NLVLKLSKLPRSSTRIRNRCAETGRPRGYYRKFKLCRNIIRELAGSGIIPGLRKSSW
RS14_ORITB      ----NLVLKLSKLPRSSTRIRNRCAETGRPRGYYRKFKLCRNIIRELAGSGIIPGLRKSSW
RS14_METRJ      ----------------ATRIRNRCGMTGRPRAYYRKMGISRVALRELGNRGLIPGLVKSSW
RS14_HERAR      -----------------TRQRNRCALTGRPRGTFRKFGLGRIKLRECAMRGEIPGMTKASW
RS14_CHLFF      ------------------RLHNRCLLTGRPRGYLRKFAISRICFRQMASMGEIPGVVKASW
RS14_CHLAB      ------------------RLHNRCLLTGRPRGYLRKFAISRICFRQMASMGEIPGVVKASW
RS14_SYNPX      -----------------SRIRNRCWATGKPRGYYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_SACEN      ----------RRQPRSATRLRNRDAVDGRPRGYFRKFGLSRVRLRQLAHSGELPGVTKSSW
RS14_RHOCS      ------------------RIRNRCELTGRPRAYYRKFRLSRVTLRELASTGQIPGMTKSSW
RS14_RALME      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFKGEIPGLTKASW
RS14_RALEJ      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFKGEIPGLTKASW
RS14_RALEH      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFKGEIPGLTKASW
RS14_LISIN      -----------------TRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQLPGVKKASW
RS14_CUPTR      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFKGEIPGLTKASW
RS14_CHLMU      --------KMKRDTSPS-RLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVIKASW
RS14B_BACSU     ------------------RLHNRCMVTGRPRAYMRKFKMSRIAFRELAHKGQIPGVKKASW
RS14_THEEB      ----SIHRQLQRLPRNSSRLRNRCWLTGRPRGYYRDFGLCRNALREMAHQGLLPGVVKSSW
RS14_SYNPW      -----------------TRMRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_NEOSM      -------AKLNSLPRNSSRSKNRCSITGRPRGYYRKFGISRIQLRVLANWGKLPGVVKSSW
RS14_LISW6      ----------RKLPRDSTRLHNRCALTGRPHGYMRKFGMSRIRFRELAHQGQLPGVKKASW
RS14_CHLTR      -----------------SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVVKASW
RS14_CHLTB      -----------------SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVVKASW
RS14_CHLTA      -----------------SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVVKASW
RS14_CHLT2      -----------------SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVVKASW
RS14_BUCCC      -----------------SRQRNRCRQTGRPHAFLRKFGLSRMKLREAAMRGEIPGLTKASW
RR14_CHLAT      --KLNLHRKLQRLPRSSTRLHNRCAISGRPKAYYRDFGLSRHVFREMAHNCLLPGVTKSSW
RS14_SYNS9      MSRLEIHRKIQALPRNSTRIRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_SYNP2      -----------------TRMRNRCQITGRPRSYYRDFGLCRNVLRDWAHQGLLPGVVKSSW
RS14_LISMO      MAKKSKVAKHERQPRDSSRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQLPGVKKASW
RS14_CYTH3      ------------------RLHNRCKLTGRPRGYMRKFGINRVTFRELAANGKIPGVTRASW
RS14_BURVG      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURS3      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURM1      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURCM      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURCJ      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURCH      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURCC      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURCA      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURA4      -----------------TRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_PROM3      -----------------TRIRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_FLAPJ      ------------------RMHNRCKLTGRPRGYMRQFGISRVTFREMANNGLIPGVKKASW
RS14_BUCAI      ------VLKLQSFPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMKGEIPGLKKASW
RS14_ALCBS      ------------------RQRNRCRLTGRPHGYYRKFGLSRIKLREAAMRGDVPGLVKASW
RS14_WOLTR      -AQNKLIKELPRDSS-KIRIRNRCALTGRPRGVYRKFGLCRIVLRGLCSFGKIPGITKSSW
RS14_SYNP6      ------------------RVRNRCWVTGRPRGYYRDFGLCRNVLREMAHQGLLPGVVKSSW
RS14_RHOS5      ----------------ATRIHNRCQLTGRPHAYYRKLKLSRIMLRELASFGQIPGMVKSSW
RS14_RHOS4      ----------------ATRIHNRCQLTGRPHAYYRKLKLSRIMLRELASFGQIPGMVKSSW
RS14_RHOS1      ----------------ATRIHNRCQLTGRPHAYYRKLKLSRIMLRELASFGQIPGMVKSSW
RS14_PROM4      -----------------SRMRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_POLSQ      ------------------RQRNRCSLTGRPRGTFRKFGLARSKIREIAFRGEIPGLTKASW
RS14_POLNS      ------------------RQRNRCSLTGRPRGTFRKFGLARSKIREIAFRGEIPGLTKASW
RS14_METS4      -----------------TRIRNRCAMTGRPRAYYRKLGISRVALRDLGSRGMIPGLVKSSW
RS14_LACCB      MAKKSKIAKAKRQEKLPVRLHHRDVLDGRPHAYMRKFGMSRLNFRELAHKGQIPGVRKASW
RS14_LACC3      MAKKSKIAKAKRQEKLPVRLHHRDVLDGRPHAYMRKFGMSRLNFRELAHKGQIPGVRKASW
RS14_GRAFK      -------------PKNSSRLHNRCKLTGRPKGYMRQFGLSRVMFREMANQGLIPGVKKASW
RS14_FLAJ1      ----------QRLPKNASRLHNRCKLTGRPRGYIRQFGISRVTFREMANNGLIPGVKKASW
RS14_BUCAP      -----------------SRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMKGEIPGLKKASW
RR14_CHLVU      --KFNLHRKLQQLPRNSARSHNRCTITGRPRGYFRDFGLSRHVLREYALQGFLPGVVKASW
RS14_POLSJ      -----------------TRQRNRCAITGRPRGTFRQFGLARAKIRELAFAGDIPGITKASW
RS14_POLNA      -----------------TRQRNRCAITGRPRGTFRQFGLARAKIRELAFAGDIPGITKASW
RS14_ALTMD      ----------------SSRQRNRCRVTGRPHGYLRKFGLSRIKLREAAMRGEVPGLKKASW
RS14_ACIAC      -----------------TRQRNRCEITGRPRGTFRQFGLARAKIRELAFAGDIPGVTKASW
RR14_MESVI      -----------------TRLHNRCSVTGRPKGYYRDFGLSRHVLREMAHECLLPGVTKSSW
RS14_VIBVY      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VIBVU      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VIBPA      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VIBHB      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VIBFM      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VIBF1      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_SODGM      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLRKASW
RS14_SILST      ----------------ATRLHNRCQLTGRPHAYYRKLKVSRIALRELGSNGQIPGMVKSSW
RS14_SALTY      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALTI      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALSV      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALPK      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALPB      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALPA      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALNS      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALHS      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALDC      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALCH      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALA4      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_PSEA6      ------VLKLQQLPRDSTRQQNRCRITGRPHGFLRKFGLSRIKLREAAMRGEVPGLKKASW
RS14_PHOLL      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ERWCT      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ENTS8      ------VLKLQTLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ENT38      ------VLKLQSLPRDSSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_BURXL      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURTA      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURPS      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURPP      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURP8      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURP6      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURP1      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURP0      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURMS      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURMA      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURM9      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_BURM7      -----------------TRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW
RS14_ALISL      ----------------ASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_VEREI      -----------------TRQRNRCAITGRPRGTFRQFGLARAKIREMAFAGDIPGITKASW
RS14_SYNSC      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_SYNS3      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_SYNR3      MERLEIHRKIQQLPRNSTRMRNRCWATGKPRGVYRDFGLCRNQLRERAHKGLLPGVVKSSW
RS14_SINMW      -----------------TRIRNRCEVTGRPRAYYRKLRMSRIALRELGNLGKVPGVVKSSW
RS14_SHEWM      ----------------AARQRNRCSQTGRPHGYLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHESH      ----------------AARQRNRCSQTGRPHGYLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_RHIME      -----------------TRIRNRCEVTGRPRAYYRKLRMSRIALRELGNLGKVPGVVKSSW
RS14_PARDP      ----------------ATRLHNRCQLTGRPHAYYRKLKLSRIMLRELGSFGQIPGMVKSSW
RS14_METCA      ----------------ATRQRNRCQLTGRPHGFYRKFGLGRNKLRECVMRGEVPGVVKASW
RS14_HALHL      ------------------RQRNRCAKSGRPRGYYRKFGLARNELRRAAMNGEIPGLTLSSW
RS14_CELJU      -----------------SRQRNRCRVTGRPHGVYRKFGLCRHKLREAAMRGDVPGLVKASW
RS14_BUCBP      ------VLKLQTFPRDSSRQRNRCSQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKSSW
RR14_SCEOB      --KLALHRKLQQLPRNSSRLHNRCLVTGRPKGYFRDFGLSRHVLREMAHEGLLPGVRKASW
RR14_PSINU      --KKSQILPRNSAP---TRLHRRCSLTGRSRSNYRDFGLCRHVLREMAHTCSLPGVTKSSW
RR14_CHLRE      --KLSLHRKLQQLPRNSSRLHNRCMITGRPKGYFRDFGLSRHVLREMAHQGLLPGVCKSSW
RS14_SILPO      ----------------ATRLHNRCQLTGRPHAYYRKLKVSRIMLRELGSAGQIPGMVKSSW
RS14_SHEPW      ----------------SARQRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_RUTMC      -----------------TRQRNRCALTGRPHGFYRKFGLARTKLRERTMNGEAPGLSKASW
RS14_RHILW      -----------------TRIRNRCEVSGRPRAYYRKLRMSRIALRELGNLGKVPGIVKSSW
RS14_RHIL3      -----------------TRIRNRCEVSGRPRAYYRKLRMSRIALRELGNLGKVPGIVKSSW
RS14_RHIEC      -----------------TRIRNRCEVSGRPRAYYRKLRMSRIALRELGNLGKVPGIVKSSW
RS14_RHIE6      -----------------TRIRNRCEVSGRPRAYYRKLRMSRIALRELGNLGKVPGIVKSSW
RS14_PROMM      ------------------RIRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
RS14_GRABC      ----------------ANRVRLRCELTGRPRANYRKFKLCRVALRDLASSGQIPGLVKASW
RS14_DELAS      -----------------TRQRNRCEITGRPRGTFRQFGLGRAKIRELAFAGDIPGVTKASW
RS14_ACISJ      -----------------TRQRNRCEITGRPRGTFRQFGLGRAKIRELAFAGDIPGVTKASW
RR14_PSEAK      --KLSLYAKLQKLPRNSSRLHNRCLISGRPKGYYRDFGLSRHVLREFGHNCLLPGLTKSSW
RS14_YERPY      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPS      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPP      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPN      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPG      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPE      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPB      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERPA      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERP3      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_YERE8      ------VLKLQSLPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_SHEAM      -ARWDAVLKLQALPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SACD2      -----------------SRQQRRCRITGRPHAVYRKFGLCRNKLREAAMRGDVPGLVKASW
RS14_JANSC      ----------------ATRLNNRCQLTGRPRAYYRKLKMSRIKLRDLASNGQIPGMVKSSW
RS14_DINSH      ----------------ATRLHNRCQLTGRPHAYYRKLKISRIALRDLGSAGQIPGLVKSSW
RS14_BACLD      ------------------RLHNRCEVTGRPRGYMRKFKMSRIAFRELAYKGQIPGVKKSSW
RS14_ACHLI      ------------------RLRNRDSLDGRPRAYMRKFGVSRITFRELAHKGEIPGVKKASW
RR14_OSTTA      ------------------RLKNRCAKTGRPKGYYRDFGLSRHVLREMAHQGLLPGVRKASW
RS14_WIGBR      ------VLKLQSLPRDSSRQRNRCSQTSRPHAFLRKFGLSRIKLREAAMRGEIPGLRKSSW
RS14_SHISS      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIFL      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIF8      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIDS      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIBS      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIB3      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHEPA      ------VLKLQALPRDSSRQRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEHH      ------VLKLQALPRDSSRQRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_RHORT      -----------------TRVHNRCELTGRPHSVYRKFKLGRIMLRDLASQGQIPGMVKSSW
RS14_PROMH      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLRKASW
RS14_NEIMF      ------------------RQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_NEIMB      ------------------RQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_NEIMA      ------------------RQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_NEIM0      ------------------RQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_NEIG1      ------------------RQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_METFK      ------------------RQRNRCALTGRPRGVFSKFGIARSKLRELMMRGEVPGVTKASW
RS14_KLEP3      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_IDILO      -----------------TRQRNRCRITGRPHGFLRKFGMSRIKVREMAMRGEIPGLKKASW
RS14_EXIS2      ----------------AVRLHNRCSITGRPHGYIGKFGISRIKFRDLAHKGQIPGVKKASW
RS14_ESCF3      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOUT      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOSM      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOSE      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOLU      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOLI      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOLC      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOL6      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOL5      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOK1      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOHS      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECODH      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO8A      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO7I      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO5E      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO57      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO45      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO24      ------VLKLQTLPRDSSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_AGRT5      -----------------TRIRNRCEVTGRPRAFYRKLKMSRIALRELGNSGKVPGIVKSSW
RR14_THAPS      --KLEIHSKIQRLPRNSSRIRNRCWKTGRPRGYYRDFGVSRHVLREMAHQCLLPGVTKSSW
RR14_OEDCA      ----------------SVRLHNRCLVTGRSRGYYRDFGLSRHVLREMAHQGFLPGVIKSSW
RR14_ASTLO      --------KLQKFPRDSSRLHNRCYLTGRPRGYYRFFGLSRHIFRDMAHYGLLPGVTKSSW
RS14_SHESR      ----------------ASRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHESM      ----------------ASRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHESA      ----------------ASRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEON      ----------------ASRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHELP      ----------------AARQRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEFN      ------VLKLQALPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEB9      ------VLKLQALPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEB8      ------VLKLQALPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEB5      ------VLKLQALPRDSSRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SALAR      ------VLKLQSLPRDSSRQRNRCRQTGRPHGYVGKFGLSRIKLREAAMRGEVPGLKKASW
RS14_PARL1      -----------------TRIHNRCEITGRSKAYYRKLRMSRIALRDLASRGQIPGMVKSSW
RS14_MARMS      ----------------SSRQRNRCQITGRPHGVYRRFGLSRIKLREAAMRGDVPGLKKASW
RS14_LACRJ      ----------------AVRLHNRDRYDGRPHAYMRKFGMSRIKFRELAHKGQIPGVRKASW
RS14_LACRD      ----------------AVRLHNRDRYDGRPHAYMRKFGMSRIKFRELAHKGQIPGVRKASW
RS14_CITK8      ------VLKLQTLPRDSSRQRNRCRQTGRPHGYVGKFGLSRIKLREAAMRGEVPGLKKASW
RS14_CHRVO      ------------------RQRRRCAVTGRPRGVFRKFGLGRNKLREIAMKGEIPGVVKASW
RS14_VESOH      -----------------TRQRSRCSLTGRPHGFYRKFGLARNKLRECTMNGEVPGLSKASW
RS14_OPITP      --------KLQKLPKNSNRIRNRCSLSGRPRAYIGKFGVSRIQFRELALAGKIPGVTKSSW
RS14_MICAN      -----------------SRHRNRCLTTGRPRGYYRDFGLSRNVLREWAHQGLLPGVVKSSW
RS14_MANSM      ------VLKLQTLPRDSSRQRNRCSQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_BLOFL      ------VLKLQTLPRDSSRLRNRCGRTGRPHAFLRKFGLSRMKVREAAMKGEIPGLRKSSW
RS14_BACTN      --------KLQELPKNSNRMHNRCKLTGRPKGYIRQFGISRIQFREMASNGLIPGVKKASW
RS14_AERS4      -ARWDAVLQLQQLPRDSSRQRNRCNITGRPHGFLRKFGLSRIKVREHAMKGEIPGLKKASW
RS14_AERHH      -ARWDAVLQLQQLPRDSSRQRNRCNITGRPHGFLRKFGLSRIKVREHAMKGEIPGLKKASW
RS14_ACAM1      -----------------TRLRNRCWVTGRSRGYYRDFGLSRHVLREMAHEGLLPGVTKSSW
RS14_STAS1      -----------------TRLTRRCKVTGRPRGVYRKFGMSRIALRDYAHKGQIPGVKKSSW
RS14_ROSDO      ----------------AVRLHNRCQLTGRPHAYYRKLKISRIALRDLGSSGQIPGMVKSSW
RS14_PARD8      ------------------RLHNRCKITGRPKGYVRQFGISRIQLREMASNGLIPGVKKASW
RS14_COREF      -----------RQPRDAARVRNRDAHDGRPRGYLRKFGLSRVRMREMAHRGELPGVRKSSW
RS14_CORDI      -----------RQPRDASRVRNRDSRDGRPRGFLRKFGVSRVRMREMAHRGELPGVRKSSW
RS14_COLP3      ----------------SSRQRNRCNITGRPHGFLRKFGLSRIKLRETMMRGEVPGLKKASW
RS14_BACFR      --------KLQELPKNSNRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASW
RS14_BACFN      --------KLQELPKNSNRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASW
RS14_ALHEH      --------KLQKLPRDSSRGRNRCRVTGRPRGYYRKFGLGRNKLREAAMNGEIPGLVKSSW
RS14_SHEDO      ------VLKLQALPRDSSRKRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_PORGI      ------------------RLHNRCSMTGRPKGYMRQFGISRIQFREMASAGLIPGVKKASW
RS14_PORG3      ------------------RLHNRCSMTGRPKGYMRQFGISRIQFREMASAGLIPGVKKASW
RS14_PASMU      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_LEUCK      MAKKSKIAKAKREPKDSSRMHNRDLIDGRPHAYMREFGMSRLNFRQLAHKGQIPGVRKASW
RS14_HAES2      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAES1      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAEIN      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAEIG      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAEIE      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAEI8      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_DICNV      -----------------SRVQRRCRITGRPHAVYRKFGLSRIKLRELTMRGEVPGVRKASW
RS14_CORU7      -----------RQPRDASRVRNRDAADGRPRGYLRKFGLSRVRVREMAHRGELPGVRKSSW
RS14_CAUCR      ------------------RIRNRCEVTGRPRAYYRKLKMSRVALRELGSQGQIPGLVKSSW
RS14_BACP2      -----------------TRLKNRCELTGRPRGYLRKFKMSRIAFRELAYKGHIPGVKKSSW
RS14_ANAPZ      --------KLSKMPRDSSRIRNRCLITGRPRGYYRKFKMSRIVLRQLGSIGQIPGLTKSSW
RS14_ACTPJ      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ACTP7      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ACTP2      ------VLKLQTLPRDSSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RR14_LEPTE      --KVNLNRKLQQLPRFPVRLHNRCLITGRPKGYLRDFGLSRHVLREMAHECLLPGVTKSSW
RS14_THIDA      ------------------RQRNRCQLTGRPRGVFSKFGLARGKLREYAMRGEIPGIVKASW
RS14_THICR      ------------------RQQNRCRLTGRPHGVYRKFGLSRNMLRQLAMQGDVPGLRKASW
RS14_SYNY3      -----------------------CQVTGRPRSYYRDFGLCRNVLREWAHQGLLPGVTKSSW
RS14_SHESW      ----------------ASRKRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_SHEPC      ----------------ASRKRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
RS14_RHOFD      -----------------TRQRNRCAITGRPRGTFQHFGLARAKIREMAFAGEIPGIVKASW
RS14_RHILO      ------------------RIRNRCEVTGRPRAYYRKLKVSRIALRDLGNNGQIPGLVKSSW
RS14_PSEHT      ------VLKLQALPRDSSRQRNRCNITGRPHGFLRKFGMSRIKVREAAMRGEIPGLKKASW
RS14_PROMS      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRQRAHNGELPGVVKSSW
RS14_PROMP      -----------------TRVRNRCWATGKPRGVYRDFGLCRNQLRLRAHNGELPGVVKSSW
RS14_PROMA      -----------------SRMRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSS-
RS14_PROM9      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRQRAHNGELPGVVKSSW
RS14_PROM2      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRQRAHNGELPGVVKSSW
RS14_NITEC      ------------------RLRQRCILTGRPRGVYKKFGLGRIKLREIAMRGEIPGVIKASW
RS14_MYCS2      --RAAAVSALQRLPRDSSRLRNRDVVDGRPRGHLRKFGLSRVRVREMAHRGELPGVRKASW
RS14_CYAP7      -----------------SRHRNRCWVTGRPRGYYRDFGLSRNVLREWAHQGLLPGVVKSSW
RS14_CAUSK      ----------------AVRIRNRCEVTGRPRAYYRKLKMSRIALRELGSSGQIPGLVKSSW
RS14_ACTSZ      -----------------SRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14Z_LEGPL     ------------------RYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW
RS14Z_LEGPH     ------------------RYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW
RS14Z_LEGPA     ------------------RYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW
RR14_NEPOL      ------------------RLHNRCTITGRPKGYYRDFGLSRHELRAMAHGCLLPGVTKASW
RS14_STREM      ------------------RLKNRDRIDGRPHAYMRKFGVSRINFRELAHKGQLPGITKASW
RS14_CHLP8      ----------------ATRVRNRCVLTGRGRGNYEKFGLCRNMFRKLALEGKLPGVRKASW
RS14_BARBK      ------------------RVRNRCEVTGRPRAYYRKLQMSRIALRELGSLGHIPGVVKSSW
RS14_BACV8      ------------------RLHNRCKLTGRPKGYIRQFGISRIQFREMASNGLIPGVKKASW
RS14_SERP5      ------VLKLQTLPRDSSRQRKRCRQTGRPHGYVGKFGLSRIKLREAAMRGEVPGLKKASW
RS14_PROA2      ----------------ATRVRNRCVLTGRGRGVYEKFGLCRHMFRKLALEGKIPGVKKASW
RS14_PELLD      ----------------ATRVRNRCVLTGRGRGVYEKFGLCRHMFRKLALEGKIPGVKKASW
RS14_METPP      ---------------YPSRLRNRCELTGRPRGTFRTFGLARNKIRELAFKGDIPGVVKASW
RS14_LEUMM      MAKKSKIAKAKREPKDSSRVHNRDWIDGRPHAYMREFGMSRLNFRQLAHKGQIPGVRKASW
RS14_ERWT9      ------VLKLQSLPRDSSRQRKRCRQTGRPHGYVGKFGLSRIKLREAAMRGEVPGLKKASW
RS14_CHLTE      ----------------ATRLRTRCVLTGRGRGNYRKFGLCRNMFRKLALEGKLPGVRKASW
RR14_RHDSA      -----LYAKLEKLPRFPSRLRNRCWLTGRTRGYYRQFGLSRHVLREMAHQCLLPGVVKSSW
RR14_PHYPA      -----------------TRLHRRCFLTGRPRANYRDFGLSRHVLREMAHACFLPGVTKSSW
RS14_TRIEI      -----------------SRVRNRCWLTGRPRGFYRDFGLSRNVIREMAHEGLLPGVVKSSW
RS14_STRPM      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPG      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPF      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPD      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPC      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPB      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP8      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP6      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP3      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP1      ------------------RLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_PSEAE      ----------------ASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_PSEAB      ----------------ASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_PSEA8      ----------------ASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_PSEA7      ----------------ASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_PROVI      MAKKSVVARAKREPRDSSRVRNRCVLTGRGRGVYEKFGLCRHMFRKLALEGKLPGVKKASW
RS14_PROMT      ------------------RIRNRCWATGKPRGVYRDFGLCRNQLRSRAHNGELPGVVKSSW
RS14_PROM1      ------------------RIRNRCWATGKPRGVYRDFGLCRNQLRSRAHNGELPGVVKSSW
RS14_PROM0      ------------------RVRNRCWATGKPRGVYRDFGLCRNQLRQRAHNGELPGLVKSSW
RS14_MARMM      -----------------TRIRNRCEITGRPRAFYRKFRMSRIAMRDYASQGMIPGMVKSSW
RS14_KINRD      -----------------TRVRNRDAADGRPRGTLRKFGLSRIRVREMAHAGELPGVTKSSW
RS14_GLUOX      ----------------ATRVRLRCKLSGRPRANYRKFELSRIALRDLASAGQIPGMVKSSW
RS14_BUCAK      ------VLKLQTLPRDSSRQRNPCRQTGRPHGYVGKFGLSRIKLREAAMRGEVPGLKKASW
RS14_BARHE      ------------------RVRNRCEVSGRPRAYYRKLKMSRIALRELGSVGHIPGIIKSSW
RR14_ZYGCR      --KWSIQRQLQRLPRNSTRVHRRCFVTGRPRAVYRDFGLSRHVIREMAHACLLPGVIKASW
RS14_XANP2      ------------------RIRNRCEVTGRPRAFYRKLKMSRIALRELGNQGMVPGLVKSSW
RS14_MYCVP      -ARVAAQSELNRQPRDASRVRNRDSVDGRPRGHLRKFGLSRVRVRELAHQGQLPGVRKSSW
RS14_MESSB      -----------------TRIRNRCEVTGRPRAFYRKLKMSRIALRELGSQGLIPGLVKSSW
RS14_FRATW      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATT      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATO      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATN      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATM      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATH      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATF      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRAT1      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRAP2      ----------------ASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_CORJK      -----------RQPRDASRVRNRDAADGRPRGYLRKFGLSRVRVRNMAHRGELPGVRKSSW
RS14_CHLPD      ----------------ATRVRSRCTLTGRGRSVYAKFGLCRHMFRKFALEGKLPGVKKASW
RS14_CHLL2      ----------------ATRVKNRCVLTGRGRGVYEKFGLCRQMFRKFALEGKLPGVKKASW
RR14_CHAGL      -----------------TRIHRRCFVTGRPRAVYRDFGLSRHVIREMAHSCLLPGVTKSSW
RS14_PEDPA      -----------------TRMHRRDSLDGRPHAYMRKFGMSRLNFRRLAHEGQIPGVRKASW
RS14_LEPCP      ---------------YPTRLRARCGITGRPRGTFRKFGLGRTKIRELAFRGDIPGVVKASW
RS14_GLUDA      ----------------------RCKLTGRARANYRKFELCRVALRDLASSGQIPGMVKSSW
RS14_CHLCH      ----------------ATRVRNRCVLTGRGRGVYAKFGLCRHMFRKLSLEGKLPGIRKASW
RS14_BARQU      ------------------RVRNRCEVSGRPRAYYRKLKMSRIALRELGSVGYIPGIIKSSW
RS14_ACICJ      -----------------TRVRLRCELTGRARGNYRKFKLCRVALRDLASAGQIPGMVKSSW
RR14_PINKO      --------KLQSSPRNSTRLHRRCSSTGRPRANYRDFGLSGHILREMAHACLLPGITKSSW
RR14_ODOSI      -------SKIQKLPRNSAKNRNRCWKTGRPRGFYRDFGVSRHVLREMAHSCLLPGVTKSSW
RR14_MARPO      -----------------TRLHRRCFLTGRPKANYRDFGLSRHLLREMAHACLLPGVTKSSW
RR14_ANGEV      -----------------TRLHRRCFLTGRPRSNYRDFGLSRHVLREMAHTCLLPGVTKSSW
RS14_RICPR      ----------------STRIRNRCELTGRPRGVIRKFGISRNKLRELIGRGLVPGVVKASW
RS14_PHEZH      ----------------AVRIRNRCEVTGRPRAYYRKLKMSRVSLRELGSHGLIPGLVKSSW
RS14_MYCGI      -ARAAAQSELNRQPRDASRVRNRDAVDGRPRGHLRKFGLSRMRVRELAHRGQLPGVRKSSW
RS14_DECAR      -----------------------CQLTGRPRGVFRKFGLCRHKIRELAFNGEVPGVVKASW
RS14_AKKM8      -----------------TRTVNRCLVSGRRRAFIRRFKLSRISFRELANAGMIPGVTKSSW
RR14_PHATR      --KLELHSKIQKLPRNSTRIRNRCWKTGRPRGVFRDFGLSRHVFREMAHQCLLPGVTKSSW
RS14_STRGG      ------VEELRRQPRSATRVRNRDSVDGRPRGYLRRFGLSRVRMREQAHAGFLPGVTTSSW
RS14_RICTY      ----------------STRIRNRCELTGRPRGVTRKFGISRNKLRELIGRGLVPGVVKASW
RS14_RHOSR      ------------------RLRNRDAADGRPRGHLRKFGLSRVRVREMAHRGELPGVHKSSW
RS14_PSYCK      ------------------RLRNRCAITGRPHGYFRKFGLSRNMLRERVMQGDVPGVRKASW
RS14_PSYA2      ------------------RLRNRCAITGRPHGYFRKFGLSRNMLRERVMQGDVPGVRKASW
RS14_PSEU5      ----------------ASRLRNRCRLTGRPHGVYRKFGLARNMLRQAAMRGDVPGLVKASW
RS14_PSEF5      ----------------ASRMRNRCRLTGRPHGVYRKFGLGRNKLREAAMRGDVPGLVKASW
RS14_NOCFA      ------------------RLRNRDAADGRPRGHLRKFGLSRVRVREMAHRGELPGVHKSSW
RS14_MYCUA      -----------RQPRDASRLRNRDAIDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKASW
RS14_MYCMM      -----------RQPRDASRLRNRDAIDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKASW
RS14_MYCA9      -------SELNRQPRDASRLRNRDAVDGRPRGYLRKFGLSRVRVRELVHDGSLPGVRKASW
RS14_LACSS      -------------PKDSSRLRNRDLIDGRPRSFMRKFGMSRINFRELAHKGQIPGVKKASW
RS14_CORGL      ---------------------------GRPRGYLRKFGLSRVRMREMAHRGELPGVRKSSW
RS14_CORGB      ---------------------------GRPRGYLRKFGLSRVRMREMAHRGELPGVRKSSW
RS14_BRUSU      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUSI      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUO2      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUME      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUC2      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUAB      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUA2      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUA1      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_STRMK      ------LAKLPRDSSPS-RQRNRCELSGRPRGVYSKFGLGRNKLREATMRGDVPGLRKASW
RS14_PSEMY      ----------------ASRLRNRCRITGRPHGVYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_PSEE4      ------VVALQKQPRSASRLRNRCRLTGRPHGVYRKFGLGRNKLREAAMRGDVPGLVKASW
RS14_PELPB      ----------------ATRVRNRCVLTGRGRGVYAKYGLCRHMFRKFALEGKLPGVKKASW
RS14_OENOB      ------LAKLPRDAS-PVRAHHRDLTDGRPHAYMRAFGLSRLNFRQLAHKGQIPGVRKASW
RS14_OCHA4      ------------------RIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGIVKSSW
RS14_MYCPA      ----------------AVRVRNRDAVDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKASW
RS14_LACBA      -----------------TRIHRRDHLDGRPHAYMRKFGLSRLNFRQLAHEGKIPGVQKASW
RS14_HYPNA      ------------------RVRNRCEITGRPRAFYRKLKMSRIALREYGSRGQVPGLVKSSW
RS14_FUSNN      ----------------AVRKRNRCQLDGRPRGYMREFGISRVKFRQLAGAGVIPGVKKSSW
RS14_CHLT3      -----------------TRLKNRCSITGRAKGVYKKFGLCRHILRKYALEGKIPGMKKASW
RS14_BRASB      ----------------ATRIRNRCELTGRPRSNYRKNKLSRIALRELGSKGLVPGLVKSSW
RS14_AZOPC      ------------------RLHNRCRITGRSKGYIRQFGISRIQLREMASMGLVPGVRKASW
RS14_AZOC5      ------------------RVRNRCEVTGRPRAFYRKLKMSRVALRELGSQGLVPGLVKSSW
RS14_XYLFT      --------KLQKLPRDSTRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW
RS14_XYLFM      --------KLQKLPRDSTRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW
RS14_XYLF2      --------KLQKLPRDSTRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW
RS14_PSYWF      ------------------RLRNRCGVTGRPHGYFRKFGLSRNILRERVMQGDVPGVRKASW
RS14_PSEU2      ----------------AARMRNRCRITGRPHGVYRKFGLGRNKLREAAMRGDVPGLVKASW
RS14_PSESM      ----------------AARMRNRCRITGR