[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56185.1

[Show Plain Result]


## Summary of Sequence Search
    1::280
    1::280     3e-41  32%  284 aa  MODD_ECO27 RecName: Full=Putative pyrophosphorylase modD;       
    1::280     8e-41  31%  284 aa  MODD_ECOL6 RecName: Full=Putative pyrophosphorylase modD;       
    1::280     8e-41  31%  284 aa  MODD_ECO57 RecName: Full=Putative pyrophosphorylase modD;       
    1::276     3e-40  35%  282 aa  MODD_PASMU RecName: Full=Putative pyrophosphorylase modD;       
   21::276     2e-30  31%  281 aa  MODD_HAEIN RecName: Full=Putative pyrophosphorylase modD;       
    1::256     3e-26  34%  258 aa  NADC_ARCFU RecName: Full=Probable nicotinate-nucleotide
   59::278     1e-24  30%  279 aa  NADC_METTH RecName: Full=Probable nicotinate-nucleotide
   48::285     5e-24  33%  285 aa  NADC_MYCTU RecName: Full=Nicotinate-nucleotide pyrophosphorylase
    1::190     7e-24  34%  259 aa  MODD_RHOCA RecName: Full=Putative pyrophosphorylase modD;       
   10::272     3e-23  29%  289 aa  NADC_BACSU RecName: Full=Probable nicotinate-nucleotide
   20::292     6e-23  30%  295 aa  NADC_SYNY3 RecName: Full=Probable nicotinate-nucleotide
   38::272     2e-21  28%  273 aa  NADC_HELPJ RecName: Full=Probable nicotinate-nucleotide
    5::272     3e-21  29%  273 aa  NADC_HELPY RecName: Full=Probable nicotinate-nucleotide
   47::282     5e-20  34%  284 aa  NADC_MYCLE RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   20::285     3e-18  28%  299 aa  NADC_RAT RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   16::272     4e-18  28%  296 aa  NADC_RHORU RecName: Full=Probable nicotinate-nucleotide
   21::280     6e-18  28%  282 aa  NADC_PSEAE RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   62::297     6e-18  30%  297 aa  NADC_ECOLI RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   20::285     1e-17  28%  299 aa  NADC_MOUSE RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   44::295     3e-17  28%  297 aa  NADC_SALTY RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   18::293     1e-16  25%  295 aa  NADC_YEAST RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   20::285     3e-16  27%  297 aa  NADC_HUMAN RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   42::277     4e-16  28%  283 aa  NADC_METJA RecName: Full=Probable nicotinate-nucleotide
   18::289     1e-15  24%  289 aa  NADC_NEMVE RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   20::285     2e-13  25%  299 aa  NADC_BOVIN RecName: Full=Nicotinate-nucleotide pyrophosphorylase
   34::277     2e-10  23%  300 aa  NADC_DICDI RecName: Full=Nicotinate-nucleotide pyrophosphorylase
  257::325     3e-04  31%  403 aa  IMDH1_YEAST RecName: Full=Putative inosine-5'-monophosphate
    6::51      6e-04  41%  486 aa  MURE_PARD8 RecName:
  258::326     6e-04  31%  524 aa  IMDH4_YEAST RecName: Full=Probable inosine-5'-monophosphate
    1::280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
MODD_ECO27      MIFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGISVACKMLTTLGLTIDDAVSDG
MODD_ECOL6      MIFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGISVACKMLTTLGLTIDDAVSDG
MODD_ECO57      MIFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGVSVACKMLTTLGLTIDDAVSDG
MODD_PASMU      MLYFSDNELDDFLLEDIYRGDLTTHALGLESIPAEICFKRKNAGIVAGISIAEKLLRKLDIHPQVYVKEG
MODD_HAEIN      --------------------DLTTHALSIENIPAKILFKRKNAGVVAGVSVAEKLLKKLDIQPHLYVKEG
NADC_ARCFU      ----------------MPYGDVTA----IPTKDVEAVIVSKGEGVLAGVGVVKILFDLAEIVVMESKKDG
NADC_METTH      --------------------------------------------------------------IIRWKDDG
NADC_MYCTU      ----------------------------------------REAGVVAGLDVALEVLGTNGYRVLDRVEDG
MODD_RHOCA      MFLIDDTALMALIREDVPAGDLTTRSLGLAAEAGELTMRARGAMTVACSEEAVRILQLLGAEAWIATASG
NADC_BACSU      --------LNHFFLEDIGTGDLTSQSI-FGEQSCEAEIVAKSEGIFAGAAIIKEGFSLLDENVILHKKDG
NADC_SYNY3      ---IIDPWLQQWLAEDIGRGDWSTQGLGL-QHRGQARWVAKENGVIAGLPMAARIFQLLSMEFQVLAGEG
NADC_HELPJ      ----------------------------------------KQEGVFSGEKYALELLQMTGIECVQNIKDK
NADC_HELPY      ------TFLERALKEDLGHGDLFERVL---EKDFKATAFVRQEGVFSGEKYALELLEMTGIECVQTIKDK
NADC_MYCLE      ----------------------------------------REPGVIAGVDVALLVLDEVGYRVLYRVEDG
NADC_RAT        ---------NSWLQEDCP--GLNFASLVTGSAPAQAVLWAKSPGVLAGRPFFDAIFTQLNCQVSWLLPEG
NADC_RHORU      -----DEAVRRALAEDLGRADITSTATIPAATRAHARFVARQPGILAGLGCARSAFALLDDTVTFTTEDG
NADC_PSEAE      ------------LAEDVGGGDLTAQLIDPQRE-AEARVITREHATIAGRAWVDEVFRQVDPRVLVTWQDG
NADC_ECOLI      ---------------------------------------TRENGVFCGKRWVEEVFIQLAGDIIWHVDDG
NADC_MOUSE      ---------NSWLQEDCP--GLNFASLVTGSAPSQAVLWAKSPGVLAGRPFFDAIFTQLNCQVSWFLPEG
NADC_SALTY      --------------------DITAQLLP-ADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTDDG
NADC_YEAST      --------VTNWLSEDVPSFDFGGYV--VGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
NADC_HUMAN      ---------DSWLREDCPGLNYAALVSGAG--PSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEG
NADC_METJA      ----------------------------------------KEKCIVCGIDFIVAFFEEYGIKCKKLFNDG
NADC_NEMVE      ---VIEKHVETWLKEDTPSFDYGGFVVGSSVEKAVL--LCKSDGVLAGVPFFNAIFEKLDCKVEWQNNEG
NADC_BOVIN      ---------DSWLREDCPGLNYVALVSGTA--PSQAVLWAKSPGVLAGRPFLDAIFAQVNCQVSWFLPEG
NADC_DICDI      ----------------------------VGSDEKVAHLLGKQNGVFSGSIFFQEIFNQLGCKVIWFIKDG
IMDH1_YEAST     ----------------------------------------------------------------------
MURE_PARD8      ---------------------------------------------LIGALEAPMLMGADNVDITNIQSDS
IMDH4_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
MODD_ECO27      SQANAGQRLIRAQGNAAALHQGWKAVQNVLEWSCGVSDYLAQMLALLRERYPDGNIACTRKAIPGTRLLA
MODD_ECOL6      SQANAGQRLIRAQGNAAALHQGWKAVQNVLEWSCGVSDYLAQMLALLRERYPDGNIACTRKAIPGTRLLA
MODD_ECO57      SQANAGQRLIRAQGNAAALHQGWKAIQNVLEWSCGVSDYLDQMLALLRERYPDGNIACTRKAIPGTRLLA
MODD_PASMU      EFVEAGSLLLSAKGSADKLHQAWKVVQLVLEWSCGVAQYTAEMISNAKAINPAAVVACTRKSIPNTRKLA
MODD_HAEIN      EWVESGALLISAEGMSEQLHQAWKVVQLVLEWSCGVAQYTAEMIANAKSVNPTAVVACTRKSIPNTRKLA
NADC_ARCFU      EPIKPGDVVMRLRGKSDSILATERLAINILMRMSGIATATAKMVERARRVNPKVVVAATRKTTPGFRIFE
NADC_METTH      DPLSGGERVLTLEGDAMDILMVERTMLNLMMKMSGIATLTRSMLQRARAVNEGIRIAATRKTTPGLQWFE
NADC_MYCTU      ARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLSGIATATAAWVDAVRGT--KAKIRDTRKTLPGLRALQ
MODD_RHOCA      RQVEGGEMLLFARGQVEALLAGWKVAQNLIEWASGLXXXXXXXXXXXXXXXXXXXXXCTRKSVPGTRALS
NADC_BACSU      DMLHKGEVIAELHGPAAALLSGERVVLNLIQRLSGIATMTREAVRCLDDE--QIKICDTRKTTPGLRMLE
NADC_SYNY3      QXXXXXXXXXXMAGNLGSLLTGERVALNLVMGLSGIATMTRQYVQAI-ADYPT-RFVDTRKTTPGLRVLE
NADC_HELPJ      ERFKPKDTLMEIRGDFSMLLKIERTLLNLLQHSSGIATLTSRFVEALNS--PKVRLLDTRKTRPLLRIFE
NADC_HELPY      ERFKPKDALMEIRGDFSMLLKVERTLLNLLQHSSGIATLTSRFVEALNSHKVR--LLDTRKTRPLLRIFE
NADC_MYCLE      ARLQSGQPLLTVQAAARGLLTAERTMLNLVCHMSGIATVTVAWVDAVRGT--KAKIRDTRKTLPGLRALQ
NADC_RAT        SKLVPVVKVAEVRGPAHHLLLGERVALNTLARCSGIXXXXXXXXXXXXXXGWAGHVAGTRKTTPGFRLVE
NADC_RHORU      AEIAAGQTVAEVAGAARTILAAERTALNFLGHLSGIATRTRRFGDAAHT---RARLTCTRKTTPGLRGLE
NADC_PSEAE      QRVEPNQMLFQLKGPARALLTGERSALNFLQLLSGTATRSQHYADLV--AGTAVKLLDTRKTLPGLRLAQ
NADC_ECOLI      DVINANQSLFELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNT--QLLDTRKTLPGLRSAL
NADC_MOUSE      SKLVPVVKVAEVKGPAHHLLLGERVALNTLARCSGIXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
NADC_SALTY      DAIHANQTVFELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLL--AGTQTQLLDTRKTLPGLRTAL
NADC_YEAST      SKNDSGKIVVKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
NADC_HUMAN      SKLVPVARVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXXXGWTGHVAGTRKTTPGFRLVE
NADC_METJA      EEAYGNILEFE--GDARTILMLERTALNLLMHLSGIATMTNRIVKKAKSVNKNVRVACTRKTLPLLSPLQ
NADC_NEMVE      DPIKAVSVIGTVTGPVNKILLGERVALNCISRASGIATKSRSLTNLKEQYQWHGEIAGTRKTTPGFRVVE
NADC_BOVIN      SKLVPVAKVAEVRGPAHCLLLGERVALNTLXXXXXXXXXXXXXXXXXXGTGWAGHVAGTRKTTPGFRLVE
NADC_DICDI      ESMTHGQVLAHVIGPVRNILIGERLSLNILSRSCGITTQVKKLVDGDNEQQQKGKIAGTRKTTPGFRLVE
IMDH1_YEAST     ----------------------------------------------------------------------
MURE_PARD8      RRVTKGSLFVAVRGTAVDGHA-------------------------------------------------
IMDH4_YEAST     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
MODD_ECO27      SQAILAAGGLIHRAGCAETILLFANHRHFLHDNQDWSGAINQLRRHAPEKKIVVEADAPKEAIAARAQPD
MODD_ECOL6      SQAILAAGGLIHRAGCAETILLFANHRHFLHDNQDWSGAINQLRRHAPEKKIVVEADTPKEAIAARAQPD
MODD_ECO57      SQAILAAGGLIHRAGCAETILLFANHRHFLHDNQDWSGAINQLRRHAPEKKIVVEADTPKEAIAARAQPD
MODD_PASMU      TNAVLAAGGHIHRQGLSETLLVFTNHRNLLSDPEDWQGIVTRLKQQAPENKITLEADLVQFEQMLTADPD
MODD_HAEIN      TNAVLAAGGHIHRQGVSETLLVFTNHRNLLSDPNDWTKIVDRLRQEAPENKITLEADYAQFEQMYMAEPD
NADC_ARCFU      KMAVEIGGGDAHRFSLSDCLMLKDNHIAVAGSLERAMK----VK-RSFTKKLEVEGDAIKA---AEFGAD
NADC_METTH      KQAVRIGGGDTHRFRLDDCAMIKDNHIAIVGNIEDAVRRVRDHVSFTKKVEVEVESPDDAVRA-AEAGAD
NADC_MYCTU      KYAVRTGGGVNHRLGLGDAALIKDNHVAAAG---SVVDALRAVRNAAPDLPCEVEVDSEQLDAVLPEKPE
MODD_RHOCA      LRAVTVGGATVHRTGLSDSVLLFAEHRA-FGGADALAAQIARLRASCPERK-------------------
NADC_BACSU      KYAVRAGGGYNHRFGLYDGIMIKDNHIAACGSILEACKKARQAAGHMVNIEVEIETE-EQLREAIAAGAD
NADC_SYNY3      KYASRLGGAMNHRLGLDDAVMVKDNHIQAAGSITKAVQTL----RQNLPYPLAIEVETEEVQEAIATQVE
NADC_HELPJ      KYSVLNGGASNHRLGLDDALMLKDTHLKHVKDLKSFLTHAR--KNLPFTAKIEIECESEEAKNAMSAGAD
NADC_HELPY      KYSVLNGGASNHRLGLDDALMLKDTHLRHVKDLKSFLTHAR--KNLPFTAKIEIECESEEAKNAMNAGAD
NADC_MYCLE      KYAVRVGGGVNHRLGLGDTALIKDNHVAAVG---SXXXXXXXXXXXXPELPCEVEVDSEQLDAMLAEEPE
NADC_RAT        KYGLLVGGAECHRYDLGGLVMVKDNHVVAAGSMEKAVLKARQAAG--FPLKVEVECSSKEALQAAEAGAD
NADC_RHORU      KYAVRCGGGSNHRFGLDDAVLIKDNHIAVAGGVSAALSRARAGVGHMVRIEIEVDTLEQXXXXXXXXXXX
NADC_PSEAE      KYAVTCGGCHNHRIGLYDAFLIKENHIAACGGXXXXXXXXXXXPGKPVEVEV---ENLDELRQALEAGAD
NADC_ECOLI      KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVR-----------QAVEKASWLHPDAXXXXXXXKAGAD
NADC_MOUSE      KYGLQVGGAACHRYDLGGMVMVKDNHVVAAGSMERAVLKARQAAGFSL--KVEVECSSEEAFRAAEAGAD
NADC_SALTY      KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHXXXXXXXXXXXXXXXXXAL--KAGAD
NADC_YEAST      KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCGFAV--KIEVECLSEEATEAIEAGAD
NADC_HUMAN      KYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG----VEKXXXXXXXXXXXXLKVEVECQEAVQAAEAGAD
NADC_METJA      KYAVYIGGGDTHRFRLDDCVLIKDNHIAIVGVKEAIRRAKENVS---FTKKIEVESNLKXXXXXXXXXXD
NADC_NEMVE      KYALEVGGVSTHRYDLSTMIMLKDNHIWSTGNITRAVKNARRVGG--FSMKIEVECRSXXXXXXXXXXXX
NADC_BOVIN      KYGLLVGGAAAHRYDLGGLVMVKDNHVMXXXXXXXXXXXXXXXXDFAL--KVEVECSSQEAVEAAEAGAD
NADC_DICDI      KLALLTAGLDTHRMDLSSMIMLKDNHIWACGNITNTVKNARSVGG--FSLKIEVECNQNXXXXXXXXXXX
IMDH1_YEAST     -----------------------------------------------------MDADKERLRLLVKAGLD
MURE_PARD8      ----------------------------------------------------------------------
IMDH4_YEAST     -----------------------------------------------------IEADKERLRLLVEAGLD


                         .         .         .         +         .         .         .:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRPL
MODD_ECO27      VLQLDKFSPQQATEIAQIAPSLAPHCTLALTGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSLQP-
MODD_ECOL6      VLQLDKFSPQQATEIAQIAPSLAPHCTLALTGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSLQP-
MODD_ECO57      VLQLDKFSPQQATEIAQIAPSLAPHCTLALTGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSLQP-
MODD_PASMU      IIQLDKFTLEQVKQALHLLALANKNITLSVAGGVNKHNVAEYAKLGIQLFITSAPYYAAPEDIKV-----
MODD_HAEIN      IIQLDKWLLEDVKKALDLLQSKQKDILLSVAGGVNKNNVSDYAKLGIRLFITSAPYYVPPEDIKV-----
NADC_ARCFU      IIMLDNFTPEMVAEAVEELRGLREKVIIEVSGSVTPENVAEFAAMDVDVISSYITHSAPALDFSLRV---
NADC_METTH      IVLLDNMSPETIRNTLEELRGLRDNVIVEASGGIKPDNIELYASTGVEVISMFITASAHPVDLSLEIRGL
NADC_MYCTU      LILLDNFAVWQTQTAVQRRDSRAPTVMLESSGGLSLQTAATYAETGVDYLAVGATHSVRVLDIGLDM---
MODD_RHOCA      ----------------------------------------------------------------------
NADC_BACSU      VIMFDNCPPD----TVRHFAKLTPNIKTEASGGITLESLPAFKGTGVNYISLFLTHSVKSLDISM-----
NADC_SYNY3      IIMLDNMGTDTMATAVKLIRQANPLIRIEASGNVTLANLTAIASTGVDFISSSAPITRSPLDLSMQI---
NADC_HELPJ      IVMCDNMSVGETKEIAAYREAHYPFVLLEASGNISLESINAYAKSGVDAISVGALIQATFIDMHMKM---
NADC_HELPY      IVMCDNLSVLETKEIAAYRDAHYPFVLLEASGNISLESINAYAKSGVDAISVGALIQATFIDMHMKM---
NADC_MYCLE      LILLDNFPVWQTQVAVRDIRA--PTVXXXXXXXXXXXNAAIYAGTGVDYLAVGATHSVRILDIGL-----
NADC_RAT        LVMLDNFKPEELHPTAATLKAKFPNVSVEASGGVTLDNLPQFCGTNIDVISLGMLTQAAPLDFSLKL---
NADC_RHORU      XXXXDNM---DAPTLTRAVDMVAGRLVTEASGGVSLDTIAALAESGVDYISVGA----------------
NADC_PSEAE      IVMLDELSLDDMRTAVALTAG---RAKLEASGGINEGTLRNIAETGVDYISITLTKDVRAVDLSMRL---
NADC_ECOLI      IIMLDNFETEQMREAVKRTNG---KALLEVSGNVTDKTLREFAETGVDFISVGATKHVQALDLSMRFR--
NADC_MOUSE      LVMLDNFKPEELHPTAATLKARFPSVSVEASGGVTLDNLTQFCGTHIDVISLGMLTQAAPLDFSLKL---
NADC_SALTY      IIMLDNFNTDQMREAVKR---VNGQARLEVSGNVTAETLREFAETGVDFISVGATKHVRALDLSMR----
NADC_YEAST      VIMLDNFKGDGLKMCAQSLKNKKKHFLLECSGGLNLDNLEEYLCDDIDIYSTSSIHQGTPIDFSLKL---
NADC_HUMAN      LVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPLDFSLKL---
NADC_METJA      IIMLDNFKPEEIEEALKIIRKTNFKPIIEVSGGIKEDNILEYAKYNVDVISMGATHSVKSVDMSL-----
NADC_NEMVE      XIMLDNFEPQALHTTAKTLKGKCAGVIIEASGGINDSSIAQYFGPHVDVISLGCLTQGKPVNFSLKI---
NADC_BOVIN      LVLLDNFRPEELHPTAATLKAQFPSVSVEASGGVRLDNLPQFCGPHIDVISLGMLTQAAPLDFSLKL---
NADC_DICDI      XVMLDNFNPQDLQTVSTYLKQHYPHITLEASGGITSATIIQYAIPTID----------------------
IMDH1_YEAST     VVILDSSQGNSIFQLIKWIKETFPDLEIIAGNVVTKEQAANLIAAGADGL--------------------
MURE_PARD8      ----------------------------------------------------------------------
IMDH4_YEAST     VVILDSSQGNSVFQLIKWIKETFPDLEIIAGNVATREQAANLIAAGADGL--------------------