[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56230.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
    3::213     6e-40  42%  251 aa  ABCX_PORPU RecName: Full=Probable ATP-dependent transporter ycf16;
    4::213     7e-39  41%  251 aa  ABCX_PORYE RecName: Full=Probable ATP-dependent transporter ycf16;
    6::214     9e-37  37%  251 aa  ABCX_ANTSP RecName: Full=Probable ATP-dependent transporter ycf16;
    4::212     6e-36  39%  256 aa  Y075_SYNY3 RecName: Full=Probable ATP-dependent transporter
    4::210     7e-36  40%  261 aa  V296_BACSU RecName: Full=Vegetative protein 296;       
    1::215     1e-35  37%  251 aa  ABCX_ODOSI RecName: Full=Probable ATP-dependent transporter ycf16;
    1::236     8e-35  36%  248 aa  SUFC_ECOLI RecName: Full=Probable ATP-dependent transporter sufC;
    2::213     3e-34  36%  253 aa  ABCX_GUITH RecName: Full=Probable ATP-dependent transporter ycf16;
    3::216     9e-34  36%  259 aa  ABCX_CYAPA RecName: Full=Probable ATP-dependent transporter ycf16;
    5::214     2e-33  38%  254 aa  ABCX_CYACA RecName: Full=Probable ATP-dependent transporter ycf16;
   88::324     3e-33  37%  338 aa  AB6I_ARATH RecName: Full=ABC transporter I family member 6,
    2::232     1e-31  36%  256 aa  Y285_STRP1 RecName: Full=Probable ABC transporter ATP-binding
    2::232     1e-31  36%  256 aa  Y273_STRP6 RecName: Full=Probable ABC transporter ATP-binding
    2::232     1e-31  36%  256 aa  Y208_STRP3 RecName: Full=Probable ABC transporter ATP-binding
    2::232     4e-31  35%  256 aa  Y273_STRP8 RecName: Full=Probable ABC transporter ATP-binding
    5::246     1e-26  32%  257 aa  ABCX_GALSU RecName: Full=Probable ATP-dependent transporter ycf16;
    6::209     3e-23  32%  250 aa  Y035_METJA RecName: Full=Uncharacterized ABC transporter
    1::143     3e-14  36%  494 aa  RBSA_GEOKA RecName: Full=Ribose import ATP-binding protein rbsA;   
   11::96      2e-13  38%  527 aa  LSRA_YERE8 RecName: Full=Autoinducer 2 import ATP-binding protein
   11::135     2e-13  33%  520 aa  LSRA_PHOTE RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPY RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPS RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPP RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPN RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPG RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPE RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPB RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERPA RecName: Full=Autoinducer 2 import ATP-binding protein
    4::96      4e-13  37%  527 aa  LSRA_YERP3 RecName: Full=Autoinducer 2 import ATP-binding protein
    4::84      2e-12  38%  369 aa  UGPC1_RHIL3 RecName: Full=sn-glycerol-3-phosphate import
    4::143     3e-12  32%  499 aa  RBSA1_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 1;
   14::137     4e-12  32%  517 aa  RBSA_ANAVT RecName: Full=Ribose import ATP-binding protein rbsA;   
    4::193     6e-12  28%  369 aa  UGPC2_RHIEC RecName: Full=sn-glycerol-3-phosphate import
    3::87      7e-12  39%  257 aa  LIVG_ARCFU RecName: Full=Probable branched-chain amino acid
    4::137     7e-12  35%  362 aa  AGLK_RHIME RecName: Full=Alpha-glucoside transport ATP-binding
    7::126     1e-11  30%  511 aa  LSRA_SALTY RecName: Full=Autoinducer 2 import ATP-binding protein
    7::126     1e-11  30%  511 aa  LSRA_SALTI RecName: Full=Autoinducer 2 import ATP-binding protein
    7::126     1e-11  30%  511 aa  LSRA_SALPB RecName: Full=Autoinducer 2 import ATP-binding protein
    7::126     1e-11  30%  511 aa  LSRA_SALPA RecName: Full=Autoinducer 2 import ATP-binding protein
    7::126     1e-11  30%  511 aa  LSRA_SALCH RecName: Full=Autoinducer 2 import ATP-binding protein
    1::105     1e-11  30%  270 aa  HMUV_JANSC RecName: Full=Hemin import ATP-binding protein hmuV;    
    2::145     1e-11  33%  511 aa  RBSA_SILST RecName: Full=Ribose import ATP-binding protein rbsA;   
   11::101     2e-11  34%  511 aa  LSRA_PHOLU RecName: Full=Autoinducer 2 import ATP-binding protein
   10::93      2e-11  43%  517 aa  RBSA2_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA
   10::93      4e-11  43%  517 aa  RBSA_BURPS RecName: Full=Ribose import ATP-binding protein rbsA; 
   12::105     5e-11  35%  505 aa  RBSA1_STRCO RecName: Full=Ribose import ATP-binding protein rbsA 1;
    2::141     5e-11  31%  241 aa  LPTB_HAEIN RecName: Full=Lipopolysaccharide export system
    3::86      6e-11  36%  504 aa  RGMG_BURXL RecName: Full=Putative ribose/galactose/methyl
   28::110     6e-11  39%  519 aa  RBSA2_PASMU RecName: Full=Ribose import ATP-binding protein rbsA 2;
   10::93      6e-11  43%  517 aa  RBSA1_BURCH RecName: Full=Ribose import ATP-binding protein rbsA
   10::93      6e-11  43%  517 aa  RBSA1_BURCA RecName: Full=Ribose import ATP-binding protein rbsA
   11::101     6e-11  33%  511 aa  LSRA_PHOLL RecName: Full=Autoinducer 2 import ATP-binding protein
   31::170     8e-11  29%  270 aa  Y382_RHIME RecName: Full=Uncharacterized ABC transporter
    2::191     8e-11  27%  330 aa  WTPC_PYRKO RecName: Full=Molybdate/tungstate import ATP-binding
   12::105     8e-11  35%  505 aa  RBSA2_STRAW RecName: Full=Ribose import ATP-binding protein rbsA 2;
   19::210     8e-11  29%  715 aa  MACB_SYNFM RecName: Full=Macrolide export ATP-binding/permease
    3::138     1e-10  33%  492 aa  RBSA_LACLS RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::125     1e-10  31%  501 aa  RBSA_HAHCH RecName: Full=Ribose import ATP-binding protein rbsA;   
    7::100     1e-10  37%  515 aa  RBSA1_RHILO RecName: Full=Ribose import ATP-binding protein rbsA 1;
   10::93      1e-10  43%  517 aa  RBSA1_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA
   11::134     1e-10  29%  511 aa  LSRA_ECOLI RecName: Full=Autoinducer 2 import ATP-binding protein
   11::134     1e-10  29%  511 aa  LSRA_ECODH RecName: Full=Autoinducer 2 import ATP-binding protein
    1::140     1e-10  31%  498 aa  RBSA_DEIGD RecName: Full=Ribose import ATP-binding protein rbsA;   
   11::134     1e-10  29%  511 aa  LSRA_ECO57 RecName: Full=Autoinducer 2 import ATP-binding protein
    4::94      2e-10  32%  495 aa  LSRA_ENT38 RecName: Full=Autoinducer 2 import ATP-binding protein
   11::134     2e-10  29%  333 aa  LSRA_ECO24 RecName: Full=Putative autoinducer 2 import ATP-binding
    4::79      2e-10  42%  237 aa  LIVF_SALTY RecName: Full=High-affinity branched-chain amino acid
    4::79      2e-10  42%  237 aa  LIVF_SALTI RecName: Full=High-affinity branched-chain amino acid
   40::121     2e-10  35%  281 aa  Y3926_AZOC5 RecName: Full=Probable ABC transporter ATP-binding
    4::84      2e-10  36%  366 aa  UGPC_RHILO RecName: Full=sn-glycerol-3-phosphate import
    4::137     2e-10  31%  332 aa  SMOK_RHOSH RecName: Full=ATP-binding transport protein
    2::84      2e-10  35%  499 aa  RBSA_BACHD RecName: Full=Ribose import ATP-binding protein rbsA; 
   11::134     2e-10  29%  511 aa  LSRA_SHIFL RecName: Full=Autoinducer 2 import ATP-binding protein
   11::134     2e-10  29%  511 aa  LSRA_SHIF8 RecName: Full=Autoinducer 2 import ATP-binding protein
   11::134     2e-10  29%  511 aa  LSRA_ECOLC RecName: Full=Autoinducer 2 import ATP-binding protein
    6::88      3e-10  39%  506 aa  RBSA2_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA
   10::93      3e-10  42%  517 aa  RBSA2_BURTA RecName: Full=Ribose import ATP-binding protein rbsA
    5::144     3e-10  26%  506 aa  RBSA2_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA 2;
    1::146     4e-10  34%  522 aa  RBSA1_STRAW RecName: Full=Ribose import ATP-binding protein rbsA 1;
   10::91      4e-10  34%  372 aa  POTA_HAEI8 RecName: Full=Spermidine/putrescine import ATP-binding
    6::88      5e-10  39%  507 aa  RBSA_YERPS RecName: Full=Ribose import ATP-binding protein rbsA; 
    6::88      5e-10  39%  507 aa  RBSA_YERPN RecName: Full=Ribose import ATP-binding protein rbsA; 
    6::88      5e-10  39%  507 aa  RBSA_YERPE RecName: Full=Ribose import ATP-binding protein rbsA; 
    6::88      5e-10  39%  507 aa  RBSA_YERPA RecName: Full=Ribose import ATP-binding protein rbsA; 
    5::97      5e-10  29%  496 aa  RBSA_BACCR RecName: Full=Ribose import ATP-binding protein rbsA;   
   13::140     5e-10  34%  506 aa  MGLA_SODGM RecName: Full=Galactose/methyl galactoside import
    1::75      5e-10  40%  255 aa  HMUV_PSEPK RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::67      7e-10  45%  497 aa  Y4MK_RHISN RecName: Full=Uncharacterized ABC transporter
   18::130     7e-10  35%  353 aa  UGPC_PARDP RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    4::84      7e-10  37%  373 aa  UGPC2_AGRT5 RecName: Full=sn-glycerol-3-phosphate import
   10::93      7e-10  42%  517 aa  RBSA1_BURCM RecName: Full=Ribose import ATP-binding protein rbsA
   13::140     7e-10  33%  506 aa  MGLA_SALTY RecName: Full=Galactose/methyl galactoside import
    8::89      7e-10  35%  261 aa  HMUV_ROSDO RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::80      7e-10  37%  357 aa  CYSA_BACCR RecName: Full=Sulfate/thiosulfate import ATP-binding
   11::98      9e-10  34%  516 aa  RBSA_JANSC RecName: Full=Ribose import ATP-binding protein rbsA; 
    3::95      9e-10  29%  494 aa  RBSA_BACHK RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::95      9e-10  29%  494 aa  RBSA_BACCZ RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::95      9e-10  29%  494 aa  RBSA_BACAN RecName: Full=Ribose import ATP-binding protein rbsA;   
  293::373     1e-09  38%  579 aa  Y5482_VIBPA RecName: Full=Putative ABC transporter ATP-binding
    3::138     1e-09  31%  492 aa  RBSA_LACLA RecName: Full=Ribose import ATP-binding protein rbsA;   
   11::94      1e-09  39%  516 aa  RBSA_BURXL RecName: Full=Ribose import ATP-binding protein rbsA; 
    3::67      1e-09  37%  494 aa  RBSA_BACC1 RecName: Full=Ribose import ATP-binding protein rbsA; 
   10::105     1e-09  43%  259 aa  PSTB2_MAGSA RecName: Full=Phosphate import ATP-binding protein pstB
   10::91      1e-09  33%  372 aa  POTA_HAEIN RecName: Full=Spermidine/putrescine import ATP-binding
    6::140     1e-09  33%  506 aa  MGLA_YERPS RecName: Full=Galactose/methyl galactoside import
    6::140     1e-09  33%  506 aa  MGLA_YERPN RecName: Full=Galactose/methyl galactoside import
    6::140     1e-09  33%  506 aa  MGLA_YERPE RecName: Full=Galactose/methyl galactoside import
    6::140     1e-09  33%  506 aa  MGLA_YERPA RecName: Full=Galactose/methyl galactoside import
   11::134     1e-09  28%  511 aa  LSRA_ECOSM RecName: Full=Autoinducer 2 import ATP-binding protein
    4::84      2e-09  37%  350 aa  Y3745_BRUSU RecName: Full=Putative ATP-binding protein BRA0745;  
    4::84      2e-09  37%  350 aa  Y2993_BRUA2 RecName: Full=Putative ATP-binding protein BAB2_0493;
    4::84      2e-09  37%  350 aa  Y2787_BRUAB RecName: Full=Putative ATP-binding protein
    3::95      2e-09  34%  519 aa  XYLG_BURCM RecName: Full=Xylose import ATP-binding protein xylG; 
    3::95      2e-09  34%  519 aa  XYLG_BURCH RecName: Full=Xylose import ATP-binding protein xylG; 
    3::95      2e-09  34%  519 aa  XYLG_BURCA RecName: Full=Xylose import ATP-binding protein xylG; 
    5::87      2e-09  33%  501 aa  RGMG_THETN RecName: Full=Putative ribose/galactose/methyl
    4::149     2e-09  29%  501 aa  RBSA_CLOPE RecName: Full=Ribose import ATP-binding protein rbsA;   
    4::88      2e-09  36%  498 aa  RBSA1_PASMU RecName: Full=Ribose import ATP-binding protein rbsA
    6::140     2e-09  31%  506 aa  MGLA_ECO57 RecName: Full=Galactose/methyl galactoside import
    3::86      2e-09  41%  228 aa  LOLD2_CAUCR RecName: Full=Lipoprotein-releasing system
    3::95      2e-09  34%  519 aa  XYLG_BURTA RecName: Full=Xylose import ATP-binding protein xylG; 
    1::75      2e-09  41%  344 aa  WTPC_PYRFU RecName: Full=Molybdate/tungstate import ATP-binding
    4::149     2e-09  29%  501 aa  RBSA_CLOPS RecName: Full=Ribose import ATP-binding protein rbsA;   
    4::149     2e-09  29%  501 aa  RBSA_CLOP1 RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::64      2e-09  40%  502 aa  RBSA_CHRVO RecName: Full=Ribose import ATP-binding protein rbsA; 
   10::91      2e-09  33%  373 aa  POTA_MANSM RecName: Full=Spermidine/putrescine import ATP-binding
    6::140     2e-09  31%  506 aa  MGLA_SHISS RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_SHIFL RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_SHIF8 RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_ECOUT RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_ECOLI RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_ECOL6 RecName: Full=Galactose/methyl galactoside import
    6::140     2e-09  31%  506 aa  MGLA_ECOL5 RecName: Full=Galactose/methyl galactoside import
   11::134     2e-09  28%  511 aa  LSRA_ECOHS RecName: Full=Autoinducer 2 import ATP-binding protein
   19::91      2e-09  38%  257 aa  LIVG_METJA RecName: Full=Probable branched-chain amino acid
   19::92      2e-09  41%  262 aa  HMUV_RHOP2 RecName: Full=Hemin import ATP-binding protein hmuV;  
  410::477     3e-09  43%  631 aa  Y1303_MYCBO RecName: Full=Uncharacterized ABC transporter
  410::477     3e-09  43%  631 aa  Y1272_MYCTU RecName: Full=Uncharacterized ABC transporter
    1::148     3e-09  27%  505 aa  RGMG1_AGRT5 RecName: Full=Putative ribose/galactose/methyl
    3::122     3e-09  32%  492 aa  RBSA_STRA5 RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::122     3e-09  32%  492 aa  RBSA_STRA3 RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::122     3e-09  32%  492 aa  RBSA_STRA1 RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::125     3e-09  32%  501 aa  RBSA_SALPA RecName: Full=Ribose import ATP-binding protein rbsA;   
    4::112     3e-09  34%  501 aa  RBSA_ERWCT RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::122     3e-09  31%  506 aa  RBSA2_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA 2;
    2::65      3e-09  41%  506 aa  RBSA2_BURCH RecName: Full=Ribose import ATP-binding protein rbsA
    2::65      3e-09  41%  506 aa  RBSA2_BURCA RecName: Full=Ribose import ATP-binding protein rbsA
   20::129     3e-09  34%  458 aa  POTA_MYCPU RecName: Full=Spermidine/putrescine import ATP-binding
    1::108     3e-09  32%  259 aa  HMUV_MESSB RecName: Full=Hemin import ATP-binding protein hmuV;    
    4::84      3e-09  36%  351 aa  UGPC_SILST RecName: Full=sn-glycerol-3-phosphate import
    4::84      3e-09  37%  365 aa  UGPC_RALSO RecName: Full=sn-glycerol-3-phosphate import
    4::85      3e-09  40%  357 aa  UGPC_ERWCT RecName: Full=sn-glycerol-3-phosphate import
    3::73      3e-09  39%  504 aa  RGMG_RHOFD RecName: Full=Putative ribose/galactose/methyl
    3::122     3e-09  28%  493 aa  RBSA_BACLD RecName: Full=Ribose import ATP-binding protein rbsA;   
    1::100     3e-09  32%  512 aa  RBSA1_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 1;
   10::91      3e-09  32%  372 aa  POTA_ACTAC RecName: Full=Spermidine/putrescine import ATP-binding
   18::104     5e-09  36%  517 aa  RGMG1_BURCM RecName: Full=Putative ribose/galactose/methyl
    5::100     5e-09  32%  512 aa  RBSA1_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 1;
    8::142     5e-09  24%  368 aa  POTA_LEUMM RecName: Full=Spermidine/putrescine import ATP-binding
    5::95      5e-09  33%  496 aa  LSRA_KLEP7 RecName: Full=Autoinducer 2 import ATP-binding protein
    4::85      6e-09  36%  361 aa  UGPC_BORA1 RecName: Full=sn-glycerol-3-phosphate import
   32::143     6e-09  33%  525 aa  RGMG_PSEU2 RecName: Full=Putative ribose/galactose/methyl
   32::143     6e-09  34%  525 aa  RGMG_PSE14 RecName: Full=Putative ribose/galactose/methyl
    5::144     6e-09  31%  503 aa  RBSA1_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 1;
    1::71      6e-09  42%  333 aa  METN_MYCSS RecName: Full=Methionine import ATP-binding protein
    3::76      6e-09  49%  225 aa  LOLD_DECAR RecName: Full=Lipoprotein-releasing system ATP-binding
    3::86      8e-09  37%  251 aa  ZNUC_SALTY RecName: Full=Zinc import ATP-binding protein znuC;   
    5::95      8e-09  33%  519 aa  XYLG_BURXL RecName: Full=Xylose import ATP-binding protein xylG; 
    4::85      8e-09  38%  362 aa  UGPC_YERE8 RecName: Full=sn-glycerol-3-phosphate import
    4::130     8e-09  34%  348 aa  UGPC3_RHIEC RecName: Full=sn-glycerol-3-phosphate import
   14::96      8e-09  35%  513 aa  RGMG3_BURCM RecName: Full=Putative ribose/galactose/methyl
    2::125     8e-09  31%  501 aa  RBSA_SALCH RecName: Full=Ribose import ATP-binding protein rbsA;   
    1::148     8e-09  32%  517 aa  RBSA2_STRCO RecName: Full=Ribose import ATP-binding protein rbsA 2;
   17::114     8e-09  35%  519 aa  RBSA2_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 2;
    3::106     8e-09  31%  508 aa  RBSA2_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 2;
    2::92      8e-09  35%  506 aa  RBSA1_BURTA RecName: Full=Ribose import ATP-binding protein rbsA
   19::159     8e-09  30%  510 aa  RBSA1_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA 1;
    8::90      8e-09  31%  371 aa  POTA_HAEDU RecName: Full=Spermidine/putrescine import ATP-binding
    1::89      8e-09  40%  330 aa  METN_MYXXD RecName: Full=Methionine import ATP-binding protein
    2::143     8e-09  30%  501 aa  ARAG_RHIEC RecName: Full=Arabinose import ATP-binding protein araG;
    9::95      1e-08  32%  512 aa  RGMG2_BURCH RecName: Full=Putative ribose/galactose/methyl
    9::95      1e-08  32%  512 aa  RGMG2_BURCA RecName: Full=Putative ribose/galactose/methyl
    6::88      1e-08  36%  495 aa  RBSA_SHIDS RecName: Full=Ribose import ATP-binding protein rbsA; 
    3::134     1e-08  28%  500 aa  RBSA_LACC3 RecName: Full=Ribose import ATP-binding protein rbsA;   
    1::143     1e-08  26%  367 aa  POTA_OENOB RecName: Full=Spermidine/putrescine import ATP-binding
   16::102     1e-08  34%  260 aa  HMUV_AGRT5 RecName: Full=Hemin import ATP-binding protein hmuV;    
    3::86      1e-08  37%  251 aa  ZNUC_SALTI RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      1e-08  37%  251 aa  ZNUC_SALPA RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      1e-08  37%  251 aa  ZNUC_SALCH RecName: Full=Zinc import ATP-binding protein znuC;   
   13::65      1e-08  51%  260 aa  ZNUC_MAGSM RecName: Full=Zinc import ATP-binding protein znuC;   
   32::143     1e-08  33%  525 aa  RGMG_PSESM RecName: Full=Putative ribose/galactose/methyl
    4::127     1e-08  30%  501 aa  RBSA_VIBPA RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::112     1e-08  33%  501 aa  RBSA_SALTY RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::112     1e-08  33%  501 aa  RBSA_SALTI RecName: Full=Ribose import ATP-binding protein rbsA;   
   20::85      1e-08  38%  365 aa  POTA_LACAC RecName: Full=Spermidine/putrescine import ATP-binding
    4::88      1e-08  32%  373 aa  POTA_DESDG RecName: Full=Spermidine/putrescine import ATP-binding
  352::419     1e-08  37%  601 aa  MSBA_SYNAS RecName: Full=Lipid A export ATP-binding/permease
    6::95      1e-08  33%  506 aa  MGLA_SHIBS RecName: Full=Galactose/methyl galactoside import
    7::150     1e-08  31%  504 aa  MGLA_CLOTE RecName: Full=Galactose/methyl galactoside import
   23::202     1e-08  28%  288 aa  CBIO1_SYMTH RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    3::144     1e-08  29%  502 aa  ARAG_RHIL3 RecName: Full=Arabinose import ATP-binding protein araG;
    3::146     1e-08  27%  497 aa  ARAG_CHRSD RecName: Full=Arabinose import ATP-binding protein araG;
   16::76      2e-08  45%  564 aa  Y2240_PHOPR RecName: Full=Putative ABC transporter ATP-binding
   20::84      2e-08  44%  558 aa  Y1934_STRMU RecName: Full=Putative ABC transporter ATP-binding
    3::100     2e-08  32%  528 aa  XYLG_PSESM RecName: Full=Xylose import ATP-binding protein xylG;   
    4::85      2e-08  38%  357 aa  UGPC_YERPS RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-08  38%  357 aa  UGPC_YERPN RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-08  38%  357 aa  UGPC_YERPE RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-08  38%  357 aa  UGPC_YERPA RecName: Full=sn-glycerol-3-phosphate import
    4::130     2e-08  30%  351 aa  UGPC_SILPO RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    4::85      2e-08  37%  362 aa  UGPC_BURXL RecName: Full=sn-glycerol-3-phosphate import
   22::147     2e-08  31%  522 aa  RGMG_BACHD RecName: Full=Putative ribose/galactose/methyl
    4::128     2e-08  30%  500 aa  RBSA_VIBCH RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::145     2e-08  29%  496 aa  RBSA_THETN RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::92      2e-08  35%  506 aa  RBSA2_BURCM RecName: Full=Ribose import ATP-binding protein rbsA
    9::93      2e-08  29%  372 aa  POTA_VIBF1 RecName: Full=Spermidine/putrescine import ATP-binding
    6::77      2e-08  36%  368 aa  POTA_THEMA RecName: Full=Spermidine/putrescine import ATP-binding
    4::88      2e-08  28%  368 aa  POTA_DESVH RecName: Full=Spermidine/putrescine import ATP-binding
  345::407     2e-08  43%  579 aa  MSBA_THIDA RecName: Full=Lipid A export ATP-binding/permease
    3::137     2e-08  31%  503 aa  MGLA2_PHOPR RecName: Full=Galactose/methyl galactoside import
   20::199     2e-08  36%  338 aa  METN1_RHOSR RecName: Full=Methionine import ATP-binding protein
    4::87      2e-08  36%  348 aa  FBPC_STRCO RecName: Full=Fe(3+) ions import ATP-binding protein
    3::80      2e-08  35%  357 aa  CYSA_BACC1 RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::53      2e-08  39%  259 aa  ZNUC_ALCBS RecName: Full=Zinc import ATP-binding protein znuC;   
    4::84      2e-08  33%  349 aa  UGPC_RHOS1 RecName: Full=sn-glycerol-3-phosphate import
   24::131     2e-08  32%  515 aa  RGMG_PSEF5 RecName: Full=Putative ribose/galactose/methyl
   21::93      2e-08  37%  402 aa  POTA_PSYCK RecName: Full=Spermidine/putrescine import ATP-binding
    6::92      2e-08  31%  372 aa  POTA_PHOPR RecName: Full=Spermidine/putrescine import ATP-binding
   25::95      2e-08  39%  459 aa  POTA_MYCS5 RecName: Full=Spermidine/putrescine import ATP-binding
   32::167     2e-08  28%  473 aa  POTA_MYCMO RecName: Full=Spermidine/putrescine import ATP-binding
    2::139     2e-08  27%  361 aa  POTA_ENTFA RecName: Full=Spermidine/putrescine import ATP-binding
    3::139     2e-08  30%  347 aa  POTA_CLONN RecName: Full=Spermidine/putrescine import ATP-binding
    5::113     2e-08  41%  653 aa  MACB_SODGM RecName: Full=Macrolide export ATP-binding/permease
   14::73      2e-08  43%  261 aa  HMUV_RHOPS RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::100     3e-08  32%  518 aa  XYLG_PSEU2 RecName: Full=Xylose import ATP-binding protein xylG;   
    5::147     3e-08  25%  504 aa  XYLG_GEOKA RecName: Full=Xylose import ATP-binding protein xylG;   
   17::85      3e-08  38%  367 aa  UGPC_RALME RecName: Full=sn-glycerol-3-phosphate import
   20::85      3e-08  39%  370 aa  UGPC_CHRSD RecName: Full=sn-glycerol-3-phosphate import
   13::95      3e-08  33%  512 aa  RGMG1_BURS3 RecName: Full=Putative ribose/galactose/methyl
    1::149     3e-08  27%  503 aa  RBSA_RHOSR RecName: Full=Ribose import ATP-binding protein rbsA;   
    5::82      3e-08  38%  512 aa  RBSA_PSEPK RecName: Full=Ribose import ATP-binding protein rbsA; 
    2::86      3e-08  35%  493 aa  RBSA_HAEIN RecName: Full=Ribose import ATP-binding protein rbsA; 
    2::86      3e-08  35%  493 aa  RBSA_HAEI8 RecName: Full=Ribose import ATP-binding protein rbsA; 
   17::98      3e-08  30%  378 aa  POTA_SALTY RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      3e-08  30%  378 aa  POTA_SALTI RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      3e-08  30%  378 aa  POTA_SALPA RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      3e-08  30%  378 aa  POTA_SALCH RecName: Full=Spermidine/putrescine import ATP-binding
    5::86      3e-08  34%  364 aa  POTA_LEGPL RecName: Full=Spermidine/putrescine import ATP-binding
    3::86      4e-08  36%  251 aa  ZNUC_SHISS RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_SHIFL RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_SHIF8 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_SHIDS RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_SHIBS RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECOUT RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECOLI RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECOL6 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECOL5 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECOK1 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::86      4e-08  36%  251 aa  ZNUC_ECO57 RecName: Full=Zinc import ATP-binding protein znuC;   
   17::144     4e-08  37%  273 aa  SSUB2_BURS3 RecName: Full=Aliphatic sulfonates import ATP-binding
    6::125     4e-08  28%  502 aa  RBSA_RHOS4 RecName: Full=Ribose import ATP-binding protein rbsA;   
    3::138     4e-08  28%  496 aa  RBSA_OCEIH RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::149     4e-08  30%  501 aa  RBSA_ECOUT RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::149     4e-08  30%  501 aa  RBSA_ECOLI RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::149     4e-08  30%  501 aa  RBSA_ECOL6 RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::149     4e-08  30%  501 aa  RBSA_ECOL5 RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::149     4e-08  30%  501 aa  RBSA1_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA 1;
   10::91      4e-08  29%  370 aa  POTA_PASMU RecName: Full=Spermidine/putrescine import ATP-binding
    5::86      4e-08  34%  364 aa  POTA_LEGPH RecName: Full=Spermidine/putrescine import ATP-binding
    5::86      4e-08  34%  364 aa  POTA_LEGPA RecName: Full=Spermidine/putrescine import ATP-binding
    2::84      4e-08  31%  361 aa  POTA_CHRVO RecName: Full=Spermidine/putrescine import ATP-binding
    5::79      4e-08  37%  237 aa  LIVF_ECOLI RecName: Full=High-affinity branched-chain amino acid
    7::112     4e-08  30%  236 aa  LIVF_ARCFU RecName: Full=Probable branched-chain amino acid
    1::111     4e-08  29%  273 aa  HMUV_SALRD RecName: Full=Hemin import ATP-binding protein hmuV;    
    7::195     4e-08  31%  214 aa  CCMA_XANAC RecName: Full=Cytochrome c biogenesis ATP-binding export
    3::100     5e-08  31%  518 aa  XYLG_PSE14 RecName: Full=Xylose import ATP-binding protein xylG;   
   16::190     5e-08  25%  345 aa  WTPC_PYRHO RecName: Full=Molybdate/tungstate import ATP-binding
   18::130     5e-08  33%  362 aa  UGPC_BORPE RecName: Full=sn-glycerol-3-phosphate import ATP-binding
   18::130     5e-08  33%  362 aa  UGPC_BORBR RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    3::65      5e-08  41%  548 aa  TLRC_STRFR RecName: Full=Tylosin resistance ATP-binding protein
    4::97      5e-08  32%  501 aa  RBSA_PHOLL RecName: Full=Ribose import ATP-binding protein rbsA;   
   20::106     5e-08  33%  512 aa  RBSA2_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 2;
   17::98      5e-08  30%  377 aa  POTA_VIBVY RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      5e-08  30%  377 aa  POTA_VIBVU RecName: Full=Spermidine/putrescine import ATP-binding
    2::85      5e-08  30%  364 aa  POTA_STAS1 RecName: Full=Spermidine/putrescine import ATP-binding
    2::87      5e-08  29%  365 aa  POTA_HAHCH RecName: Full=Spermidine/putrescine import ATP-binding
   47::153     5e-08  29%  465 aa  POTA_FRAAA RecName: Full=Spermidine/putrescine import ATP-binding
    1::112     5e-08  37%  266 aa  NIKE_BRUSU RecName: Full=Nickel import ATP-binding protein nikE;   
    4::86      5e-08  36%  496 aa  MGLA_TREPA RecName: Full=Galactose/methyl galactoside import
    1::75      5e-08  36%  255 aa  HMUV_PSEE4 RecName: Full=Hemin import ATP-binding protein hmuV;  
   29::104     5e-08  39%  288 aa  HMUV_NOCFA RecName: Full=Hemin import ATP-binding protein hmuV;    
    2::128     5e-08  41%  349 aa  FBPC_YERPS RecName: Full=Fe(3+) ions import ATP-binding protein
    2::128     5e-08  41%  349 aa  FBPC_YERPN RecName: Full=Fe(3+) ions import ATP-binding protein
    2::128     5e-08  41%  349 aa  FBPC_YERPE RecName: Full=Fe(3+) ions import ATP-binding protein
    2::128     5e-08  41%  349 aa  FBPC_YERPA RecName: Full=Fe(3+) ions import ATP-binding protein
    3::83      5e-08  33%  339 aa  CYSA_CAUCR RecName: Full=Sulfate/thiosulfate import ATP-binding
    5::53      7e-08  45%  253 aa  ZNUC_YERPS RecName: Full=Zinc import ATP-binding protein znuC;   
    5::53      7e-08  45%  253 aa  ZNUC_YERPN RecName: Full=Zinc import ATP-binding protein znuC;   
    5::53      7e-08  45%  253 aa  ZNUC_YERPE RecName: Full=Zinc import ATP-binding protein znuC;   
    5::53      7e-08  45%  253 aa  ZNUC_YERPA RecName: Full=Zinc import ATP-binding protein znuC;   
    3::52      7e-08  44%  252 aa  ZNUC_YERE8 RecName: Full=Zinc import ATP-binding protein znuC;   
    4::84      7e-08  32%  349 aa  UGPC_RHOS4 RecName: Full=sn-glycerol-3-phosphate import
    4::85      7e-08  35%  360 aa  UGPC_BURTA RecName: Full=sn-glycerol-3-phosphate import
    2::112     7e-08  31%  501 aa  RBSA_SHISS RecName: Full=Ribose import ATP-binding protein rbsA;   
    5::98      7e-08  31%  504 aa  RBSA_PHOPR RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::92      7e-08  34%  506 aa  RBSA_BURMA RecName: Full=Ribose import ATP-binding protein rbsA; 
    3::138     7e-08  27%  493 aa  RBSA_BACSU RecName: Full=Ribose import ATP-binding protein rbsA;   
    8::137     7e-08  28%  499 aa  RBSA_BACSK RecName: Full=Ribose import ATP-binding protein rbsA;   
  355::445     7e-08  34%  859 aa  RBSA1_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA 1;
    5::88      7e-08  38%  559 aa  POTA_MYCGE RecName: Full=Spermidine/putrescine import ATP-binding
    3::86      7e-08  30%  350 aa  POTA_MESFL RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     7e-08  25%  268 aa  NIKE_SHIBS RecName: Full=Nickel import ATP-binding protein nikE;   
    1::69      7e-08  36%  264 aa  HMUV_RHIEC RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::84      7e-08  31%  331 aa  CYSA_NOCFA RecName: Full=Sulfate/thiosulfate import ATP-binding
    8::153     7e-08  27%  507 aa  ARAG_PSE14 RecName: Full=Arabinose import ATP-binding protein araG;
   19::85      9e-08  37%  369 aa  UGPC_RALEJ RecName: Full=sn-glycerol-3-phosphate import
   21::71      9e-08  48%  255 aa  SSUB_BACSU RecName: Full=Aliphatic sulfonates import ATP-binding
   16::154     9e-08  29%  524 aa  RBSA_CORGL RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::107     9e-08  32%  512 aa  RBSA2_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 2;
    2::147     9e-08  28%  507 aa  RBSA2_RHILO RecName: Full=Ribose import ATP-binding protein rbsA 2;
    5::86      9e-08  29%  363 aa  POTA_PSEAB RecName: Full=Spermidine/putrescine import ATP-binding
    5::86      9e-08  29%  363 aa  POTA2_PSEAE RecName: Full=Spermidine/putrescine import
    1::112     9e-08  37%  266 aa  NIKE_BRUME RecName: Full=Nickel import ATP-binding protein nikE;   
    1::112     9e-08  37%  266 aa  NIKE_BRUAB RecName: Full=Nickel import ATP-binding protein nikE;   
    1::112     9e-08  37%  266 aa  NIKE_BRUA2 RecName: Full=Nickel import ATP-binding protein nikE;   
    1::136     9e-08  29%  502 aa  MGLA_VIBVY RecName: Full=Galactose/methyl galactoside import
    1::136     9e-08  29%  502 aa  MGLA_VIBVU RecName: Full=Galactose/methyl galactoside import
    1::69      9e-08  35%  264 aa  HMUV_RHILE RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::69      9e-08  35%  264 aa  HMUV_RHIL3 RecName: Full=Hemin import ATP-binding protein hmuV;  
    2::91      9e-08  27%  352 aa  FBPC1_ERWCT RecName: Full=Fe(3+) ions import ATP-binding protein
    1::129     1e-07  29%  500 aa  YTFR_ECOLI RecName: Full=Uncharacterized ABC transporter
    1::129     1e-07  29%  500 aa  YTFR_ECO57 RecName: Full=Uncharacterized ABC transporter
   23::85      1e-07  40%  363 aa  UGPC_RHOPA RecName: Full=sn-glycerol-3-phosphate import
   17::144     1e-07  36%  270 aa  SSUB2_BURCH RecName: Full=Aliphatic sulfonates import ATP-binding
   17::144     1e-07  36%  270 aa  SSUB2_BURCA RecName: Full=Aliphatic sulfonates import ATP-binding
   41::165     1e-07  31%  515 aa  RGMG_HAHCH RecName: Full=Putative ribose/galactose/methyl
    2::147     1e-07  27%  503 aa  RGMG_GEOKA RecName: Full=Putative ribose/galactose/methyl
    4::98      1e-07  29%  504 aa  RBSA_VIBF1 RecName: Full=Ribose import ATP-binding protein rbsA;   
    2::143     1e-07  30%  495 aa  RBSA3_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 3;
    2::84      1e-07  30%  361 aa  POTA_NITEU RecName: Full=Spermidine/putrescine import ATP-binding
    2::84      1e-07  30%  363 aa  POTA_NITEC RecName: Full=Spermidine/putrescine import ATP-binding
   18::107     1e-07  39%  264 aa  PHNC_PSEE4 RecName: Full=Phosphonates import ATP-binding protein
    1::91      1e-07  33%  502 aa  MGLA_VIBCH RecName: Full=Galactose/methyl galactoside import
    3::92      1e-07  36%  268 aa  HMUV_BRAJA RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::68      1e-07  36%  511 aa  ARAG_RALSO RecName: Full=Arabinose import ATP-binding protein
   14::153     1e-07  28%  507 aa  ARAG_PSEU2 RecName: Full=Arabinose import ATP-binding protein araG;
    3::53      1e-07  43%  257 aa  ZNUC_PSEE4 RecName: Full=Zinc import ATP-binding protein znuC;   
  296::373     1e-07  36%  574 aa  Y5533_VIBVU RecName: Full=Putative ABC transporter ATP-binding
  296::373     1e-07  36%  574 aa  Y4347_VIBVY RecName: Full=Putative ABC transporter ATP-binding
  299::372     1e-07  38%  566 aa  Y2655_BACCR RecName: Full=Putative ABC transporter ATP-binding
    3::194     1e-07  26%  349 aa  UGPC_RHIME RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    2::66      1e-07  41%  262 aa  TAUB_PSEPU RecName: Full=Taurine import ATP-binding protein tauB;
    9::56      1e-07  46%  245 aa  SSUB1_RHOSR RecName: Full=Aliphatic sulfonates import ATP-binding
   36::110     1e-07  37%  284 aa  PSTB2_NATPD RecName: Full=Phosphate import ATP-binding protein pstB
   21::86      1e-07  36%  363 aa  POTA_LACJO RecName: Full=Spermidine/putrescine import ATP-binding
   20::85      1e-07  36%  362 aa  POTA_LACDB RecName: Full=Spermidine/putrescine import ATP-binding
   20::85      1e-07  36%  362 aa  POTA_LACDA RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     1e-07  25%  268 aa  NIKE_ECOUT RecName: Full=Nickel import ATP-binding protein nikE;   
   17::216     1e-07  25%  268 aa  NIKE_ECOL6 RecName: Full=Nickel import ATP-binding protein nikE;   
   17::216     1e-07  25%  268 aa  NIKE_ECOL5 RecName: Full=Nickel import ATP-binding protein nikE;   
   26::101     1e-07  39%  284 aa  HMUV_THEFY RecName: Full=Hemin import ATP-binding protein hmuV;    
    1::73      1e-07  34%  240 aa  GLNQ_ECOLI RecName: Full=Glutamine transport ATP-binding protein
    3::68      1e-07  41%  362 aa  CYSA_NITEU RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      1e-07  35%  354 aa  CYSA_BORBR RecName: Full=Sulfate/thiosulfate import ATP-binding
   17::87      1e-07  44%  276 aa  CBIO_MOOTA RecName: Full=Cobalt import ATP-binding protein cbiO; 
    8::153     1e-07  27%  507 aa  ARAG_PSESM RecName: Full=Arabinose import ATP-binding protein araG;
  591::659     1e-07  37%  849 aa  ABCB6_XENTR RecName: Full=ATP-binding cassette sub-family B member
   52::127     1e-07  34%  624 aa  AB23G_ARATH RecName: Full=ABC transporter G family member 23;      
    3::62      2e-07  40%  262 aa  ZNUC_PSEU2 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::100     2e-07  30%  518 aa  XYLG_PSEPF RecName: Full=Xylose import ATP-binding protein xylG;   
   23::126     2e-07  32%  361 aa  UGPC_RHOP5 RecName: Full=sn-glycerol-3-phosphate import ATP-binding
   19::85      2e-07  36%  366 aa  UGPC_RALEH RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-07  33%  361 aa  UGPC_BURCM RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-07  33%  361 aa  UGPC_BURCH RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-07  33%  361 aa  UGPC_BURCA RecName: Full=sn-glycerol-3-phosphate import
    2::71      2e-07  41%  263 aa  TAUB_PSEAE RecName: Full=Taurine import ATP-binding protein tauB;
   32::103     2e-07  36%  524 aa  RGMG2_BURCM RecName: Full=Putative ribose/galactose/methyl
    4::132     2e-07  27%  501 aa  RGMG1_RHIME RecName: Full=Putative ribose/galactose/methyl
   11::214     2e-07  29%  260 aa  PSTB1_MAGSA RecName: Full=Phosphate import ATP-binding protein pstB
   17::98      2e-07  30%  377 aa  POTA_VIBPA RecName: Full=Spermidine/putrescine import ATP-binding
    5::86      2e-07  28%  363 aa  POTA_LACSS RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     2e-07  24%  268 aa  NIKE_SHIFL RecName: Full=Nickel import ATP-binding protein nikE;   
    5::87      2e-07  31%  497 aa  MGLA1_PHOPR RecName: Full=Galactose/methyl galactoside import
 1091::1274    2e-07  26% 1321 aa  MDR1_CAEEL RecName: Full=Multidrug resistance protein 1;       
    6::75      2e-07  39%  644 aa  MACB_MARAV RecName: Full=Macrolide export ATP-binding/permease
   35::97      2e-07  40%  656 aa  MACB_AZOSB RecName: Full=Macrolide export ATP-binding/permease
    1::125     2e-07  27%  263 aa  HMUV_RHILO RecName: Full=Hemin import ATP-binding protein hmuV;    
    3::62      2e-07  47%  207 aa  CCMA_RHIME RecName: Full=Cytochrome c biogenesis ATP-binding
    7::102     2e-07  28%  517 aa  ARAG_BACHD RecName: Full=L-arabinose transport ATP-binding protein
  333::442     2e-07  32%  588 aa  Y020_ONYPE RecName: Full=Putative ABC transporter ATP-binding
   23::85      2e-07  40%  366 aa  UGPC_RHOPB RecName: Full=sn-glycerol-3-phosphate import
    4::85      2e-07  33%  361 aa  UGPC_BURS3 RecName: Full=sn-glycerol-3-phosphate import
   18::130     2e-07  32%  362 aa  UGPC_BORPA RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    1::65      2e-07  38%  255 aa  TAUB_ECO57 RecName: Full=Taurine import ATP-binding protein tauB;
    1::64      2e-07  34%  229 aa  SRTF_STRPY RecName: Full=Lantibiotic transport ATP-binding
    1::64      2e-07  34%  229 aa  SRTF_STRP1 RecName: Full=Lantibiotic transport ATP-binding
   17::98      2e-07  30%  377 aa  POTA_VIBCH RecName: Full=Spermidine/putrescine import ATP-binding
   20::85      2e-07  36%  373 aa  POTA_PARUW RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     2e-07  24%  268 aa  NIKE_SHIF8 RecName: Full=Nickel import ATP-binding protein nikE;   
   17::216     2e-07  24%  268 aa  NIKE_ECO57 RecName: Full=Nickel import ATP-binding protein nikE;   
   21::205     2e-07  27%  359 aa  METN_POLSJ RecName: Full=Methionine import ATP-binding protein
   21::204     2e-07  34%  362 aa  METN_BORA1 RecName: Full=Methionine import ATP-binding protein
   23::207     2e-07  29%  224 aa  LOLD_GEOSL RecName: Full=Lipoprotein-releasing system ATP-binding
   22::83      2e-07  44%  227 aa  LOLD_BRUSU RecName: Full=Lipoprotein-releasing system ATP-binding
   22::83      2e-07  44%  227 aa  LOLD_BRUME RecName: Full=Lipoprotein-releasing system ATP-binding
   22::83      2e-07  44%  227 aa  LOLD_BRUAB RecName: Full=Lipoprotein-releasing system ATP-binding
   22::83      2e-07  44%  227 aa  LOLD_BRUA2 RecName: Full=Lipoprotein-releasing system ATP-binding
    1::87      2e-07  37%  228 aa  LOLD_AZOSE RecName: Full=Lipoprotein-releasing system ATP-binding
   26::74      2e-07  49%  239 aa  LOLD_ANADE RecName: Full=Lipoprotein-releasing system ATP-binding
    3::75      2e-07  37%  267 aa  HMUV_MYXXD RecName: Full=Hemin import ATP-binding protein hmuV;  
    2::128     2e-07  35%  345 aa  FBPC_SERMA RecName: Full=Fe(3+) ions import ATP-binding protein
   10::95      2e-07  31%  362 aa  CYSA_MYCPA RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::62      3e-07  38%  265 aa  ZNUC_PSE14 RecName: Full=Zinc import ATP-binding protein znuC;   
  352::546     3e-07  27%  578 aa  Y1799_STAAB RecName: Full=Putative multidrug export
    3::81      3e-07  35%  568 aa  Y1583_CLOPE RecName: Full=Putative ABC transporter ATP-binding
    4::85      3e-07  35%  356 aa  UGPC_SALCH RecName: Full=sn-glycerol-3-phosphate import
   23::85      3e-07  38%  364 aa  UGPC_RHOPS RecName: Full=sn-glycerol-3-phosphate import
   39::99      3e-07  44%  303 aa  SSUB_RALEH RecName: Full=Aliphatic sulfonates import ATP-binding
   23::163     3e-07  29%  513 aa  RGMG2_RHIME RecName: Full=Putative ribose/galactose/methyl
    2::85      3e-07  27%  364 aa  POTA_STAHJ RecName: Full=Spermidine/putrescine import ATP-binding
    1::81      3e-07  32%  461 aa  POTA_BACFR RecName: Full=Spermidine/putrescine import ATP-binding
    1::81      3e-07  32%  461 aa  POTA_BACFN RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     3e-07  24%  268 aa  NIKE_SHIDS RecName: Full=Nickel import ATP-binding protein nikE;   
    1::85      3e-07  36%  659 aa  MACB_NITEU RecName: Full=Macrolide export ATP-binding/permease
    4::198     3e-07  24%  241 aa  LPTB_SHIFL RecName: Full=Lipopolysaccharide export system
    4::198     3e-07  24%  241 aa  LPTB_ECOLI RecName: Full=Lipopolysaccharide export system
    4::198     3e-07  24%  241 aa  LPTB_ECOL6 RecName: Full=Lipopolysaccharide export system
    4::198     3e-07  24%  241 aa  LPTB_ECO57 RecName: Full=Lipopolysaccharide export system
    8::132     3e-07  38%  255 aa  LOLD2_RHOBA RecName: Full=Lipoprotein-releasing system ATP-binding
   42::101     3e-07  42%  292 aa  HMUV_RHOSR RecName: Full=Hemin import ATP-binding protein hmuV;    
    1::69      3e-07  36%  261 aa  HMUV_PSEHT RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::67      3e-07  33%  269 aa  HMUV_METFK RecName: Full=Hemin import ATP-binding protein hmuV;  
    2::81      3e-07  38%  345 aa  FBPC_STRAW RecName: Full=Fe(3+) ions import ATP-binding protein
    6::89      3e-07  27%  351 aa  FBPC_MANSM RecName: Full=Fe(3+) ions import ATP-binding protein
    3::67      3e-07  37%  357 aa  CYSA_NEIMB RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      3e-07  33%  350 aa  CYSA_CUCSA RecName: Full=Sulfate/thiosulfate import ATP-binding
   16::118     3e-07  33%  214 aa  CCMA_MARMM RecName: Full=Cytochrome c biogenesis ATP-binding export
   28::142     3e-07  35%  274 aa  CBIO2_MYCMO RecName: Full=Cobalt import ATP-binding protein cbiO 2;
   20::159     3e-07  25%  523 aa  ARAG_YERPS RecName: Full=Arabinose import ATP-binding protein araG;
   20::159     3e-07  25%  523 aa  ARAG_YERPN RecName: Full=Arabinose import ATP-binding protein araG;
   20::159     3e-07  25%  523 aa  ARAG_YERPE RecName: Full=Arabinose import ATP-binding protein araG;
   20::159     3e-07  25%  523 aa  ARAG_YERPA RecName: Full=Arabinose import ATP-binding protein araG;
    8::89      3e-07  33%  504 aa  ARAG_SHISS RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_SHIFL RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_SHIDS RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_SHIBS RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_ECOUT RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_ECOLI RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_ECOL6 RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_ECOL5 RecName: Full=Arabinose import ATP-binding protein
    8::89      3e-07  33%  504 aa  ARAG_ECO57 RecName: Full=Arabinose import ATP-binding protein
    5::147     3e-07  30%  513 aa  ARAG_BACST RecName: Full=L-arabinose transport ATP-binding protein
   20::139     3e-07  33%  503 aa  ARAG1_BURCH RecName: Full=Arabinose import ATP-binding protein araG
   20::139     3e-07  33%  503 aa  ARAG1_BURCA RecName: Full=Arabinose import ATP-binding protein araG
    3::53      4e-07  39%  269 aa  ZNUC_PSEAE RecName: Full=Zinc import ATP-binding protein znuC;   
    3::53      4e-07  39%  269 aa  ZNUC_PSEAB RecName: Full=Zinc import ATP-binding protein znuC;   
   20::69      4e-07  42%  259 aa  ZNUC_ALHEH RecName: Full=Zinc import ATP-binding protein znuC;   
  344::526     4e-07  29%  575 aa  YWJA_BACSU RecName: Full=Uncharacterized ABC transporter
   22::86      4e-07  38%  510 aa  YUFO_BACSU RecName: Full=Uncharacterized ABC transporter
  319::364     4e-07  48%  563 aa  Y2324_STRCO RecName: Full=Putative ABC transporter ATP-binding
  352::419     4e-07  40%  578 aa  Y2003_STAA8 RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1956_STAAR RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1924_STAAC RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1866_STAAM RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1847_STAA3 RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1806_STAAW RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1788_STAAS RecName: Full=Putative multidrug export
  352::419     4e-07  40%  578 aa  Y1683_STAAN RecName: Full=Putative multidrug export
    4::85      4e-07  33%  356 aa  UGPC_SALTY RecName: Full=sn-glycerol-3-phosphate import
    4::85      4e-07  33%  360 aa  UGPC_BURMA RecName: Full=sn-glycerol-3-phosphate import
    2::69      4e-07  38%  259 aa  TAUB_PSEE4 RecName: Full=Taurine import ATP-binding protein tauB;
    2::71      4e-07  41%  263 aa  TAUB_PSEAB RecName: Full=Taurine import ATP-binding protein tauB;
   19::105     4e-07  32%  511 aa  RBSA3_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 3;
   17::87      4e-07  33%  362 aa  POTA_LACS1 RecName: Full=Spermidine/putrescine import ATP-binding
   24::102     4e-07  30%  381 aa  POTA_ANAVT RecName: Full=Spermidine/putrescine import ATP-binding
   24::102     4e-07  30%  381 aa  POTA_ANASP RecName: Full=Spermidine/putrescine import ATP-binding
   16::64      4e-07  47%  369 aa  MODC_MYCTU RecName: Full=Molybdenum import ATP-binding protein
    3::87      4e-07  33%  497 aa  MGLA_TREDE RecName: Full=Galactose/methyl galactoside import
    7::89      4e-07  31%  500 aa  MGLA_FUSNN RecName: Full=Galactose/methyl galactoside import
  352::480     4e-07  33%  593 aa  MDLB_ECOLI RecName: Full=Multidrug resistance-like ATP-binding
  352::480     4e-07  33%  593 aa  MDLB_ECOL6 RecName: Full=Multidrug resistance-like ATP-binding
  352::480     4e-07  33%  593 aa  MDLB_ECO57 RecName: Full=Multidrug resistance-like ATP-binding
    5::92      4e-07  35%  269 aa  HMUV_RHOPB RecName: Full=Hemin import ATP-binding protein hmuV;  
   16::70      4e-07  42%  262 aa  HMUV_RHIME RecName: Full=Hemin import ATP-binding protein hmuV;  
    5::68      4e-07  42%  352 aa  FBPC_NEIMB RecName: Full=Fe(3+) ions import ATP-binding protein
    5::68      4e-07  42%  352 aa  FBPC_NEIMA RecName: Full=Fe(3+) ions import ATP-binding protein
    5::68      4e-07  41%  352 aa  FBPC_NEIGO RecName: Full=Fe(3+) ions import ATP-binding protein
    5::68      4e-07  41%  352 aa  FBPC_NEIG1 RecName: Full=Fe(3+) ions import ATP-binding protein
    3::67      4e-07  37%  357 aa  CYSA_NEIMA RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      4e-07  33%  354 aa  CYSA_BORPE RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      4e-07  33%  354 aa  CYSA_BORPA RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::89      4e-07  28%  507 aa  ARAG_ERWCT RecName: Full=Arabinose import ATP-binding protein
   14::208     6e-07  27%  231 aa  YTRE_BACSU RecName: Full=ABC transporter ATP-binding protein ytrE;
    4::85      6e-07  33%  356 aa  UGPC_SALPA RecName: Full=sn-glycerol-3-phosphate import
    4::85      6e-07  33%  360 aa  UGPC_BURPS RecName: Full=sn-glycerol-3-phosphate import
    4::85      6e-07  33%  360 aa  UGPC_BURP1 RecName: Full=sn-glycerol-3-phosphate import
    2::66      6e-07  40%  262 aa  TAUB_PSEPK RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      6e-07  38%  255 aa  TAUB_ECOUT RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      6e-07  38%  255 aa  TAUB_ECOL6 RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      6e-07  38%  255 aa  TAUB_ECOL5 RecName: Full=Taurine import ATP-binding protein tauB;
    1::100     6e-07  28%  499 aa  RGMG3_AGRT5 RecName: Full=Putative ribose/galactose/methyl
   28::110     6e-07  33%  524 aa  RGMG1_RHIEC RecName: Full=Putative ribose/galactose/methyl
   32::98      6e-07  36%  524 aa  RGMG1_BURCH RecName: Full=Putative ribose/galactose/methyl
   32::98      6e-07  36%  524 aa  RGMG1_BURCA RecName: Full=Putative ribose/galactose/methyl
    5::141     6e-07  31%  504 aa  RBSA3_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 3;
    7::108     6e-07  32%  513 aa  RBSA3_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 3;
   17::98      6e-07  28%  378 aa  POTA_SHIDS RecName: Full=Spermidine/putrescine import ATP-binding
    6::88      6e-07  38%  560 aa  POTA_MYCPN RecName: Full=Spermidine/putrescine import ATP-binding
    2::86      6e-07  28%  373 aa  POTA_MARAV RecName: Full=Spermidine/putrescine import ATP-binding
   42::161     6e-07  30%  343 aa  NODI_RHISN RecName: Full=Nod factor export ATP-binding protein I;  
  354::542     6e-07  26%  585 aa  MSBA_DECAR RecName: Full=Lipid A export ATP-binding/permease
  269::309     6e-07  54%  490 aa  MODF_ECOLI RecName: Full=Putative molybdenum transport ATP-binding
   28::95      6e-07  35%  359 aa  MKL_MYCTU RecName: Full=Probable ribonucleotide transport
   16::83      6e-07  35%  347 aa  MKL_MYCLE RecName: Full=Probable ribonucleotide transport
   28::95      6e-07  35%  359 aa  MKL_MYCBO RecName: Full=Probable ribonucleotide transport
    5::91      6e-07  40%  340 aa  METN_LEIXX RecName: Full=Methionine import ATP-binding protein
   26::100     6e-07  36%  369 aa  METN_BRUSU RecName: Full=Methionine import ATP-binding protein
   26::100     6e-07  36%  369 aa  METN_BRUME RecName: Full=Methionine import ATP-binding protein
   26::100     6e-07  36%  369 aa  METN_BRUAB RecName: Full=Methionine import ATP-binding protein
   26::100     6e-07  36%  369 aa  METN_BRUA2 RecName: Full=Methionine import ATP-binding protein
   21::77      6e-07  42%  233 aa  LOLD_SALCH RecName: Full=Lipoprotein-releasing system ATP-binding
   21::81      6e-07  47%  224 aa  LOLD_NITEU RecName: Full=Lipoprotein-releasing system ATP-binding
   23::82      6e-07  43%  230 aa  LOLD_CHRVO RecName: Full=Lipoprotein-releasing system ATP-binding
    3::80      6e-07  31%  330 aa  CYSA_ERWCT RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::52      7e-07  38%  261 aa  ZNUC_VIBVY RecName: Full=Zinc import ATP-binding protein znuC;   
    3::52      7e-07  38%  261 aa  ZNUC_VIBVU RecName: Full=Zinc import ATP-binding protein znuC;   
    5::53      7e-07  45%  256 aa  ZNUC_SILPO RecName: Full=Zinc import ATP-binding protein znuC;   
    2::53      7e-07  40%  243 aa  ZNUC_JANSC RecName: Full=Zinc import ATP-binding protein znuC;   
  295::375     7e-07  36%  560 aa  Y430_STRR6 RecName: Full=Putative ABC transporter ATP-binding
   16::85      7e-07  34%  356 aa  UGPC_SALTI RecName: Full=sn-glycerol-3-phosphate import
   19::131     7e-07  29%  345 aa  UGPC_BARBK RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    1::204     7e-07  28%  247 aa  TCYC_BACSU RecName: Full=L-cystine import ATP-binding protein tcyC;
    1::65      7e-07  38%  255 aa  TAUB_SHISS RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      7e-07  38%  255 aa  TAUB_SHIFL RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      7e-07  38%  255 aa  TAUB_SHIF8 RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      7e-07  38%  255 aa  TAUB_SHIDS RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      7e-07  38%  255 aa  TAUB_SHIBS RecName: Full=Taurine import ATP-binding protein tauB;
    1::65      7e-07  38%  255 aa  TAUB_ECOLI RecName: Full=Taurine import ATP-binding protein tauB;
   19::100     7e-07  33%  377 aa  POTG_ECOLI RecName: Full=Putrescine transport ATP-binding protein
    4::85      7e-07  27%  364 aa  POTA_STAEQ RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_SHISS RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_SHIFL RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_SHIF8 RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_SHIBS RecName: Full=Spermidine/putrescine import ATP-binding
    6::86      7e-07  32%  376 aa  POTA_FUSNN RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECOUT RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECOLI RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECOL6 RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECOL5 RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECOK1 RecName: Full=Spermidine/putrescine import ATP-binding
   17::98      7e-07  28%  378 aa  POTA_ECO57 RecName: Full=Spermidine/putrescine import ATP-binding
    3::86      7e-07  27%  347 aa  POTA_CLOD6 RecName: Full=Spermidine/putrescine import ATP-binding
   17::216     7e-07  24%  268 aa  NIKE_SHISS RecName: Full=Nickel import ATP-binding protein nikE;   
   17::216     7e-07  24%  268 aa  NIKE_ECOLI RecName: Full=Nickel import ATP-binding protein nikE;   
  351::403     7e-07  42%  587 aa  NDVA_RHIL3 RecName: Full=Beta-(1-->2)glucan export
   34::102     7e-07  46%  361 aa  METN_RHIEC RecName: Full=Methionine import ATP-binding protein
   16::74      7e-07  42%  228 aa  LOLD_SILPO RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      7e-07  40%  233 aa  LOLD_SALTY RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      7e-07  40%  233 aa  LOLD_SALTI RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      7e-07  40%  233 aa  LOLD_SALPA RecName: Full=Lipoprotein-releasing system ATP-binding
    2::74      7e-07  45%  224 aa  LOLD_POLSJ RecName: Full=Lipoprotein-releasing system ATP-binding
   24::82      7e-07  42%  228 aa  LOLD_HYPNA RecName: Full=Lipoprotein-releasing system ATP-binding
   12::207     7e-07  30%  225 aa  LOLD_GEOMG RecName: Full=Lipoprotein-releasing system ATP-binding
    1::75      7e-07  28%  237 aa  LIVF_METJA RecName: Full=Probable branched-chain amino acid
    4::92      7e-07  31%  269 aa  HMUV_NITWN RecName: Full=Hemin import ATP-binding protein hmuV;  
    4::87      7e-07  25%  351 aa  FBPC_PHOPR RecName: Full=Fe(3+) ions import ATP-binding protein
    2::87      7e-07  24%  351 aa  FBPC_PHOLL RecName: Full=Fe(3+) ions import ATP-binding protein
    5::130     7e-07  33%  346 aa  FBPC2_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein
   22::89      7e-07  34%  353 aa  CYSA_MYCTU RecName: Full=Sulfate/thiosulfate import ATP-binding
   22::89      7e-07  34%  353 aa  CYSA_MYCBO RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::67      7e-07  37%  348 aa  CYSA_METCA RecName: Full=Sulfate/thiosulfate import ATP-binding
    5::87      7e-07  31%  255 aa  BRAF_PSEAE RecName: Full=High-affinity branched-chain amino acid
  461::524     7e-07  38%  716 aa  ATM1_NEUCR RecName: Full=Iron-sulfur clusters transporter atm-1,
  453::514     7e-07  37%  698 aa  ATM1_GIBZE RecName: Full=Iron-sulfur clusters transporter ATM1,
    3::62      9e-07  37%  264 aa  ZNUC_PSESM RecName: Full=Zinc import ATP-binding protein znuC;   
    3::53      9e-07  39%  257 aa  ZNUC_PSEPK RecName: Full=Zinc import ATP-binding protein znuC;   
  353::422     9e-07  41%  580 aa  YGAD_BACSU RecName: Full=Putative multidrug export
   14::86      9e-07  44%  279 aa  Y3001_GEOSL RecName: Full=Putative ABC transporter ATP-binding
    4::85      9e-07  33%  356 aa  UGPC_ECOUT RecName: Full=sn-glycerol-3-phosphate import
    4::85      9e-07  33%  356 aa  UGPC_ECOL6 RecName: Full=sn-glycerol-3-phosphate import
    4::85      9e-07  33%  356 aa  UGPC_ECOL5 RecName: Full=sn-glycerol-3-phosphate import
    4::85      9e-07  33%  356 aa  UGPC_ECOK1 RecName: Full=sn-glycerol-3-phosphate import
   17::84      9e-07  37%  348 aa  UGPC3_RHIL3 RecName: Full=sn-glycerol-3-phosphate import
    2::84      9e-07  29%  363 aa  POTA_NITMU RecName: Full=Spermidine/putrescine import ATP-binding
   21::86      9e-07  35%  363 aa  POTA_LACGA RecName: Full=Spermidine/putrescine import ATP-binding
  351::403     9e-07  42%  587 aa  NDVA_RHIEC RecName: Full=Beta-(1-->2)glucan export
  343::477     9e-07  33%  572 aa  MSBA_DESPS RecName: Full=Lipid A export ATP-binding/permease
   40::227     9e-07  30%  359 aa  METN_COREF RecName: Full=Methionine import ATP-binding protein
    4::84      9e-07  31%  369 aa  MALK_VIBF1 RecName: Full=Maltose/maltodextrin import ATP-binding
    8::81      9e-07  38%  654 aa  MACB2_PSEE4 RecName: Full=Macrolide export ATP-binding/permease
    2::114     9e-07  29%  219 aa  LOLD_PORGI RecName: Full=Lipoprotein-releasing system ATP-binding
   14::94      9e-07  32%  366 aa  CYSA2_CHRVO RecName: Full=Sulfate/thiosulfate import ATP-binding
   20::195     9e-07  31%  214 aa  CCMA_XANOR RecName: Full=Cytochrome c biogenesis ATP-binding export
   20::195     9e-07  31%  214 aa  CCMA_XANOM RecName: Full=Cytochrome c biogenesis ATP-binding export
   20::195     9e-07  31%  214 aa  CCMA_XANC5 RecName: Full=Cytochrome c biogenesis ATP-binding export
   19::197     9e-07  30%  272 aa  CBIO2_MYCH2 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
   19::197     9e-07  30%  272 aa  CBIO1_MYCHJ RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   19::197     9e-07  30%  272 aa  CBIO1_MYCH7 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  156::277     9e-07  31%  406 aa  CBIO1_MESFL RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   20::66      9e-07  51%  503 aa  ARAG_BURMA RecName: Full=Arabinose import ATP-binding protein
   20::139     9e-07  35%  503 aa  ARAG1_BURCM RecName: Full=Arabinose import ATP-binding protein araG
  506::563     9e-07  36%  738 aa  ABCBA_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  154::276     9e-07  29%  737 aa  AB27G_ARATH RecName: Full=ABC transporter G family member 27;      
    3::53      1e-06  37%  257 aa  ZNUC_MARAV RecName: Full=Zinc import ATP-binding protein znuC;   
    3::52      1e-06  42%  252 aa  ZNUC_ERWCT RecName: Full=Zinc import ATP-binding protein znuC;   
    5::98      1e-06  34%  547 aa  YKOD_BACSU RecName: Full=Putative HMP/thiamine import ATP-binding
   15::87      1e-06  33%  486 aa  Y318_BORBU RecName: Full=Uncharacterized ABC transporter
   23::131     1e-06  29%  358 aa  UGPC_ROSDO RecName: Full=sn-glycerol-3-phosphate import ATP-binding
   40::163     1e-06  33%  278 aa  SSUB_BRAJA RecName: Full=Aliphatic sulfonates import ATP-binding
   15::88      1e-06  39%  245 aa  SSUB2_PARDP RecName: Full=Aliphatic sulfonates import ATP-binding
  480::662     1e-06  29%  707 aa  RTX1B_ACTPL RecName: Full=Toxin RTX-I translocation ATP-binding
    5::152     1e-06  26%  511 aa  RBSA_ROSDO RecName: Full=Ribose import ATP-binding protein rbsA;   
    5::86      1e-06  26%  362 aa  POTA_LACC3 RecName: Full=Spermidine/putrescine import ATP-binding
    4::87      1e-06  25%  353 aa  POTA_GEOKA RecName: Full=Spermidine/putrescine import ATP-binding
   21::205     1e-06  27%  345 aa  METN4_OCEIH RecName: Full=Methionine import ATP-binding protein
   13::80      1e-06  37%  654 aa  MACB_HAHCH RecName: Full=Macrolide export ATP-binding/permease
    3::210     1e-06  26%  228 aa  LOLD_IDILO RecName: Full=Lipoprotein-releasing system ATP-binding
   24::78      1e-06  40%  233 aa  LOLD_COXBU RecName: Full=Lipoprotein-releasing system ATP-binding
   19::82      1e-06  38%  234 aa  LOLD1_CAUCR RecName: Full=Lipoprotein-releasing system
    1::80      1e-06  42%  261 aa  HMUV_RALME RecName: Full=Hemin import ATP-binding protein hmuV;  
  355::421     1e-06  42%  583 aa  EXP8_STRPN RecName: Full=Putative ABC transporter ATP-binding
    3::80      1e-06  29%  365 aa  CYSA_SALTY RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      1e-06  29%  364 aa  CYSA_SALTI RecName: Full=Sulfate/thiosulfate import ATP-binding
   19::133     1e-06  34%  265 aa  CBIO1_MYCPU RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    5::144     1e-06  30%  508 aa  ARAG_RHIME RecName: Full=Arabinose import ATP-binding protein araG;
  601::658     1e-06  36%  836 aa  ABCB6_RAT RecName: Full=ATP-binding cassette sub-family B member 6,
  601::658     1e-06  36%  842 aa  ABCB6_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  601::658     1e-06  36%  842 aa  ABCB6_HUMAN RecName: Full=ATP-binding cassette sub-family B member
    3::61      2e-06  39%  249 aa  ZNUC_SILST RecName: Full=Zinc import ATP-binding protein znuC;   
    2::61      2e-06  43%  262 aa  ZNUC_MAGSA RecName: Full=Zinc import ATP-binding protein znuC;   
   20::70      2e-06  43%  230 aa  YKNY_BACSU RecName: Full=Uncharacterized ABC transporter
  624::690     2e-06  33%  859 aa  Y1383_MYCBO RecName: Full=Uncharacterized ABC transporter
  624::690     2e-06  33%  859 aa  Y1348_MYCTU RecName: Full=Uncharacterized ABC transporter
   17::89      2e-06  39%  780 aa  Y043_BIFLO RecName: Full=Putative ABC transporter ATP-binding
   19::77      2e-06  44%  236 aa  THIQ_ERWCT RecName: Full=Thiamine import ATP-binding protein
   20::116     2e-06  30%  514 aa  RGMG3_BURCH RecName: Full=Putative ribose/galactose/methyl
   20::116     2e-06  30%  514 aa  RGMG3_BURCA RecName: Full=Putative ribose/galactose/methyl
   17::163     2e-06  29%  513 aa  RGMG2_AGRT5 RecName: Full=Putative ribose/galactose/methyl
    4::153     2e-06  34%  253 aa  PSTB1_STRPC RecName: Full=Phosphate import ATP-binding protein pstB
    4::153     2e-06  34%  253 aa  PSTB1_STRPB RecName: Full=Phosphate import ATP-binding protein pstB
   17::228     2e-06  26%  337 aa  OPPD_ECOLI RecName: Full=Oligopeptide transport ATP-binding protein
  355::407     2e-06  40%  582 aa  MSBA_SODGM RecName: Full=Lipid A export ATP-binding/permease
   21::73      2e-06  45%  344 aa  METN_BURTA RecName: Full=Methionine import ATP-binding protein
    4::80      2e-06  38%  655 aa  MACB_RHOPB RecName: Full=Macrolide export ATP-binding/permease
    4::82      2e-06  40%  654 aa  MACB_RHOP2 RecName: Full=Macrolide export ATP-binding/permease
   15::78      2e-06  36%  644 aa  MACB_ALCBS RecName: Full=Macrolide export ATP-binding/permease
   30::91      2e-06  46%  239 aa  LOLD_XANCP RecName: Full=Lipoprotein-releasing system ATP-binding
   30::91      2e-06  46%  239 aa  LOLD_XANC8 RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_SHISS RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_SHIBS RecName: Full=Lipoprotein-releasing system ATP-binding
    3::57      2e-06  47%  225 aa  LOLD_NITMU RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_ECOUT RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_ECOLI RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_ECOL6 RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_ECOL5 RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  40%  233 aa  LOLD_ECO57 RecName: Full=Lipoprotein-releasing system ATP-binding
    8::78      2e-06  37%  220 aa  LOLD_BDEBA RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      2e-06  42%  226 aa  LOLD1_RHOPA RecName: Full=Lipoprotein-releasing system
    3::80      2e-06  29%  365 aa  CYSA_SHIFL RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      2e-06  31%  362 aa  CYSA_PHOLL RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      2e-06  29%  365 aa  CYSA_ECOLI RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      2e-06  29%  365 aa  CYSA_ECOL6 RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      2e-06  29%  365 aa  CYSA_ECO57 RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::65      2e-06  32%  292 aa  YTRB_BACSU RecName: Full=ABC transporter ATP-binding protein
    7::77      2e-06  32%  225 aa  YBBL_ECOLI RecName: Full=Uncharacterized ABC transporter
   21::80      2e-06  44%  566 aa  Y149_LACPL RecName: Full=Putative ABC transporter ATP-binding
    5::90      2e-06  33%  514 aa  XYLG_RALSO RecName: Full=Xylose import ATP-binding protein xylG; 
    2::84      2e-06  30%  647 aa  UUP1_HAEIN RecName: Full=ABC transporter ATP-binding protein
 1593::1649    2e-06  35% 1825 aa  TAGD_DICDI RecName: Full=Serine protease/ABC transporter tagD;       
   37::101     2e-06  35%  527 aa  RGMG2_BURS3 RecName: Full=Putative ribose/galactose/methyl
    1::81      2e-06  31%  463 aa  POTA_BACTN RecName: Full=Spermidine/putrescine import ATP-binding
   29::209     2e-06  29%  320 aa  NODI_AZOC5 RecName: Full=Nod factor export ATP-binding protein I;  
  355::409     2e-06  38%  582 aa  MSBA_VIBPA RecName: Full=Lipid A export ATP-binding/permease
    7::203     2e-06  27%  350 aa  METN_LACC3 RecName: Full=Methionine import ATP-binding protein
  449::529     2e-06  32%  695 aa  MDL1_YEAST RecName: Full=ATP-dependent permease MDL1,
    1::76      2e-06  38%  650 aa  MACB_BDEBA RecName: Full=Macrolide export ATP-binding/permease
   17::207     2e-06  25%  240 aa  LOLD2_PELLD RecName: Full=Lipoprotein-releasing system ATP-binding
    2::87      2e-06  26%  348 aa  FBPC_ECOLI RecName: Full=Fe(3+) ions import ATP-binding protein
    3::67      2e-06  34%  329 aa  CYSA_PSEAE RecName: Full=Sulfate/thiosulfate import ATP-binding
   20::90      2e-06  38%  278 aa  CBIO1_BACHD RecName: Full=Cobalt import ATP-binding protein cbiO
   29::125     2e-06  30%  520 aa  ARAG_AZOBR RecName: Full=Arabinose import ATP-binding protein araG;
   20::68      2e-06  49%  503 aa  ARAG1_BURS3 RecName: Full=Arabinose import ATP-binding protein
  434::490     2e-06  40% 1321 aa  ABCBB_HUMAN RecName: Full=Bile salt export pump;AltName:
 1187::1274    2e-06  36% 1427 aa  ABC1_SCHPO RecName: Full=ATP-binding cassette transporter abc1;
   21::71      3e-06  39%  246 aa  ZNUC_WOLTR RecName: Full=Zinc import ATP-binding protein znuC;   
    3::62      3e-06  38%  261 aa  ZNUC_PSEPF RecName: Full=Zinc import ATP-binding protein znuC;   
    3::52      3e-06  38%  257 aa  ZNUC_PHOLL RecName: Full=Zinc import ATP-binding protein znuC;   
    2::55      3e-06  41%  244 aa  ZNUC2_HAHCH RecName: Full=Zinc import ATP-binding protein znuC 2;
    1::51      3e-06  49%  229 aa  YVRO_BACSU RecName: Full=Uncharacterized ABC transporter
    3::66      3e-06  36%  308 aa  YDBJ_BACSU RecName: Full=Uncharacterized ABC transporter
    9::84      3e-06  32%  347 aa  UGPC1_RHIEC RecName: Full=sn-glycerol-3-phosphate import
   16::58      3e-06  44%  266 aa  TROB_TREPA RecName: Full=Zinc transport system ATP-binding
   12::71      3e-06  40%  243 aa  SSUB_CORGL RecName: Full=Aliphatic sulfonates import ATP-binding
   17::88      3e-06  35%  259 aa  SSUB2_AGRT5 RecName: Full=Aliphatic sulfonates import ATP-binding
    4::87      3e-06  26%  349 aa  POTA_CLOPS RecName: Full=Spermidine/putrescine import ATP-binding
    4::87      3e-06  26%  349 aa  POTA_CLOPE RecName: Full=Spermidine/putrescine import ATP-binding
    4::87      3e-06  26%  349 aa  POTA_CLOP1 RecName: Full=Spermidine/putrescine import ATP-binding
   22::96      3e-06  31%  383 aa  POTA_ACIC1 RecName: Full=Spermidine/putrescine import ATP-binding
  351::403     3e-06  40%  588 aa  NDVA_RHIRD RecName: Full=Beta-(1-->2)glucan export
  351::403     3e-06  40%  588 aa  NDVA_AGRT5 RecName: Full=Beta-(1-->2)glucan export
  361::552     3e-06  27%  592 aa  MSBA_RALSO RecName: Full=Lipid A export ATP-binding/permease
  348::411     3e-06  34%  585 aa  MSBA_HAHCH RecName: Full=Lipid A export ATP-binding/permease
   17::89      3e-06  38%  321 aa  METN_THEFY RecName: Full=Methionine import ATP-binding protein
   27::76      3e-06  44%  668 aa  MACB1_PARDP RecName: Full=Macrolide export ATP-binding/permease
   21::83      3e-06  44%  226 aa  LOLD_THIDA RecName: Full=Lipoprotein-releasing system ATP-binding
    2::83      3e-06  35%  230 aa  LOLD_SHEON RecName: Full=Lipoprotein-releasing system ATP-binding
    5::83      3e-06  37%  227 aa  LOLD_ROSDO RecName: Full=Lipoprotein-releasing system ATP-binding
    5::82      3e-06  40%  227 aa  LOLD_PSEPF RecName: Full=Lipoprotein-releasing system ATP-binding
    1::113     3e-06  29%  218 aa  LOLD_BACTN RecName: Full=Lipoprotein-releasing system ATP-binding
   10::97      3e-06  30%  264 aa  HMUV_PHOLL RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::76      3e-06  36%  262 aa  HMUV_BORPA RecName: Full=Hemin import ATP-binding protein hmuV;  
  336::528     3e-06  26%  623 aa  GSIA_ECOUT RecName: Full=Glutathione import ATP-binding protein
  336::528     3e-06  26%  623 aa  GSIA_ECOL5 RecName: Full=Glutathione import ATP-binding protein
    3::206     3e-06  27%  308 aa  DDPF_ECOLI RecName: Full=Probable D,D-dipeptide transport
    3::74      3e-06  36%  343 aa  CYSA_XANAC RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      3e-06  32%  351 aa  CYSA_BURPS RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      3e-06  32%  351 aa  CYSA_BURMA RecName: Full=Sulfate/thiosulfate import ATP-binding
  492::560     3e-06  42%  698 aa  CVAB_ECOLX RecName: Full=Colicin V secretion/processing ATP-binding
  478::666     3e-06  23%  734 aa  ATM1_CRYNE RecName: Full=Iron-sulfur clusters transporter ATM1,
   20::66      3e-06  51%  503 aa  ARAG_BURPS RecName: Full=Arabinose import ATP-binding protein
   20::66      3e-06  51%  503 aa  ARAG_BURP1 RecName: Full=Arabinose import ATP-binding protein
    6::53      3e-06  42%  510 aa  ALSA_ECOLI RecName: Full=D-allose import ATP-binding protein
  471::528     3e-06  34%  715 aa  ABCBA_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  472::651     3e-06  25%  718 aa  ABCB8_PONAB RecName: Full=ATP-binding cassette sub-family B member
  409::458     3e-06  40%  678 aa  AB2F_ARATH RecName: Full=ABC transporter F family member 2;        
    2::51      4e-06  38%  255 aa  ZNUC_ROSDO RecName: Full=Zinc import ATP-binding protein znuC;   
   17::63      4e-06  40%  254 aa  ZNUC_PARDP RecName: Full=Zinc import ATP-binding protein znuC;   
  201::376     4e-06  31%  437 aa  Y753_CLOTE RecName: Full=Putative ABC transporter ATP-binding
   16::137     4e-06  30%  244 aa  Y289_GLOVI RecName: Full=Putative ABC transporter ATP-binding
  347::473     4e-06  28%  579 aa  Y1384_MYCBO RecName: Full=Uncharacterized ABC transporter
   20::67      4e-06  46%  279 aa  Y1368_CLOAB RecName: Full=Putative ABC transporter ATP-binding
  347::473     4e-06  28%  579 aa  Y1349_MYCTU RecName: Full=Uncharacterized ABC transporter
  348::407     4e-06  37%  582 aa  Y1304_MYCBO RecName: Full=Uncharacterized ABC transporter
  348::407     4e-06  37%  582 aa  Y1273_MYCTU RecName: Full=Uncharacterized ABC transporter
   16::75      4e-06  38%  344 aa  WTPC_PYRAB RecName: Full=Molybdate/tungstate import ATP-binding
    4::85      4e-06  32%  356 aa  UGPC_SHISS RecName: Full=sn-glycerol-3-phosphate import
    4::85      4e-06  32%  356 aa  UGPC_SHIBS RecName: Full=sn-glycerol-3-phosphate import
   23::85      4e-06  35%  364 aa  UGPC_RHOP2 RecName: Full=sn-glycerol-3-phosphate import
    4::85      4e-06  32%  356 aa  UGPC_ECOLI RecName: Full=sn-glycerol-3-phosphate import
   17::109     4e-06  35%  370 aa  UGPC_CHRVO RecName: Full=sn-glycerol-3-phosphate import ATP-binding
    1::77      4e-06  36%  236 aa  THIQ_YERPN RecName: Full=Thiamine import ATP-binding protein
    1::77      4e-06  36%  236 aa  THIQ_YERPE RecName: Full=Thiamine import ATP-binding protein
    1::77      4e-06  36%  236 aa  THIQ_YERPA RecName: Full=Thiamine import ATP-binding protein
    1::49      4e-06  37%  255 aa  TAUB_YERPS RecName: Full=Taurine import ATP-binding protein tauB;
    1::49      4e-06  37%  255 aa  TAUB_YERPN RecName: Full=Taurine import ATP-binding protein tauB;
    1::49      4e-06  37%  255 aa  TAUB_YERPE RecName: Full=Taurine import ATP-binding protein tauB;
    1::49      4e-06  37%  255 aa  TAUB_YERPA RecName: Full=Taurine import ATP-binding protein tauB;
   17::163     4e-06  28%  513 aa  RGMG2_RHIEC RecName: Full=Putative ribose/galactose/methyl
    4::87      4e-06  31%  501 aa  RBSA_VIBVU RecName: Full=Ribose import ATP-binding protein rbsA; 
    3::96      4e-06  38%  257 aa  PSTB_TROWT RecName: Full=Phosphate import ATP-binding protein
   51::212     4e-06  32%  313 aa  PSTB2_HALMA RecName: Full=Phosphate import ATP-binding protein pstB
    4::85      4e-06  26%  364 aa  POTA_STAES RecName: Full=Spermidine/putrescine import ATP-binding
    7::93      4e-06  35%  277 aa  PHNC2_PSEU2 RecName: Full=Phosphonates import ATP-binding protein
    7::93      4e-06  35%  277 aa  PHNC2_PSE14 RecName: Full=Phosphonates import ATP-binding protein
    1::137     4e-06  33%  267 aa  PHNC2_NATPD RecName: Full=Phosphonates import ATP-binding protein
  152::230     4e-06  32% 1444 aa  PDR7_ORYSJ RecName: Full=Putative pleiotropic drug resistance
    9::75      4e-06  39%  250 aa  MNTB_BACSU RecName: Full=Manganese transport system ATP-binding
   10::204     4e-06  30%  335 aa  METN_XANC5 RecName: Full=Methionine import ATP-binding protein
   17::205     4e-06  33%  332 aa  METN_SYMTH RecName: Full=Methionine import ATP-binding protein
    1::90      4e-06  35%  350 aa  METN_RALSO RecName: Full=Methionine import ATP-binding protein
   22::204     4e-06  30%  334 aa  METN_NOCFA RecName: Full=Methionine import ATP-binding protein
    1::201     4e-06  27%  320 aa  METN_CLOAB RecName: Full=Methionine import ATP-binding protein
    2::134     4e-06  28%  369 aa  MALK_PHOLL RecName: Full=Maltose/maltodextrin import ATP-binding
    4::84      4e-06  31%  372 aa  MALK_MANSM RecName: Full=Maltose/maltodextrin import ATP-binding
   12::145     4e-06  34%  648 aa  MACB_SALCH RecName: Full=Macrolide export ATP-binding/permease
    3::113     4e-06  35%  648 aa  MACB_AGRT5 RecName: Full=Macrolide export ATP-binding/permease
    3::82      4e-06  42%  640 aa  MACB3_PARDP RecName: Full=Macrolide export ATP-binding/permease
   49::98      4e-06  48%  271 aa  LOLD_SALRD RecName: Full=Lipoprotein-releasing system ATP-binding
   18::206     4e-06  28%  221 aa  HRTA_STAHJ RecName: Full=Putative hemin import ATP-binding protein
    5::65      4e-06  39%  268 aa  HMUV_RHOPA RecName: Full=Hemin import ATP-binding protein hmuV;  
   13::92      4e-06  35%  270 aa  HMUV_RHOP5 RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::74      4e-06  34%  275 aa  HMUV_GLOVI RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::76      4e-06  36%  262 aa  HMUV_BORBR RecName: Full=Hemin import ATP-binding protein hmuV;  
  306::528     4e-06  27%  623 aa  GSIA_SALPA RecName: Full=Glutathione import ATP-binding protein
  336::528     4e-06  28%  623 aa  GSIA_ECO57 RecName: Full=Glutathione import ATP-binding protein
    3::86      4e-06  26%  348 aa  FBPC_ACTPL RecName: Full=Fe(3+) ions import ATP-binding protein
    3::69      4e-06  31%  363 aa  CYSA_YERPS RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::69      4e-06  31%  363 aa  CYSA_YERPE RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      4e-06  31%  264 aa  CYSA_BURCE RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::87      4e-06  40%  311 aa  CBIO_METTH RecName: Full=Putative cobalt import ATP-binding
   20::197     4e-06  31%  276 aa  CBIO2_STRTD RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    3::52      5e-06  38%  262 aa  ZNUC_VIBPA RecName: Full=Zinc import ATP-binding protein znuC;   
    7::76      5e-06  37%  269 aa  YRBF_ECOLI RecName: Full=Uncharacterized ABC transporter
    7::76      5e-06  37%  269 aa  YRBF_ECOL6 RecName: Full=Uncharacterized ABC transporter
    7::76      5e-06  37%  269 aa  YRBF_ECO57 RecName: Full=Uncharacterized ABC transporter
  295::375     5e-06  35%  560 aa  Y483_STRPN RecName: Full=Putative ABC transporter ATP-binding
  271::341     5e-06  32%  489 aa  Y282_TREDE RecName: Full=Putative ABC transporter ATP-binding
  295::372     5e-06  35%  566 aa  Y2641_BACAN RecName: Full=Putative ABC transporter ATP-binding
   16::54      5e-06  49%  558 aa  Y1680_STRA3 RecName: Full=Putative ABC transporter ATP-binding
   16::54      5e-06  49%  558 aa  Y1633_STRA5 RecName: Full=Putative ABC transporter ATP-binding
    4::85      5e-06  32%  356 aa  UGPC_ECO57 RecName: Full=sn-glycerol-3-phosphate import
  481::535     5e-06  35%  702 aa  TAP2_MOUSE RecName: Full=Antigen peptide transporter 2;       
    4::87      5e-06  31%  501 aa  RBSA_VIBVY RecName: Full=Ribose import ATP-binding protein rbsA; 
    7::153     5e-06  33%  253 aa  PSTB_METTH RecName: Full=Phosphate import ATP-binding protein pstB;
    3::152     5e-06  34%  252 aa  PSTB1_STRP6 RecName: Full=Phosphate import ATP-binding protein pstB
    4::121     5e-06  26%  444 aa  POTA_MYCHJ RecName: Full=Spermidine/putrescine import ATP-binding
    4::121     5e-06  26%  444 aa  POTA_MYCH7 RecName: Full=Spermidine/putrescine import ATP-binding
    4::121     5e-06  26%  444 aa  POTA_MYCH2 RecName: Full=Spermidine/putrescine import ATP-binding
   10::91      5e-06  28%  372 aa  POTA_HAES1 RecName: Full=Spermidine/putrescine import ATP-binding
    3::86      5e-06  26%  348 aa  POTA_DESHY RecName: Full=Spermidine/putrescine import ATP-binding
   25::113     5e-06  42%  257 aa  PHNC_LACC3 RecName: Full=Phosphonates import ATP-binding protein
    3::95      5e-06  29%  262 aa  PHNC_ECO57 RecName: Full=Phosphonates import ATP-binding protein
    2::71      5e-06  33%  277 aa  PHNC2_PSESM RecName: Full=Phosphonates import ATP-binding protein
  344::413     5e-06  35%  604 aa  NDVA_RHOPB RecName: Full=Beta-(1-->2)glucan export
  344::413     5e-06  36%  593 aa  NDVA_NITHX RecName: Full=Beta-(1-->2)glucan export
  355::409     5e-06  36%  582 aa  MSBA_YERPS RecName: Full=Lipid A export ATP-binding/permease
  355::409     5e-06  36%  582 aa  MSBA_YERPN RecName: Full=Lipid A export ATP-binding/permease
  355::409     5e-06  36%  582 aa  MSBA_YERPE RecName: Full=Lipid A export ATP-binding/permease
  355::409     5e-06  36%  582 aa  MSBA_YERPA RecName: Full=Lipid A export ATP-binding/permease
   13::140     5e-06  30%  506 aa  MGLA_HAEIN RecName: Full=Galactose/methyl galactoside import
   13::140     5e-06  30%  506 aa  MGLA_HAEI8 RecName: Full=Galactose/methyl galactoside import
    6::71      5e-06  35%  515 aa  MGLA_CLOPS RecName: Full=Galactose/methyl galactoside import
    6::71      5e-06  35%  515 aa  MGLA_CLOPE RecName: Full=Galactose/methyl galactoside import
    6::71      5e-06  35%  515 aa  MGLA_CLOP1 RecName: Full=Galactose/methyl galactoside import
   21::204     5e-06  29%  335 aa  METN_XANCP RecName: Full=Methionine import ATP-binding protein
   21::204     5e-06  29%  335 aa  METN_XANC8 RecName: Full=Methionine import ATP-binding protein
   10::204     5e-06  30%  335 aa  METN_XANAC RecName: Full=Methionine import ATP-binding protein
   17::89      5e-06  38%  335 aa  METN2_PSESM RecName: Full=Methionine import ATP-binding protein
   21::73      5e-06  45%  344 aa  METN1_BURPS RecName: Full=Methionine import ATP-binding protein
   21::73      5e-06  45%  344 aa  METN1_BURP1 RecName: Full=Methionine import ATP-binding protein
   21::73      5e-06  45%  344 aa  METN1_BURMA RecName: Full=Methionine import ATP-binding protein
    4::193     5e-06  27%  371 aa  MALK_VIBVY RecName: Full=Maltose/maltodextrin import ATP-binding
    4::193     5e-06  27%  371 aa  MALK_VIBVU RecName: Full=Maltose/maltodextrin import ATP-binding
   23::94      5e-06  32%  665 aa  MACB_PSYA2 RecName: Full=Macrolide export ATP-binding/permease
   13::113     5e-06  36%  655 aa  MACB_BORA1 RecName: Full=Macrolide export ATP-binding/permease
   22::78      5e-06  40%  641 aa  MACB_AZOSE RecName: Full=Macrolide export ATP-binding/permease
   24::86      5e-06  35%  233 aa  LOLD_SHEDO RecName: Full=Lipoprotein-releasing system ATP-binding
   24::206     5e-06  27%  228 aa  LOLD_RHIME RecName: Full=Lipoprotein-releasing system ATP-binding
    1::214     5e-06  34%  233 aa  LOLD_DESVH RecName: Full=Lipoprotein-releasing system ATP-binding
   28::86      5e-06  37%  277 aa  HMUV_PHOPR RecName: Full=Hemin import ATP-binding protein hmuV;  
  336::528     5e-06  28%  623 aa  GSIA_SHISS RecName: Full=Glutathione import ATP-binding protein
  336::528     5e-06  28%  623 aa  GSIA_SHIFL RecName: Full=Glutathione import ATP-binding protein
  336::528     5e-06  28%  623 aa  GSIA_SHIF8 RecName: Full=Glutathione import ATP-binding protein
  306::528     5e-06  27%  623 aa  GSIA_SALTY RecName: Full=Glutathione import ATP-binding protein
  306::528     5e-06  27%  623 aa  GSIA_SALTI RecName: Full=Glutathione import ATP-binding protein
  306::528     5e-06  27%  623 aa  GSIA_SALCH RecName: Full=Glutathione import ATP-binding protein
  336::528     5e-06  28%  623 aa  GSIA_ECOLI RecName: Full=Glutathione import ATP-binding protein
  336::528     5e-06  28%  623 aa  GSIA_ECOL6 RecName: Full=Glutathione import ATP-binding protein
  336::528     5e-06  26%  623 aa  GSIA_ECOK1 RecName: Full=Glutathione import ATP-binding protein
    3::138     5e-06  25%  349 aa  FBPC_HAES1 RecName: Full=Fe(3+) ions import ATP-binding protein
    5::130     5e-06  31%  346 aa  FBPC3_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein
   16::196     5e-06  26%  346 aa  CYSA_RHILO RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::67      5e-06  32%  326 aa  CYSA_PSESM RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::86      5e-06  35%  205 aa  CCMA_VIBVY RecName: Full=Cytochrome c biogenesis ATP-binding
    2::144     5e-06  30%  282 aa  CBIO1_LACJO RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  320::378     6e-06  36%  530 aa  YBIT_ECOLI RecName: Full=Uncharacterized ABC transporter
  320::378     6e-06  36%  530 aa  YBIT_ECOL6 RecName: Full=Uncharacterized ABC transporter
  320::378     6e-06  36%  530 aa  YBIT_ECO57 RecName: Full=Uncharacterized ABC transporter
  289::341     6e-06  43%  527 aa  Y804_OCEIH RecName: Full=Putative ABC transporter ATP-binding
  295::383     6e-06  34%  566 aa  Y2424_BACHK RecName: Full=Putative ABC transporter ATP-binding
    3::65      6e-06  35%  240 aa  Y124_THEMA RecName: Full=Probable metal transport system
    4::73      6e-06  34%  264 aa  Y1087_HAEIN RecName: Full=Uncharacterized ABC transporter
   29::72      6e-06  48%  297 aa  WTPC_METJA RecName: Full=Molybdate/tungstate import ATP-binding
   20::85      6e-06  32%  353 aa  UGPC3_AGRT5 RecName: Full=sn-glycerol-3-phosphate import
   15::77      6e-06  43%  234 aa  THIQ_VIBVY RecName: Full=Thiamine import ATP-binding protein
   15::77      6e-06  43%  234 aa  THIQ_VIBVU RecName: Full=Thiamine import ATP-binding protein
    2::75      6e-06  36%  261 aa  TAUB_PSESM RecName: Full=Taurine import ATP-binding protein tauB;
    4::153     6e-06  34%  253 aa  PSTB1_STRPM RecName: Full=Phosphate import ATP-binding protein pstB
    4::153     6e-06  34%  253 aa  PSTB1_STRPF RecName: Full=Phosphate import ATP-binding protein pstB
    4::153     6e-06  34%  253 aa  PSTB1_STRPD RecName: Full=Phosphate import ATP-binding protein pstB
    3::152     6e-06  34%  252 aa  PSTB1_STRP8 RecName: Full=Phosphate import ATP-binding protein pstB
    3::152     6e-06  34%  252 aa  PSTB1_STRP3 RecName: Full=Phosphate import ATP-binding protein pstB
    3::152     6e-06  34%  252 aa  PSTB1_STRP1 RecName: Full=Phosphate import ATP-binding protein pstB
   42::110     6e-06  32%  384 aa  POTA_THEFY RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      6e-06  36%  384 aa  POTA_STRTD RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      6e-06  36%  384 aa  POTA_STRT2 RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      6e-06  36%  384 aa  POTA_STRT1 RecName: Full=Spermidine/putrescine import ATP-binding
   19::88      6e-06  35%  428 aa  POTA_LACLA RecName: Full=Spermidine/putrescine import ATP-binding
    3::87      6e-06  28%  352 aa  POTA_CLOTH RecName: Full=Spermidine/putrescine import ATP-binding
    1::106     6e-06  36%  254 aa  PHNC_LACJO RecName: Full=Phosphonates import ATP-binding protein
    4::111     6e-06  35%  261 aa  PHNC_LACGA RecName: Full=Phosphonates import ATP-binding protein
   25::80      6e-06  38%  659 aa  NRTC_SYNE7 RecName: Full=Nitrate transport ATP-binding protein
  354::421     6e-06  35%  601 aa  MSBA_PSEF5 RecName: Full=Lipid A export ATP-binding/permease
   10::72      6e-06  44%  335 aa  METN_XANOR RecName: Full=Methionine import ATP-binding protein
   10::72      6e-06  44%  335 aa  METN_XANOM RecName: Full=Methionine import ATP-binding protein
   35::103     6e-06  46%  362 aa  METN_RHIL3 RecName: Full=Methionine import ATP-binding protein
    1::72      6e-06  33%  336 aa  METN_CAMJR RecName: Full=Methionine import ATP-binding protein
    1::72      6e-06  33%  336 aa  METN_CAMJE RecName: Full=Methionine import ATP-binding protein
   17::89      6e-06  38%  335 aa  METN1_PSEU2 RecName: Full=Methionine import ATP-binding protein
    4::84      6e-06  30%  369 aa  MALK_YERPS RecName: Full=Maltose/maltodextrin import ATP-binding
    4::84      6e-06  30%  369 aa  MALK_YERPN RecName: Full=Maltose/maltodextrin import ATP-binding
    4::84      6e-06  30%  369 aa  MALK_YERPE RecName: Full=Maltose/maltodextrin import ATP-binding
    4::84      6e-06  30%  369 aa  MALK_YERPA RecName: Full=Maltose/maltodextrin import ATP-binding
    4::123     6e-06  28%  369 aa  MALK_PHOPR RecName: Full=Maltose/maltodextrin import ATP-binding
   30::88      6e-06  42%  241 aa  LPTB_THIFE RecName: Full=Lipopolysaccharide export system
   21::83      6e-06  35%  238 aa  LOLD_VIBF1 RecName: Full=Lipoprotein-releasing system ATP-binding
    4::86      6e-06  34%  239 aa  LOLD_SHEFN RecName: Full=Lipoprotein-releasing system ATP-binding
    5::82      6e-06  39%  227 aa  LOLD_PSEAE RecName: Full=Lipoprotein-releasing system ATP-binding
    1::86      6e-06  40%  230 aa  LOLD_BORA1 RecName: Full=Lipoprotein-releasing system ATP-binding
    1::87      6e-06  30%  216 aa  LOLD_BACFN RecName: Full=Lipoprotein-releasing system ATP-binding
   14::86      6e-06  43%  236 aa  LOLD_ALHEH RecName: Full=Lipoprotein-releasing system ATP-binding
   13::82      6e-06  37%  226 aa  LOLD1_RHORT RecName: Full=Lipoprotein-releasing system
  360::543     6e-06  26%  590 aa  LMRA_LACLM RecName: Full=Multidrug resistance ABC transporter
    4::85      6e-06  32%  266 aa  HMUV_YEREN RecName: Full=Hemin import ATP-binding protein hmuV;  
   40::114     6e-06  35%  280 aa  HMUV_STRCO RecName: Full=Hemin import ATP-binding protein hmuV;    
  336::528     6e-06  28%  623 aa  GSIA_SHIDS RecName: Full=Glutathione import ATP-binding protein
    3::87      6e-06  24%  351 aa  FBPC_VIBCH RecName: Full=Fe(3+) ions import ATP-binding protein
    2::87      6e-06  24%  348 aa  FBPC_ECO57 RecName: Full=Fe(3+) ions import ATP-binding protein
   42::98      6e-06  40%  282 aa  CMPD_SYNY3 RecName: Full=Bicarbonate transport ATP-binding
  450::513     6e-06  31%  696 aa  ATM1_DEBHA RecName: Full=Iron-sulfur clusters transporter ATM1,
  357::420     6e-06  33%  603 aa  ATM1_CHAGB RecName: Full=Iron-sulfur clusters transporter ATM1,
   20::68      6e-06  43%  516 aa  ARAG_BURXL RecName: Full=Arabinose import ATP-binding protein
   31::127     6e-06  30%  522 aa  ARAG2_BURS3 RecName: Full=Arabinose import ATP-binding protein araG
   24::120     6e-06  30%  515 aa  ARAG2_BURCH RecName: Full=Arabinose import ATP-binding protein araG
   24::120     6e-06  30%  515 aa  ARAG2_BURCA RecName: Full=Arabinose import ATP-binding protein araG
  489::668     6e-06  25%  735 aa  ABCB8_HUMAN RecName: Full=ATP-binding cassette sub-family B member
    3::62      8e-06  37%  261 aa  ZNUC_PSEF5 RecName: Full=Zinc import ATP-binding protein znuC;   
    2::50      8e-06  43%  243 aa  ZNUC2_VIBF1 RecName: Full=Zinc import ATP-binding protein znuC 2;
  295::372     8e-06  35%  566 aa  Y2668_BACC1 RecName: Full=Putative ABC transporter ATP-binding
    5::68      8e-06  33%  505 aa  XYLG_THEP3 RecName: Full=Xylose import ATP-binding protein xylG; 
   19::85      8e-06  33%  348 aa  UGPC_BARQU RecName: Full=sn-glycerol-3-phosphate import
   28::86      8e-06  42%  246 aa  THIQ_MESSB RecName: Full=Thiamine import ATP-binding protein
   19::66      8e-06  48%  261 aa  TAUB_CHRVO RecName: Full=Taurine import ATP-binding protein tauB;
    1::91      8e-06  33%  255 aa  SSUB_ANAVT RecName: Full=Aliphatic sulfonates import ATP-binding
    3::78      8e-06  39%  257 aa  PSTB_TROW8 RecName: Full=Phosphate import ATP-binding protein
   43::136     8e-06  33%  290 aa  PSTB_PSEA6 RecName: Full=Phosphate import ATP-binding protein pstB;
    1::79      8e-06  25%  368 aa  POTA_LAWIP RecName: Full=Spermidine/putrescine import ATP-binding
   19::88      8e-06  35%  426 aa  POTA_LACLS RecName: Full=Spermidine/putrescine import ATP-binding
   28::132     8e-06  29%  498 aa  PHNC_ANADE RecName: Full=Phosphonates import ATP-binding protein
    2::71      8e-06  35%  254 aa  PHNC2_OCEIH RecName: Full=Phosphonates import ATP-binding protein
    1::65      8e-06  35%  240 aa  MNTB_LISIN RecName: Full=Manganese transport system ATP-binding
   21::80      8e-06  40%  343 aa  METN2_YERPS RecName: Full=Methionine import ATP-binding protein
   17::89      8e-06  38%  335 aa  METN1_PSE14 RecName: Full=Methionine import ATP-binding protein
 1046::1235    8e-06  25% 1276 aa  MDR1_CRIGR RecName: Full=Multidrug resistance protein 1;       
   23::78      8e-06  39%  234 aa  LOLD_YERPS RecName: Full=Lipoprotein-releasing system ATP-binding
   23::78      8e-06  39%  234 aa  LOLD_YERPN RecName: Full=Lipoprotein-releasing system ATP-binding
   23::78      8e-06  39%  234 aa  LOLD_YERPE RecName: Full=Lipoprotein-releasing system ATP-binding
   23::78      8e-06  39%  234 aa  LOLD_YERPA RecName: Full=Lipoprotein-releasing system ATP-binding
   35::70      8e-06  53%  244 aa  LOLD_XANOR RecName: Full=Lipoprotein-releasing system ATP-binding
   35::70      8e-06  53%  244 aa  LOLD_XANOM RecName: Full=Lipoprotein-releasing system ATP-binding
   35::70      8e-06  53%  244 aa  LOLD_XANC5 RecName: Full=Lipoprotein-releasing system ATP-binding
   35::70      8e-06  53%  244 aa  LOLD_XANAC RecName: Full=Lipoprotein-releasing system ATP-binding
   21::77      8e-06  39%  233 aa  LOLD_SHIDS RecName: Full=Lipoprotein-releasing system ATP-binding
   21::83      8e-06  35%  229 aa  LOLD_PHOPR RecName: Full=Lipoprotein-releasing system ATP-binding
   21::76      8e-06  41%  225 aa  LOLD2_RHOPB RecName: Full=Lipoprotein-releasing system
    5::87      8e-06  29%  255 aa  LIVG_SHIFL RecName: Full=High-affinity branched-chain amino acid
    5::87      8e-06  29%  255 aa  LIVG_ECOLI RecName: Full=High-affinity branched-chain amino acid
    5::87      8e-06  29%  255 aa  LIVG_ECO57 RecName: Full=High-affinity branched-chain amino acid
   16::75      8e-06  38%  255 aa  HMUV_PSEPF RecName: Full=Hemin import ATP-binding protein hmuV;  
   16::71      8e-06  39%  266 aa  HMUV_BARHE RecName: Full=Hemin import ATP-binding protein hmuV;  
    2::87      8e-06  24%  328 aa  FBPC1_HAEIN RecName: Full=Fe(3+) ions import ATP-binding protein
   18::74      8e-06  42%  343 aa  CYSA_XANCP RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      8e-06  32%  355 aa  CYSA_SYNY3 RecName: Full=Sulfate/thiosulfate import ATP-binding
   21::80      8e-06  35%  354 aa  CYSA2_SHEON RecName: Full=Sulfate/thiosulfate import ATP-binding
   20::197     8e-06  31%  276 aa  CBIO2_STRT2 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
   20::197     8e-06  31%  276 aa  CBIO2_STRT1 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    1::164     8e-06  28%  329 aa  APPF_BACSU RecName: Full=Oligopeptide transport ATP-binding protein
   20::88      1e-05  32%  245 aa  ZNUC_ANAMM RecName: Full=Zinc import ATP-binding protein znuC;   
    2::45      1e-05  43%  250 aa  YECC_ECOLI RecName: Full=Uncharacterized amino-acid ABC
    1::70      1e-05  39%  290 aa  Y873_METJA RecName: Full=Uncharacterized ABC transporter
   22::84      1e-05  37%  344 aa  UGPC2_RHIL3 RecName: Full=sn-glycerol-3-phosphate import
   20::77      1e-05  43%  232 aa  THIQ_ECOLI RecName: Full=Thiamine import ATP-binding protein
    6::86      1e-05  35%  278 aa  SSUB_RHOFD RecName: Full=Aliphatic sulfonates import ATP-binding
    3::53      1e-05  41%  237 aa  SSUB1_PSEU2 RecName: Full=Aliphatic sulfonates import ATP-binding
   17::92      1e-05  32%  513 aa  RGMG_RHIL3 RecName: Full=Putative ribose/galactose/methyl
    9::100     1e-05  29%  523 aa  RBSA2_THEMA RecName: Full=Ribose import ATP-binding protein rbsA 2;
   16::109     1e-05  32%  263 aa  PSTB_MARMM RecName: Full=Phosphate import ATP-binding protein pstB;
    6::99      1e-05  39%  252 aa  PSTB_LACDA RecName: Full=Phosphate import ATP-binding protein
    5::104     1e-05  36%  257 aa  PSTB2_CHRSD RecName: Full=Phosphate import ATP-binding protein pstB
    3::86      1e-05  25%  351 aa  POTA_MYCMS RecName: Full=Spermidine/putrescine import ATP-binding
    3::86      1e-05  25%  351 aa  POTA_MYCCT RecName: Full=Spermidine/putrescine import ATP-binding
    1::89      1e-05  30%  365 aa  POTA_LACPL RecName: Full=Spermidine/putrescine import ATP-binding
   33::93      1e-05  36%  369 aa  PHNT_SALTY RecName: Full=Putative 2-aminoethylphosphonate import
   33::93      1e-05  36%  369 aa  PHNT_SALTI RecName: Full=Putative 2-aminoethylphosphonate import
   33::93      1e-05  36%  369 aa  PHNT_SALPA RecName: Full=Putative 2-aminoethylphosphonate import
   33::93      1e-05  36%  369 aa  PHNT_SALCH RecName: Full=Putative 2-aminoethylphosphonate import
    7::90      1e-05  33%  284 aa  PHNC_RHILO RecName: Full=Phosphonates import ATP-binding protein
    8::71      1e-05  36%  264 aa  PHNC_MARMM RecName: Full=Phosphonates import ATP-binding protein
    3::95      1e-05  28%  262 aa  PHNC_ECOL5 RecName: Full=Phosphonates import ATP-binding protein
   21::94      1e-05  42%  293 aa  PHNC1_RHOFD RecName: Full=Phosphonates import ATP-binding protein
    1::63      1e-05  35%  233 aa  PHNC1_NATPD RecName: Full=Phosphonates import ATP-binding protein
   37::84      1e-05  31%  335 aa  NODI1_RHIME RecName: Full=Nod factor export ATP-binding protein
  361::416     1e-05  38%  586 aa  MSBA_SACD2 RecName: Full=Lipid A export ATP-binding/permease
  354::409     1e-05  38%  584 aa  MSBA_CHRVO RecName: Full=Lipid A export ATP-binding/permease
   13::140     1e-05  30%  506 aa  MGLA_MANSM RecName: Full=Galactose/methyl galactoside import
   27::202     1e-05  32%  340 aa  METN2_RHOSR RecName: Full=Methionine import ATP-binding protein
   51::143     1e-05  39%  374 aa  METN2_PSEF5 RecName: Full=Methionine import ATP-binding protein
 1047::1236    1e-05  25% 1276 aa  MDR2_CRIGR RecName: Full=Multidrug resistance protein 2;       
    4::84      1e-05  28%  372 aa  MALK_VIBPA RecName: Full=Maltose/maltodextrin import ATP-binding
   12::78      1e-05  33%  648 aa  MACB_SALTY RecName: Full=Macrolide export ATP-binding/permease
   12::78      1e-05  33%  648 aa  MACB_SALTI RecName: Full=Macrolide export ATP-binding/permease
   12::78      1e-05  33%  648 aa  MACB_SALPA RecName: Full=Macrolide export ATP-binding/permease
   23::94      1e-05  32%  665 aa  MACB_PSYCK RecName: Full=Macrolide export ATP-binding/permease
    1::199     1e-05  24%  641 aa  MACB_CAMJJ RecName: Full=Macrolide export ATP-binding/permease
   22::80      1e-05  37%  644 aa  MACB_ACTAC RecName: Full=Macrolide export ATP-binding/permease
    2::83      1e-05  33%  231 aa  LOLD_SHESR RecName: Full=Lipoprotein-releasing system ATP-binding
    2::83      1e-05  33%  231 aa  LOLD_SHESM RecName: Full=Lipoprotein-releasing system ATP-binding
   25::206     1e-05  27%  227 aa  LOLD_RHIL3 RecName: Full=Lipoprotein-releasing system ATP-binding
   24::208     1e-05  26%  229 aa  LOLD_MESSB RecName: Full=Lipoprotein-releasing system ATP-binding
    1::87      1e-05  30%  216 aa  LOLD_BACFR RecName: Full=Lipoprotein-releasing system ATP-binding
   18::84      1e-05  33%  363 aa  LACK_RHIRD RecName: Full=Lactose transport ATP-binding protein
  336::528     1e-05  25%  623 aa  GSIA_SHIBS RecName: Full=Glutathione import ATP-binding protein
    2::87      1e-05  24%  349 aa  FBPC_PASMU RecName: Full=Fe(3+) ions import ATP-binding protein
   19::85      1e-05  31%  371 aa  FBPC_FUSNN RecName: Full=Fe(3+) ions import ATP-binding protein
    5::130     1e-05  31%  346 aa  FBPC1_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein
    1::86      1e-05  34%  205 aa  CCMA_VIBVU RecName: Full=Cytochrome c biogenesis ATP-binding
   25::89      1e-05  37%  227 aa  CCMA_RALEH RecName: Full=Cytochrome c biogenesis ATP-binding
    6::145     1e-05  25%  502 aa  ARAG_MANSM RecName: Full=Arabinose import ATP-binding protein araG;
    5::52      1e-05  40%  238 aa  ZNUC_BUCBP RecName: Full=Zinc import ATP-binding protein znuC;   
    3::69      1e-05  38%  297 aa  YCOBA_PROFR RecName: Full=Putative ABC transporter ATP-binding
   32::220     1e-05  24%  353 aa  Y4TS_RHISN RecName: Full=Probable peptide ABC transporter
  361::414     1e-05  35%  586 aa  Y4GM_RHISN RecName: Full=Uncharacterized ABC transporter
   70::126     1e-05  40%  354 aa  Y415_SYNY3 RecName: Full=Uncharacterized ABC transporter
    1::194     1e-05  31%  232 aa  Y2317_HALSA RecName: Full=Putative ABC transporter ATP-binding
  330::402     1e-05  38%  614 aa  Y1747_METAC RecName: Full=Putative ABC transporter ATP-binding
  409::465     1e-05  39%  634 aa  Y019_MYCPN RecName: Full=Putative ABC transporter ATP-binding
    5::89      1e-05  28%  504 aa  XYLG_MOOTA RecName: Full=Xylose import ATP-binding protein xylG; 
    2::85      1e-05  30%  373 aa  UGPC_PSYIN RecName: Full=sn-glycerol-3-phosphate import
   20::194     1e-05  25%  349 aa  UGPC_JANSC RecName: Full=sn-glycerol-3-phosphate import ATP-binding
   23::85      1e-05  33%  361 aa  UGPC_BRAJA RecName: Full=sn-glycerol-3-phosphate import
   18::70      1e-05  42%  255 aa  SSUB_BACLD RecName: Full=Aliphatic sulfonates import ATP-binding
    3::53      1e-05  41%  237 aa  SSUB1_PSE14 RecName: Full=Aliphatic sulfonates import ATP-binding
   22::115     1e-05  36%  268 aa  PSTB_GLUOX RecName: Full=Phosphate import ATP-binding protein pstB;
    3::152     1e-05  29%  252 aa  PSTB1_STRMU RecName: Full=Phosphate import ATP-binding protein pstB
   20::88      1e-05  29%  384 aa  POTA_STRA5 RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      1e-05  29%  384 aa  POTA_STRA3 RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      1e-05  29%  384 aa  POTA_STRA1 RecName: Full=Spermidine/putrescine import ATP-binding
    3::95      1e-05  28%  262 aa  PHNC_SHIDS RecName: Full=Phosphonates import ATP-binding protein
   13::60      1e-05  33%  311 aa  NODI_RHILV RecName: Full=Nod factor export ATP-binding protein I;
   13::60      1e-05  33%  311 aa  NODI_RHIL3 RecName: Full=Nod factor export ATP-binding protein I;
   16::86      1e-05  31%  304 aa  NODI_BURPS RecName: Full=Nod factor export ATP-binding protein I;
   16::86      1e-05  31%  304 aa  NODI_BURP1 RecName: Full=Nod factor export ATP-binding protein I;
   16::86      1e-05  31%  304 aa  NODI_BURMA RecName: Full=Nod factor export ATP-binding protein I;
   12::55      1e-05  39%  305 aa  NODI_BRASS RecName: Full=Nod factor export ATP-binding protein I;
   12::55      1e-05  39%  306 aa  NODI_BRAJA RecName: Full=Nod factor export ATP-binding protein I;
  344::413     1e-05  35%  602 aa  NDVA_RHOP2 RecName: Full=Beta-(1-->2)glucan export
  342::409     1e-05  32%  582 aa  MSBA_VIBCH RecName: Full=Lipid A export ATP-binding/permease
  347::419     1e-05  38%  600 aa  MSBA_PSEPF RecName: Full=Lipid A export ATP-binding/permease
   38::111     1e-05  43%  365 aa  METN_RHILO RecName: Full=Methionine import ATP-binding protein
   21::73      1e-05  49%  351 aa  METN_COXBU RecName: Full=Methionine import ATP-binding protein
   13::83      1e-05  31%  656 aa  MACB_SHESA RecName: Full=Macrolide export ATP-binding/permease
   27::88      1e-05  34%  663 aa  MACB_PSEAE RecName: Full=Macrolide export ATP-binding/permease
   27::88      1e-05  34%  663 aa  MACB_PSEAB RecName: Full=Macrolide export ATP-binding/permease
   11::83      1e-05  40%  227 aa  LOLD_RHOFD RecName: Full=Lipoprotein-releasing system ATP-binding
   20::82      1e-05  37%  258 aa  LOLD_COLP3 RecName: Full=Lipoprotein-releasing system ATP-binding
   20::78      1e-05  37%  229 aa  LOLD1_RHOBA RecName: Full=Lipoprotein-releasing system
  360::543     1e-05  25%  590 aa  LMRA_LACLA RecName: Full=Multidrug resistance ABC transporter
    2::74      1e-05  34%  341 aa  HTXD_PSEST RecName: Full=Hypophosphite import ATP-binding protein
   10::59      1e-05  40%  266 aa  HMUV_YERPS RecName: Full=Hemin import ATP-binding protein hmuV;  
   10::59      1e-05  40%  266 aa  HMUV_YERPN RecName: Full=Hemin import ATP-binding protein hmuV;  
   10::59      1e-05  40%  266 aa  HMUV_YERPE RecName: Full=Hemin import ATP-binding protein hmuV;  
   10::59      1e-05  40%  266 aa  HMUV_YERPA RecName: Full=Hemin import ATP-binding protein hmuV;  
    2::89      1e-05  26%  353 aa  FBPC_RHIEC RecName: Full=Fe(3+) ions import ATP-binding protein
   13::77      1e-05  42%  330 aa  DRRA_STRPE RecName: Full=Daunorubicin resistance ATP-binding
    3::74      1e-05  33%  348 aa  CYSA_XYLFT RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      1e-05  31%  336 aa  CYSA_THEEB RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::68      1e-05  32%  233 aa  BRAG_PSEAE RecName: Full=High-affinity branched-chain amino acid
  471::530     1e-05  37%  720 aa  ATM1_KLULA RecName: Full=Iron-sulfur clusters transporter ATM1,
  445::633     1e-05  21%  701 aa  ATM1_EMENI RecName: Full=Iron-sulfur clusters transporter atm1,
  519::571     1e-05  32%  766 aa  ABCB9_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  487::672     1e-05  27%  714 aa  ABCB8_DANRE RecName: Full=ATP-binding cassette sub-family B member
    2::52      2e-05  31%  232 aa  ZNUC_WIGBR RecName: Full=Zinc import ATP-binding protein znuC;   
    2::51      2e-05  40%  243 aa  ZNUC_RHOS4 RecName: Full=Zinc import ATP-binding protein znuC;   
    7::55      2e-05  37%  243 aa  ZNUC_PSYCK RecName: Full=Zinc import ATP-binding protein znuC;   
   15::197     2e-05  28%  260 aa  ZNUC_HALHL RecName: Full=Zinc import ATP-binding protein znuC;     
   10::58      2e-05  39%  259 aa  ZNUC_ACIAD RecName: Full=Zinc import ATP-binding protein znuC;   
   21::87      2e-05  45%  280 aa  YCOBB_RHOCA RecName: Full=Putative ABC transporter ATP-binding
  369::418     2e-05  38%  598 aa  Y288_THEMA RecName: Full=Uncharacterized ABC transporter
   19::194     2e-05  26%  348 aa  UGPC_BARHE RecName: Full=sn-glycerol-3-phosphate import ATP-binding
   19::77      2e-05  41%  235 aa  THIQ_PHOLL RecName: Full=Thiamine import ATP-binding protein
  482::534     2e-05  34%  703 aa  TAP2_RAT RecName: Full=Antigen peptide transporter 2;       
  482::535     2e-05  35%  686 aa  TAP2_HUMAN RecName: Full=Antigen peptide transporter 2;       
   14::76      2e-05  38%  284 aa  SSUB_RALSO RecName: Full=Aliphatic sulfonates import ATP-binding
   17::73      2e-05  35%  291 aa  SSUB2_XANAC RecName: Full=Aliphatic sulfonates import ATP-binding
   12::75      2e-05  34%  505 aa  RBSA_CLOTE RecName: Full=Ribose import ATP-binding protein rbsA; 
    5::88      2e-05  32%  347 aa  POTA_BORGA RecName: Full=Spermidine/putrescine import ATP-binding
    3::95      2e-05  28%  262 aa  PHNC_ECOUT RecName: Full=Phosphonates import ATP-binding protein
    3::95      2e-05  28%  262 aa  PHNC_ECOLI RecName: Full=Phosphonates import ATP-binding protein
    3::95      2e-05  28%  262 aa  PHNC_ECOL6 RecName: Full=Phosphonates import ATP-binding protein
    5::71      2e-05  35%  284 aa  PHNC1_RALME RecName: Full=Phosphonates import ATP-binding protein
  171::248     2e-05  26% 1447 aa  PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein
  353::420     2e-05  35%  600 aa  MSBA_PSEU2 RecName: Full=Lipid A export ATP-binding/permease
  356::557     2e-05  24%  603 aa  MSBA_PSEAE RecName: Full=Lipid A export ATP-binding/permease
  352::407     2e-05  36%  582 aa  MSBA_IDILO RecName: Full=Lipid A export ATP-binding/permease
  424::463     2e-05  48% 1325 aa  MRP4_HUMAN RecName: Full=Multidrug resistance-associated protein
    1::72      2e-05  38%  344 aa  METN_RALEJ RecName: Full=Methionine import ATP-binding protein
    1::69      2e-05  35%  341 aa  METN_LEGPL RecName: Full=Methionine import ATP-binding protein
    1::89      2e-05  39%  347 aa  METN_CHRSD RecName: Full=Methionine import ATP-binding protein
    5::90      2e-05  37%  344 aa  METN_BARHE RecName: Full=Methionine import ATP-binding protein
   21::91      2e-05  44%  339 aa  METN2_BACCR RecName: Full=Methionine import ATP-binding protein
   21::91      2e-05  44%  339 aa  METN2_BACAN RecName: Full=Methionine import ATP-binding protein
   21::72      2e-05  40%  344 aa  METN1_BURXL RecName: Full=Methionine import ATP-binding protein
   21::91      2e-05  44%  339 aa  METN1_BACHK RecName: Full=Methionine import ATP-binding protein
  999::1198    2e-05  24% 1245 aa  MDR_ORYSJ RecName: Full=Putative multidrug resistance
  416::472     2e-05  39% 1302 aa  MDR49_DROME RecName: Full=Multidrug resistance protein homolog 49; 
  508::560     2e-05  42%  698 aa  MCHF_ECOLX RecName: Full=Probable microcin-H47 secretion/processing
    4::84      2e-05  28%  373 aa  MALK_VIBCH RecName: Full=Maltose/maltodextrin import ATP-binding
    8::81      2e-05  41%  654 aa  MACB_PSEPK RecName: Full=Macrolide export ATP-binding/permease
   22::81      2e-05  40%  649 aa  MACB_PASMU RecName: Full=Macrolide export ATP-binding/permease
    4::82      2e-05  41%  646 aa  MACB_ECOLX RecName: Full=Macrolide export ATP-binding/permease
    1::138     2e-05  25%  641 aa  MACB_CAMJR RecName: Full=Macrolide export ATP-binding/permease
    1::138     2e-05  25%  641 aa  MACB_CAMJE RecName: Full=Macrolide export ATP-binding/permease
    4::82      2e-05  41%  646 aa  MACB2_ECOK1 RecName: Full=Macrolide export ATP-binding/permease
   13::83      2e-05  34%  226 aa  LOLD_MAGSA RecName: Full=Lipoprotein-releasing system ATP-binding
   24::83      2e-05  32%  231 aa  LOLD_HAHCH RecName: Full=Lipoprotein-releasing system ATP-binding
   13::50      2e-05  50%  256 aa  HMUV_HAHCH RecName: Full=Hemin import ATP-binding protein hmuV;  
    6::54      2e-05  37%  351 aa  FBPC_HAEI8 RecName: Full=Fe(3+) ions import ATP-binding protein
   11::59      2e-05  37%  356 aa  FBPC2_HAEIN RecName: Full=Fe(3+) ions import ATP-binding protein
   26::86      2e-05  38%  344 aa  CYSA_SYNE7 RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::67      2e-05  31%  329 aa  CYSA_PSEPK RecName: Full=Sulfate/thiosulfate import ATP-binding
   18::80      2e-05  35%  358 aa  CYSA_MANSM RecName: Full=Sulfate/thiosulfate import ATP-binding
    5::50      2e-05  35%  346 aa  CYSA1_AGRT5 RecName: Full=Sulfate/thiosulfate import ATP-binding
   28::97      2e-05  34%  223 aa  CCMA_XYLFA RecName: Full=Cytochrome c biogenesis ATP-binding
    2::127     2e-05  25%  274 aa  CBIO1_MYCGE RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    1::149     2e-05  25%  506 aa  ARAG_VIBPA RecName: Full=Arabinose import ATP-binding protein araG;
  987::1185    2e-05  24% 1233 aa  AB2B_ARATH RecName: Full=ABC transporter B family member 2;       
   18::87      2e-05  33%  242 aa  ZNUC_EHRCJ RecName: Full=Zinc import ATP-binding protein znuC;   
   13::63      2e-05  37%  298 aa  ZNUC_BRUSU RecName: Full=Zinc import ATP-binding protein znuC;   
   13::63      2e-05  37%  298 aa  ZNUC_BRUAB RecName: Full=Zinc import ATP-binding protein znuC;   
   13::63      2e-05  37%  298 aa  ZNUC_BRUA2 RecName: Full=Zinc import ATP-binding protein znuC;   
    4::101     2e-05  31%  275 aa  YUSV_BACSU RecName: Full=Probable siderophore transport system
  280::329     2e-05  40%  491 aa  Y906_TREDE RecName: Full=Putative ABC transporter ATP-binding
  334::402     2e-05  41%  641 aa  Y870_METAC RecName: Full=Putative ABC transporter ATP-binding
   92::217     2e-05  31%  376 aa  Y205_BRUME RecName: Full=Putative peptide import ATP-binding
   21::71      2e-05  41%  278 aa  Y1572_METJA RecName: Full=Putative ABC transporter ATP-binding
   50::175     2e-05  31%  334 aa  Y1053_BRUA2 RecName: Full=Putative peptide import ATP-binding
   50::175     2e-05  31%  334 aa  Y1034_BRUAB RecName: Full=Putative peptide import ATP-binding
  242::433     2e-05  23%  466 aa  Y065_MYCGE RecName: Full=Putative ABC transporter ATP-binding
   20::131     2e-05  29%  366 aa  UGPC1_AGRT5 RecName: Full=sn-glycerol-3-phosphate import
   20::77      2e-05  43%  232 aa  THIQ_SHIFL RecName: Full=Thiamine import ATP-binding protein
   20::77      2e-05  43%  232 aa  THIQ_SHIF8 RecName: Full=Thiamine import ATP-binding protein
   20::77      2e-05  43%  232 aa  THIQ_SHIBS RecName: Full=Thiamine import ATP-binding protein
   46::107     2e-05  39%  299 aa  SSUB_RALEJ RecName: Full=Aliphatic sulfonates import ATP-binding
   34::115     2e-05  32%  275 aa  SSUB1_RHIL3 RecName: Full=Aliphatic sulfonates import ATP-binding
   41::139     2e-05  33%  293 aa  PSTB_SACD2 RecName: Full=Phosphate import ATP-binding protein pstB;
   25::120     2e-05  33%  277 aa  PSTB1_NITOC RecName: Full=Phosphate import ATP-binding protein pstB
    4::90      2e-05  30%  379 aa  POTA_TREPA RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      2e-05  34%  385 aa  POTA_STRR6 RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      2e-05  34%  385 aa  POTA_STRPN RecName: Full=Spermidine/putrescine import ATP-binding
   20::88      2e-05  34%  385 aa  POTA_STRP2 RecName: Full=Spermidine/putrescine import ATP-binding
    9::133     2e-05  27%  366 aa  POTA_SILPO RecName: Full=Spermidine/putrescine import ATP-binding
   37::230     2e-05  25%  335 aa  OPPD_SALTY RecName: Full=Oligopeptide transport ATP-binding protein
  355::409     2e-05  35%  582 aa  MSBA_SALTY RecName: Full=Lipid A export ATP-binding/permease
  355::409     2e-05  35%  582 aa  MSBA_SALTI RecName: Full=Lipid A export ATP-binding/permease
  355::409     2e-05  35%  582 aa  MSBA_SALPA RecName: Full=Lipid A export ATP-binding/permease
  355::409     2e-05  35%  582 aa  MSBA_SALCH RecName: Full=Lipid A export ATP-binding/permease
  358::412     2e-05  33%  585 aa  MSBA_PHOPR RecName: Full=Lipid A export ATP-binding/permease
    5::77      2e-05  38%  506 aa  MGLA_PASMU RecName: Full=Galactose/methyl galactoside import
   17::80      2e-05  41%  344 aa  METN_VIBF1 RecName: Full=Methionine import ATP-binding protein
    1::69      2e-05  35%  341 aa  METN_LEGPH RecName: Full=Methionine import ATP-binding protein
    1::69      2e-05  33%  318 aa  METN_CLOTE RecName: Full=Methionine import ATP-binding protein
    5::87      2e-05  29%  255 aa  LIVG_SALTY RecName: Full=High-affinity branched-chain amino acid
    5::87      2e-05  29%  255 aa  LIVG_SALTI RecName: Full=High-affinity branched-chain amino acid
    5::54      2e-05  38%  260 aa  HMUV_VIBPA RecName: Full=Hemin import ATP-binding protein hmuV;  
   49::114     2e-05  40%  395 aa  FBPC2_RHIME RecName: Full=Fe(3+) ions import ATP-binding protein
    3::74      2e-05  33%  348 aa  CYSA_XYLFA RecName: Full=Sulfate/thiosulfate import ATP-binding
   20::195     2e-05  30%  214 aa  CCMA_XANCP RecName: Full=Cytochrome c biogenesis ATP-binding export
   20::195     2e-05  30%  214 aa  CCMA_XANC8 RecName: Full=Cytochrome c biogenesis ATP-binding export
   14::85      2e-05  39%  273 aa  CBIO_SYNWW RecName: Full=Cobalt import ATP-binding protein cbiO; 
   15::134     2e-05  30%  266 aa  CBIO1_MYCS5 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    5::97      2e-05  34%  272 aa  CBIO1_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   25::102     2e-05  43%  281 aa  CBIO1_LACPL RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    2::76      2e-05  37%  251 aa  BTUD_VIBCM RecName: Full=Vitamin B12 import ATP-binding protein
    2::76      2e-05  37%  251 aa  BTUD_VIBCH RecName: Full=Vitamin B12 import ATP-binding protein
   20::66      2e-05  47%  503 aa  ARAG1_BURTA RecName: Full=Arabinose import ATP-binding protein
  434::490     2e-05  39% 1321 aa  ABCBB_MOUSE RecName: Full=Bile salt export pump;AltName:
  466::524     2e-05  34%  700 aa  AB26B_ARATH RecName: Full=ABC transporter B family member 26,
    2::53      3e-05  35%  258 aa  ZNUC_THICR RecName: Full=Zinc import ATP-binding protein znuC;   
    7::55      3e-05  37%  243 aa  ZNUC_PSYA2 RecName: Full=Zinc import ATP-binding protein znuC;   
   10::51      3e-05  40%  264 aa  ZNUC_HAES1 RecName: Full=Zinc import ATP-binding protein znuC;   
    3::52      3e-05  32%  256 aa  ZNUC1_VIBF1 RecName: Full=Zinc import ATP-binding protein znuC 1;
  126::165     3e-05  42%  339 aa  Y683_MYCPN RecName: Full=Putative ABC transporter ATP-binding
    2::136     3e-05  30%  269 aa  Y528_PYRFU RecName: Full=Putative ABC transporter ATP-binding
    6::56      3e-05  33%  259 aa  Y348_CHLPN RecName: Full=Probable metal transport system
   20::85      3e-05  33%  570 aa  Y2766_STAAR RecName: Full=Putative ABC transporter ATP-binding
  256::303     3e-05  38%  528 aa  Y1418_METAC RecName: Full=Putative ABC transporter ATP-binding
    2::76      3e-05  32%  264 aa  TAUB_PSEF5 RecName: Full=Taurine import ATP-binding protein tauB;
   54::101     3e-05  44%  291 aa  SSUB_RALME RecName: Full=Aliphatic sulfonates import ATP-binding
    4::92      3e-05  34%  249 aa  SSUB2_PSEAE RecName: Full=Aliphatic sulfonates import ATP-binding
    4::92      3e-05  34%  249 aa  SSUB1_PSEAB RecName: Full=Aliphatic sulfonates import ATP-binding
   20::97      3e-05  32%  506 aa  RBSA_MESSB RecName: Full=Ribose import ATP-binding protein rbsA;   
    4::213     3e-05  24%  259 aa  PSTB1_PSE14 RecName: Full=Phosphate import ATP-binding protein pstB
   26::119     3e-05  34%  272 aa  PSTB1_PHOPR RecName: Full=Phosphate import ATP-binding protein pstB
   59::147     3e-05  38%  299 aa  PSTB1_HALMA RecName: Full=Phosphate import ATP-binding protein pstB
    5::88      3e-05  30%  384 aa  POTA_STRPM RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRPF RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRPD RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRPC RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRPB RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRP8 RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRP6 RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRP3 RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      3e-05  30%  384 aa  POTA_STRP1 RecName: Full=Spermidine/putrescine import ATP-binding
    6::109     3e-05  34%  257 aa  PHNC_LACAC RecName: Full=Phosphonates import ATP-binding protein
    2::90      3e-05  35%  264 aa  PHNC_CAUCR RecName: Full=Phosphonates import ATP-binding protein
    8::75      3e-05  35%  277 aa  PHNC2_RHOFD RecName: Full=Phosphonates import ATP-binding protein
    5::71      3e-05  35%  284 aa  PHNC2_RALEH RecName: Full=Phosphonates import ATP-binding protein
   14::69      3e-05  38%  304 aa  NODI_BURXL RecName: Full=Nod factor export ATP-binding protein I;
   37::84      3e-05  31%  335 aa  NODI2_RHIME RecName: Full=Nod factor export ATP-binding protein
  371::427     3e-05  37%  598 aa  MSBA_PSYCK RecName: Full=Lipid A export ATP-binding/permease
  368::424     3e-05  37%  595 aa  MSBA_PSYA2 RecName: Full=Lipid A export ATP-binding/permease
    4::56      3e-05  36%  250 aa  MNTB_BACHD RecName: Full=Manganese transport system ATP-binding
    1::69      3e-05  35%  341 aa  METN_LEGPA RecName: Full=Methionine import ATP-binding protein
   21::80      3e-05  40%  343 aa  METN3_ERWCT RecName: Full=Methionine import ATP-binding protein
   21::73      3e-05  43%  344 aa  METN1_BURCH RecName: Full=Methionine import ATP-binding protein
   21::73      3e-05  43%  344 aa  METN1_BURCA RecName: Full=Methionine import ATP-binding protein
 1049::1236    3e-05  25% 1276 aa  MDR1_MOUSE RecName: Full=Multidrug resistance protein 1;       
   13::83      3e-05  30%  656 aa  MACB_SHEON RecName: Full=Macrolide export ATP-binding/permease
   25::114     3e-05  38%  647 aa  MACB_BRUME RecName: Full=Macrolide export ATP-binding/permease
   25::114     3e-05  38%  646 aa  MACB_BRUA2 RecName: Full=Macrolide export ATP-binding/permease
   21::77      3e-05  39%  233 aa  LOLD_SHIFL RecName: Full=Lipoprotein-releasing system ATP-binding
   25::83      3e-05  39%  227 aa  LOLD_RHIEC RecName: Full=Lipoprotein-releasing system ATP-binding
    1::52      3e-05  37%  258 aa  HMUV_THICR RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::67      3e-05  36%  273 aa  HMUV_BURCM RecName: Full=Hemin import ATP-binding protein hmuV;  
    4::69      3e-05  38%  350 aa  FBPC_PSEPF RecName: Full=Fe(3+) ions import ATP-binding protein
   18::68      3e-05  37%  372 aa  CYSA_RALSO RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::96      3e-05  33%  218 aa  CCMA_YERPN RecName: Full=Cytochrome c biogenesis ATP-binding export
    1::96      3e-05  33%  218 aa  CCMA_YERPE RecName: Full=Cytochrome c biogenesis ATP-binding export
    1::96      3e-05  33%  218 aa  CCMA_YERPA RecName: Full=Cytochrome c biogenesis ATP-binding export
    1::74      3e-05  28%  274 aa  CBIO1_MYCPN RecName: Full=Cobalt import ATP-binding protein cbiO
  478::534     3e-05  33%  750 aa  ATM1_CANAL RecName: Full=Iron-sulfur clusters transporter ATM1,
  464::592     3e-05  23%  720 aa  ATM1_ASPOR RecName: Full=Iron-sulfur clusters transporter atm1,
  515::566     3e-05  33%  762 aa  ABCB9_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  471::650     3e-05  24%  717 aa  ABCB8_MOUSE RecName: Full=ATP-binding cassette sub-family B member
   40::111     3e-05  33%  590 aa  AB10G_ARATH RecName: Full=ABC transporter G family member 10;      
    4::52      4e-05  35%  254 aa  ZNUC_AERHH RecName: Full=Zinc import ATP-binding protein znuC;   
   13::195     4e-05  29%  293 aa  Y731_ARCFU RecName: Full=Putative ABC transporter ATP-binding
   26::74      4e-05  43%  330 aa  Y2593_MYCBO RecName: Full=Uncharacterized ABC transporter
   26::74      4e-05  43%  330 aa  Y2564_MYCTU RecName: Full=Uncharacterized ABC transporter
    6::88      4e-05  27%  585 aa  Y187_MYCGE RecName: Full=Putative ABC transporter ATP-binding
  241::434     4e-05  24%  465 aa  Y081_MYCPN RecName: Full=Putative ABC transporter ATP-binding
    4::146     4e-05  28%  504 aa  XYLG_HAES1 RecName: Full=Xylose import ATP-binding protein xylG;   
    1::77      4e-05  35%  236 aa  THIQ_YERPS RecName: Full=Thiamine import ATP-binding protein
   17::77      4e-05  38%  238 aa  THIQ_VIBCH RecName: Full=Thiamine import ATP-binding protein
   19::70      4e-05  43%  261 aa  TAUB_PSE14 RecName: Full=Taurine import ATP-binding protein tauB;
   40::100     4e-05  47%  281 aa  SSUB_RHOPA RecName: Full=Aliphatic sulfonates import ATP-binding
   15::48      4e-05  50%  232 aa  SSUB2_PSESM RecName: Full=Aliphatic sulfonates import ATP-binding
   21::68      4e-05  42%  274 aa  SSUB2_PSEAB RecName: Full=Aliphatic sulfonates import ATP-binding
   21::68      4e-05  42%  274 aa  SSUB1_PSEAE RecName: Full=Aliphatic sulfonates import ATP-binding
  484::666     4e-05  26%  711 aa  RTX3B_ACTPL RecName: Full=Toxin RTX-III translocation ATP-binding
   26::110     4e-05  28%  518 aa  RGMG_RALSO RecName: Full=Putative ribose/galactose/methyl
   18::171     4e-05  29%  271 aa  PSTB_THET8 RecName: Full=Phosphate import ATP-binding protein pstB;
    1::212     4e-05  29%  258 aa  PSTB3_MAGSA RecName: Full=Phosphate import ATP-binding protein pstB
   19::119     4e-05  33%  272 aa  PSTB2_VIBF1 RecName: Full=Phosphate import ATP-binding protein pstB
   26::119     4e-05  35%  272 aa  PSTB1_VIBVY RecName: Full=Phosphate import ATP-binding protein pstB
   26::119     4e-05  35%  272 aa  PSTB1_VIBVU RecName: Full=Phosphate import ATP-binding protein pstB
   20::88      4e-05  29%  384 aa  POTA_STRMU RecName: Full=Spermidine/putrescine import ATP-binding
    4::86      4e-05  28%  350 aa  POTA_SPICI RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      4e-05  30%  347 aa  POTA_BORBU RecName: Full=Spermidine/putrescine import ATP-binding
   20::71      4e-05  43%  276 aa  PHNC_PSEST RecName: Full=Phosphonates import ATP-binding protein
   18::106     4e-05  39%  266 aa  PHNC_BACSK RecName: Full=Phosphonates import ATP-binding protein
  484::666     4e-05  27%  711 aa  PAXB_PASAE RecName: Full=Exotoxin translocation ATP-binding protein
   43::229     4e-05  21%  334 aa  OPPF_ECOLI RecName: Full=Oligopeptide transport ATP-binding protein
    6::86      4e-05  27%  304 aa  NODI_RHIS3 RecName: Full=Nod factor export ATP-binding protein I;
   23::68      4e-05  35%  316 aa  NODI_RHIEC RecName: Full=Nod factor export ATP-binding protein I;
  355::409     4e-05  33%  582 aa  MSBA_SHISS RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_SHIFL RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_SHIDS RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_SHIBS RecName: Full=Lipid A export ATP-binding/permease
  366::420     4e-05  35%  600 aa  MSBA_PSESM RecName: Full=Lipid A export ATP-binding/permease
  366::420     4e-05  35%  600 aa  MSBA_PSE14 RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_ECOUT RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_ECOLI RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_ECOL6 RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_ECOL5 RecName: Full=Lipid A export ATP-binding/permease
  355::409     4e-05  33%  582 aa  MSBA_ECO57 RecName: Full=Lipid A export ATP-binding/permease
   62::160     4e-05  41%  398 aa  METN2_BURS3 RecName: Full=Methionine import ATP-binding protein
   12::81      4e-05  34%  657 aa  MACB_CHLCH RecName: Full=Macrolide export ATP-binding/permease
   16::74      4e-05  40%  227 aa  LOLD_SILST RecName: Full=Lipoprotein-releasing system ATP-binding
    3::82      4e-05  37%  224 aa  LOLD_NOVAD RecName: Full=Lipoprotein-releasing system ATP-binding
    1::87      4e-05  31%  233 aa  LOLD_NITOC RecName: Full=Lipoprotein-releasing system ATP-binding
   17::207     4e-05  26%  246 aa  LOLD1_CHLCH RecName: Full=Lipoprotein-releasing system ATP-binding
    1::43      4e-05  40%  254 aa  HMUV_SHEDO RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::57      4e-05  39%  265 aa  HMUV_ERWCT RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::90      4e-05  29%  261 aa  HMUV_DEIRA RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::50      4e-05  40%  272 aa  HMUV_BURPS RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::50      4e-05  40%  272 aa  HMUV_BURP1 RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::50      4e-05  40%  272 aa  HMUV_BURMA RecName: Full=Hemin import ATP-binding protein hmuV;  
  598::652     4e-05  31%  830 aa  HMT1_SCHPO RecName: Full=Heavy metal tolerance protein;Flags:
    1::78      4e-05  30%  242 aa  GLUA_COREF RecName: Full=Glutamate transport ATP-binding protein
    2::71      4e-05  34%  349 aa  FBPC_YEREN RecName: Full=Fe(3+) ions import ATP-binding protein
    2::77      4e-05  32%  247 aa  ECSA_BACSU RecName: Full=ABC-type transporter ATP-binding protein
   34::219     4e-05  24%  335 aa  DPPD_BACSU RecName: Full=Dipeptide transport ATP-binding protein
    3::123     4e-05  26%  343 aa  CYSA_NEPOL RecName: Full=Sulfate/thiosulfate import ATP-binding
 1375::1445    4e-05  31% 1704 aa  CED7_CAEEL RecName: Full=ABC transporter ced-7;AltName: Full=Cell
    7::79      4e-05  30%  233 aa  CCMA_PSEAE RecName: Full=Cytochrome c biogenesis ATP-binding
    6::75      4e-05  33%  218 aa  CCMA_IDILO RecName: Full=Cytochrome c biogenesis ATP-binding
    1::56      4e-05  41%  193 aa  CCMA_HYPNA RecName: Full=Cytochrome c biogenesis ATP-binding
  509::571     4e-05  33%  763 aa  ATM1_USTMA RecName: Full=Iron-sulfur clusters transporter ATM1,
    2::51      4e-05  38%  231 aa  ADCC_BACSU RecName: Full=Probable zinc transport system
    4::52      5e-05  35%  262 aa  ZNUC_VIBCH RecName: Full=Zinc import ATP-binding protein znuC;   
  321::380     5e-05  33%  555 aa  YJJK_SHIFL RecName: Full=Uncharacterized ABC transporter
  321::380     5e-05  33%  555 aa  YJJK_ECOLI RecName: Full=Uncharacterized ABC transporter
  321::380     5e-05  33%  555 aa  YJJK_ECO57 RecName: Full=Uncharacterized ABC transporter
  378::438     5e-05  30%  614 aa  Y1051_HAEIN RecName: Full=Uncharacterized ABC transporter
   13::86      5e-05  39%  274 aa  Y1037_METMA RecName: Full=Putative ABC transporter ATP-binding
   28::70      5e-05  44%  240 aa  WTPC_ARCFU RecName: Full=Molybdate/tungstate import ATP-binding
   21::83      5e-05  33%  372 aa  UGPC_VIBVY RecName: Full=sn-glycerol-3-phosphate import
   21::83      5e-05  33%  372 aa  UGPC_VIBVU RecName: Full=sn-glycerol-3-phosphate import
   20::77      5e-05  41%  232 aa  THIQ_ECO57 RecName: Full=Thiamine import ATP-binding protein
    8::103     5e-05  34%  257 aa  PSTB_SULSO RecName: Full=Phosphate import ATP-binding protein pstB;
   23::123     5e-05  33%  276 aa  PSTB_OCEIH RecName: Full=Phosphate import ATP-binding protein pstB;
    2::208     5e-05  25%  254 aa  PSTB_DEIRA RecName: Full=Phosphate import ATP-binding protein pstB;
   47::137     5e-05  37%  291 aa  PSTB_CAUCR RecName: Full=Phosphate import ATP-binding protein pstB;
   47::137     5e-05  37%  291 aa  PSTB_CAUCN RecName: Full=Phosphate import ATP-binding protein pstB;
   29::131     5e-05  34%  283 aa  PSTB1_NATPD RecName: Full=Phosphate import ATP-binding protein pstB
    7::80      5e-05  25%  370 aa  POTA_OCEIH RecName: Full=Spermidine/putrescine import ATP-binding
    3::87      5e-05  26%  352 aa  POTA_CLOAB RecName: Full=Spermidine/putrescine import ATP-binding
    3::76      5e-05  30%  417 aa  POTA_AYWBP RecName: Full=Spermidine/putrescine import ATP-binding
   20::108     5e-05  39%  257 aa  PHNC_STAHJ RecName: Full=Phosphonates import ATP-binding protein
    3::95      5e-05  27%  262 aa  PHNC_SHIFL RecName: Full=Phosphonates import ATP-binding protein
    3::95      5e-05  27%  262 aa  PHNC_SHIF8 RecName: Full=Phosphonates import ATP-binding protein
    1::68      5e-05  32%  271 aa  PHNC2_RHOPB RecName: Full=Phosphonates import ATP-binding protein
   26::80      5e-05  33%  319 aa  OPPF_LACLS RecName: Full=Oligopeptide transport ATP-binding
   26::80      5e-05  33%  319 aa  OPPF_LACLA RecName: Full=Oligopeptide transport ATP-binding
   36::91      5e-05  38%  274 aa  NRTD_SYNE7 RecName: Full=Nitrate transport ATP-binding protein
  344::413     5e-05  32%  599 aa  NDVA_RHOPA RecName: Full=Beta-(1-->2)glucan export
  354::404     5e-05  35%  602 aa  NDVA_BRAJA RecName: Full=Beta-(1-->2)glucan export
  350::409     5e-05  35%  582 aa  MSBA_HAES1 RecName: Full=Lipid A export ATP-binding/permease
  369::439     5e-05  30%  609 aa  MSBA_FRATT RecName: Full=Lipid A export ATP-binding/permease
  369::439     5e-05  30%  609 aa  MSBA_FRATO RecName: Full=Lipid A export ATP-binding/permease
  369::439     5e-05  30%  609 aa  MSBA_FRATH RecName: Full=Lipid A export ATP-binding/permease
  369::439     5e-05  30%  609 aa  MSBA_FRAT1 RecName: Full=Lipid A export ATP-binding/permease
  348::418     5e-05  30%  593 aa  MSBA_FRANO RecName: Full=Lipid A export ATP-binding/permease
  363::414     5e-05  35%  589 aa  MSBA_ALHEH RecName: Full=Lipid A export ATP-binding/permease
   17::211     5e-05  27%  351 aa  METN_STRCO RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_SHISS RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_SHIDS RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_SHIBS RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  42%  343 aa  METN_PHOLL RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_ECOUT RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_ECOLI RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_ECOL6 RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_ECOL5 RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN_ECO57 RecName: Full=Methionine import ATP-binding protein
   18::83      5e-05  39%  401 aa  METN_BIFLO RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN2_YERPN RecName: Full=Methionine import ATP-binding protein
   60::152     5e-05  43%  391 aa  METN2_BURCM RecName: Full=Methionine import ATP-binding protein
   21::91      5e-05  42%  339 aa  METN2_BACCZ RecName: Full=Methionine import ATP-binding protein
   21::91      5e-05  42%  339 aa  METN2_BACC1 RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN1_YERPE RecName: Full=Methionine import ATP-binding protein
   21::80      5e-05  38%  343 aa  METN1_YERPA RecName: Full=Methionine import ATP-binding protein
 1047::1234    5e-05  25% 1276 aa  MDR3_MOUSE RecName: Full=Multidrug resistance protein 3;       
  347::414     5e-05  34%  581 aa  MDLA_BUCAP RecName: Full=Multidrug resistance-like ATP-binding
    3::115     5e-05  36%  664 aa  MACB_ACIAD RecName: Full=Macrolide export ATP-binding/permease
    5::78      5e-05  39%  235 aa  LOLD_ERWCT RecName: Full=Lipoprotein-releasing system ATP-binding
  480::610     5e-05  36%  707 aa  LKTB_ACTAC RecName: Full=Leukotoxin translocation ATP-binding
    8::109     5e-05  31%  259 aa  HMUV_VIBF1 RecName: Full=Hemin import ATP-binding protein hmuV;    
    3::53      5e-05  37%  260 aa  HMUV_SODGM RecName: Full=Hemin import ATP-binding protein hmuV;  
    8::67      5e-05  35%  260 aa  HMUV_SILST RecName: Full=Hemin import ATP-binding protein hmuV;  
    5::89      5e-05  26%  353 aa  FBPC_BRUAB RecName: Full=Fe(3+) ions import ATP-binding protein
    5::89      5e-05  26%  353 aa  FBPC_BRUA2 RecName: Full=Fe(3+) ions import ATP-binding protein
    3::65      5e-05  33%  348 aa  CYSA_RHOPA RecName: Full=Sulfate/thiosulfate import ATP-binding
   18::66      5e-05  45%  356 aa  CYSA_LEPIN RecName: Full=Sulfate/thiosulfate import ATP-binding
   18::66      5e-05  45%  356 aa  CYSA_LEPIC RecName: Full=Sulfate/thiosulfate import ATP-binding
  333::476     5e-05  28%  575 aa  CYDD_BACSU RecName: Full=ATP-binding/permease protein cydD;
    1::96      5e-05  33%  218 aa  CCMA_YERPS RecName: Full=Cytochrome c biogenesis ATP-binding export
   10::82      5e-05  32%  213 aa  CCMA_NITEU RecName: Full=Cytochrome c biogenesis ATP-binding
   35::82      5e-05  42%  525 aa  ARAG2_BURTA RecName: Full=Arabinose import ATP-binding protein
  434::490     5e-05  37% 1321 aa  ABCBB_RAT RecName: Full=Bile salt export pump;AltName:
  515::566     5e-05  33%  762 aa  ABCB9_RAT RecName: Full=ATP-binding cassette sub-family B member
   33::111     5e-05  38%  308 aa  ABCA_AERSA RecName: Full=ABC transporter protein abcA;
  419::472     5e-05  31%  692 aa  AB5F_ARATH RecName: Full=ABC transporter F family member 5;        
    5::53      7e-05  37%  261 aa  ZNUC_SACD2 RecName: Full=Zinc import ATP-binding protein znuC;   
   21::82      7e-05  32%  242 aa  ZNUC_EHRRW RecName: Full=Zinc import ATP-binding protein znuC;   
   21::82      7e-05  32%  242 aa  ZNUC_EHRRG RecName: Full=Zinc import ATP-binding protein znuC;   
    1::43      7e-05  40%  249 aa  YXEO_BACSU RecName: Full=Probable amino-acid import ATP-binding
  379::431     7e-05  34%  604 aa  YKNV_BACSU RecName: Full=Uncharacterized ABC transporter
    1::65      7e-05  29%  252 aa  YCLP_BACSU RecName: Full=Uncharacterized ABC transporter
  317::375     7e-05  34%  568 aa  Y2153_ENTFA RecName: Full=Putative ABC transporter ATP-binding
  469::519     7e-05  39%  661 aa  Y182_SYNY3 RecName: Full=Uncharacterized ABC transporter
    5::95      7e-05  29%  511 aa  XYLG_BRUAB RecName: Full=Xylose import ATP-binding protein xylG; 
    5::95      7e-05  29%  511 aa  XYLG_BRUA2 RecName: Full=Xylose import ATP-binding protein xylG; 
   19::85      7e-05  28%  351 aa  UGPC_BRUSU RecName: Full=sn-glycerol-3-phosphate import
   19::85      7e-05  28%  351 aa  UGPC_BRUME RecName: Full=sn-glycerol-3-phosphate import
   19::85      7e-05  28%  351 aa  UGPC_BRUAB RecName: Full=sn-glycerol-3-phosphate import
   19::85      7e-05  28%  351 aa  UGPC_BRUA2 RecName: Full=sn-glycerol-3-phosphate import
   15::77      7e-05  38%  234 aa  THIQ_VIBPA RecName: Full=Thiamine import ATP-binding protein
   20::77      7e-05  41%  232 aa  THIQ_SHIDS RecName: Full=Thiamine import ATP-binding protein
    5::77      7e-05  41%  235 aa  THIQ_SALTI RecName: Full=Thiamine import ATP-binding protein
    5::77      7e-05  41%  235 aa  THIQ_SALPA RecName: Full=Thiamine import ATP-binding protein
    5::77      7e-05  41%  235 aa  THIQ_SALCH RecName: Full=Thiamine import ATP-binding protein
    2::53      7e-05  38%  264 aa  TAUB_PSEPF RecName: Full=Taurine import ATP-binding protein tauB;
  580::629     7e-05  34%  808 aa  TAP1_HUMAN RecName: Full=Antigen peptide transporter 1;       
  520::569     7e-05  34%  748 aa  TAP1_GORGO RecName: Full=Antigen peptide transporter 1;       
   40::148     7e-05  29%  276 aa  SSUB1_AGRT5 RecName: Full=Aliphatic sulfonates import ATP-binding
    1::155     7e-05  35%  255 aa  PSTB_DESVH RecName: Full=Phosphate import ATP-binding protein pstB;
   36::132     7e-05  34%  285 aa  PSTB_ALHEH RecName: Full=Phosphate import ATP-binding protein pstB;
   19::119     7e-05  33%  272 aa  PSTB1_VIBPA RecName: Full=Phosphate import ATP-binding protein pstB
   20::120     7e-05  34%  273 aa  PSTB1_VIBCH RecName: Full=Phosphate import ATP-binding protein pstB
    4::213     7e-05  24%  259 aa  PSTB1_PSEU2 RecName: Full=Phosphate import ATP-binding protein pstB
    4::213     7e-05  24%  259 aa  PSTB1_PSESM RecName: Full=Phosphate import ATP-binding protein pstB
   17::86      7e-05  32%  370 aa  POTA_LACBA RecName: Full=Spermidine/putrescine import ATP-binding
   33::103     7e-05  30%  383 aa  POTA_ERWCT RecName: Full=Spermidine/putrescine import ATP-binding
    2::67      7e-05  36%  280 aa  PHNC_HALSA RecName: Full=Phosphonates import ATP-binding protein
    9::58      7e-05  45%  279 aa  PHNC2_RALME RecName: Full=Phosphonates import ATP-binding protein
   18::92      7e-05  35%  280 aa  PHNC1_RHOP2 RecName: Full=Phosphonates import ATP-binding protein
   15::75      7e-05  38%  304 aa  PHNC1_HALWD RecName: Full=Phosphonates import ATP-binding protein
  344::413     7e-05  33%  602 aa  NDVA_RHOPS RecName: Full=Beta-(1-->2)glucan export
  344::413     7e-05  32%  602 aa  NDVA_RHOP5 RecName: Full=Beta-(1-->2)glucan export
  355::409     7e-05  33%  583 aa  MSBA_VIBVY RecName: Full=Lipid A export ATP-binding/permease
  355::409     7e-05  33%  583 aa  MSBA_VIBVU RecName: Full=Lipid A export ATP-binding/permease
    1::205     7e-05  27%  344 aa  METN_RALME RecName: Full=Methionine import ATP-binding protein
   22::89      7e-05  36%  645 aa  MACB_NITWN RecName: Full=Macrolide export ATP-binding/permease
   25::80      7e-05  39%  653 aa  MACB2_PSEU2 RecName: Full=Macrolide export ATP-binding/permease
    3::76      7e-05  40%  651 aa  MACB2_PSEPF RecName: Full=Macrolide export ATP-binding/permease
   43::104     7e-05  37%  249 aa  LOLD_RALME RecName: Full=Lipoprotein-releasing system ATP-binding
    3::77      7e-05  41%  237 aa  LOLD1_CHLTE RecName: Full=Lipoprotein-releasing system
   12::55      7e-05  39%  260 aa  HMUV_VIBAN RecName: Full=Hemin import ATP-binding protein hmuV;  
   27::74      7e-05  40%  265 aa  HMUV_LISDA RecName: Full=Hemin import ATP-binding protein hmuV;  
    6::78      7e-05  30%  261 aa  HMUV_ENTCL RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::50      7e-05  38%  276 aa  HMUV_BURCH RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::50      7e-05  38%  276 aa  HMUV_BURCA RecName: Full=Hemin import ATP-binding protein hmuV;  
    5::89      7e-05  26%  353 aa  FBPC_BRUSU RecName: Full=Fe(3+) ions import ATP-binding protein
    2::89      7e-05  24%  353 aa  FBPC_AGRT5 RecName: Full=Fe(3+) ions import ATP-binding protein
    3::67      7e-05  32%  344 aa  CYSA_GLOVI RecName: Full=Sulfate/thiosulfate import ATP-binding
    5::196     7e-05  23%  359 aa  CYSA_BRUSU RecName: Full=Sulfate/thiosulfate import ATP-binding
    5::196     7e-05  23%  359 aa  CYSA_BRUME RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::80      7e-05  29%  357 aa  CYSA_BACHD RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::83      7e-05  26%  376 aa  CYSA1_SHEON RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::86      7e-05  30%  205 aa  CCMA_VIBPA RecName: Full=Cytochrome c biogenesis ATP-binding
    3::50      7e-05  35%  204 aa  CCMA_SILPO RecName: Full=Cytochrome c biogenesis ATP-binding
   13::86      7e-05  38%  274 aa  CBIO_METAC RecName: Full=Cobalt import ATP-binding protein cbiO; 
   23::95      7e-05  38%  281 aa  CBIO3_CLOP1 RecName: Full=Cobalt import ATP-binding protein cbiO
   18::95      7e-05  37%  281 aa  CBIO2_CLOPS RecName: Full=Cobalt import ATP-binding protein cbiO
   23::95      7e-05  38%  281 aa  CBIO2_CLOPE RecName: Full=Cobalt import ATP-binding protein cbiO
    2::147     7e-05  29%  285 aa  CBIO1_LACGA RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   16::73      7e-05  36%  514 aa  ARAG_PSEPF RecName: Full=Arabinose import ATP-binding protein
  459::638     7e-05  23%  688 aa  ABCB8_XENTR RecName: Full=ATP-binding cassette sub-family B member
  454::650     7e-05  24%  714 aa  ABCB8_RAT RecName: Full=ATP-binding cassette sub-family B member 8,
    9::100     7e-05  30%  257 aa  AAPP_RHIL3 RecName: Full=General L-amino acid transport ATP-binding
    6::54      9e-05  29%  255 aa  ZNUC1_HAHCH RecName: Full=Zinc import ATP-binding protein znuC 1;
    3::69      9e-05  28%  305 aa  YHCH_BACSU RecName: Full=Uncharacterized ABC transporter
   15::85      9e-05  28%  360 aa  YCJV_ECOLI RecName: Full=Putative uncharacterized ABC transporter
   15::85      9e-05  28%  360 aa  YCJV_ECOL6 RecName: Full=Uncharacterized ABC transporter
   15::85      9e-05  28%  360 aa  YCJV_ECOL5 RecName: Full=Uncharacterized ABC transporter
   15::85      9e-05  28%  360 aa  YCJV_ECO57 RecName: Full=Uncharacterized ABC transporter
   14::89      9e-05  33%  284 aa  Y5958_STRCO RecName: Full=Putative ABC transporter ATP-binding
  254::340     9e-05  33%  498 aa  Y2387_METMA RecName: Full=Putative ABC transporter ATP-binding
  367::448     9e-05  35%  612 aa  Y1312_MYCBO RecName: Full=Uncharacterized ABC transporter
  367::448     9e-05  35%  612 aa  Y1281_MYCTU RecName: Full=Uncharacterized ABC transporter
   19::89      9e-05  38%  287 aa  Y1038_METMA RecName: Full=Putative ABC transporter ATP-binding
    3::68      9e-05  35%  243 aa  Y100_LACPL RecName: Full=Putative ABC transporter ATP-binding
    4::72      9e-05  36%  268 aa  TAUB_JANSC RecName: Full=Taurine import ATP-binding protein tauB;
   40::87      9e-05  40%  281 aa  SSUB_RHOP5 RecName: Full=Aliphatic sulfonates import ATP-binding
   32::88      9e-05  37%  268 aa  SSUB3_RHOSR RecName: Full=Aliphatic sulfonates import ATP-binding
   20::66      9e-05  45%  252 aa  SSUB1_XANAC RecName: Full=Aliphatic sulfonates import ATP-binding
    3::95      9e-05  27%  262 aa  PHNC_SHISS RecName: Full=Phosphonates import ATP-binding protein
    3::95      9e-05  27%  262 aa  PHNC_SHIBS RecName: Full=Phosphonates import ATP-binding protein
   20::70      9e-05  37%  307 aa  PHNC_BURPS RecName: Full=Phosphonates import ATP-binding protein
   20::70      9e-05  37%  307 aa  PHNC_BURP1 RecName: Full=Phosphonates import ATP-binding protein
   20::70      9e-05  37%  307 aa  PHNC_BURMA RecName: Full=Phosphonates import ATP-binding protein
   18::131     9e-05  35%  381 aa  OPUBA_BACSU RecName: Full=Choline transport ATP-binding protein
   35::104     9e-05  39%  418 aa  OPUAA_BACSU RecName: Full=Glycine betaine transport ATP-binding
    5::80      9e-05  25%  308 aa  OPPF_STRMU RecName: Full=Oligopeptide transport ATP-binding
   46::89      9e-05  34%  340 aa  NODI_RHILO RecName: Full=Nod factor export ATP-binding protein I;
    4::81      9e-05  38%  277 aa  NIKE_RHORT RecName: Full=Nickel import ATP-binding protein nikE; 
  351::403     9e-05  36%  599 aa  NDVA_BRUSU RecName: Full=Beta-(1-->2)glucan export
   18::85      9e-05  31%  365 aa  MSMX_BACSU RecName: Full=Maltodextrin import ATP-binding protein
  357::413     9e-05  35%  583 aa  MSBA_METFK RecName: Full=Lipid A export ATP-binding/permease
  369::420     9e-05  35%  601 aa  MSBA_AZOSE RecName: Full=Lipid A export ATP-binding/permease
    3::214     9e-05  26%  354 aa  METN2_OENOB RecName: Full=Methionine import ATP-binding protein
   58::156     9e-05  40%  394 aa  METN2_BURCH RecName: Full=Methionine import ATP-binding protein
   58::156     9e-05  40%  394 aa  METN2_BURCA RecName: Full=Methionine import ATP-binding protein
   21::80      9e-05  37%  343 aa  METN1_SALTY RecName: Full=Methionine import ATP-binding protein
   21::80      9e-05  37%  343 aa  METN1_SALCH RecName: Full=Methionine import ATP-binding protein
   17::205     9e-05  24%  335 aa  METN1_PSEF5 RecName: Full=Methionine import ATP-binding protein
   21::70      9e-05  42%  344 aa  METN1_BURCM RecName: Full=Methionine import ATP-binding protein
  454::519     9e-05  34%  685 aa  MDL1_CANAL RecName: Full=ATP-dependent permease MDL1;
  345::425     9e-05  31%  580 aa  MCJD_ECOLX RecName: Full=Microcin-J25 export ATP-binding/permease
   22::126     9e-05  31%  644 aa  MACB_NEIMB RecName: Full=Macrolide export ATP-binding/permease
   22::126     9e-05  31%  644 aa  MACB_NEIMA RecName: Full=Macrolide export ATP-binding/permease
   22::126     9e-05  31%  644 aa  MACB_NEIGO RecName: Full=Macrolide export ATP-binding/permease
   22::126     9e-05  31%  644 aa  MACB_NEIG1 RecName: Full=Macrolide export ATP-binding/permease
    3::76      9e-05  33%  647 aa  MACB2_AERHH RecName: Full=Macrolide export ATP-binding/permease
   23::83      9e-05  36%  229 aa  LOLD_SODGM RecName: Full=Lipoprotein-releasing system ATP-binding
   41::99      9e-05  37%  244 aa  LOLD_RALSO RecName: Full=Lipoprotein-releasing system ATP-binding
   20::80      9e-05  38%  225 aa  LOLD_METFK RecName: Full=Lipoprotein-releasing system ATP-binding
   21::87      9e-05  42%  231 aa  LOLD_BORPE RecName: Full=Lipoprotein-releasing system ATP-binding
   21::87      9e-05  42%  231 aa  LOLD_BORPA RecName: Full=Lipoprotein-releasing system ATP-binding
   21::87      9e-05  42%  231 aa  LOLD_BORBR RecName: Full=Lipoprotein-releasing system ATP-binding
   23::73      9e-05  41%  235 aa  LOLD1_PELLD RecName: Full=Lipoprotein-releasing system
    9::107     9e-05  30%  259 aa  HMUV_VIBCH RecName: Full=Hemin import ATP-binding protein hmuV;    
    1::76      9e-05  34%  261 aa  HMUV_BORAV RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::76      9e-05  34%  261 aa  HMUV_BORA1 RecName: Full=Hemin import ATP-binding protein hmuV;  
   16::65      9e-05  40%  264 aa  HMUV_BARQU RecName: Full=Hemin import ATP-binding protein hmuV;  
  480::549     9e-05  36%  707 aa  HLYB_ECOL6 RecName: Full=Alpha-hemolysin translocation ATP-binding
  478::662     9e-05  24%  706 aa  HLYB_ECO57 RecName: Full=Alpha-hemolysin translocation ATP-binding
  480::549     9e-05  36%  707 aa  HLYBP_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
  480::549     9e-05  36%  707 aa  HLYBC_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
  480::549     9e-05  36%  707 aa  HLYB3_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
   17::71      9e-05  38%  218 aa  FTSE_HAEIN RecName: Full=Cell division ATP-binding protein ftsE;
    3::83      9e-05  26%  376 aa  CYSA_VIBCH RecName: Full=Sulfate/thiosulfate import ATP-binding
    3::65      9e-05  33%  344 aa  CYSA_BRAJA RecName: Full=Sulfate/thiosulfate import ATP-binding
    1::74      9e-05  34%  216 aa  CCMA_SHEFN RecName: Full=Cytochrome c biogenesis ATP-binding
    3::50      9e-05  38%  202 aa  CCMA_MESSB RecName: Full=Cytochrome c biogenesis ATP-binding
    2::50      9e-05  35%  211 aa  CCMA_JANSC RecName: Full=Cytochrome c biogenesis ATP-binding
   25::93      9e-05  34%  282 aa  CBIO2_LACS1 RecName: Full=Cobalt import ATP-binding protein cbiO
   18::90      9e-05  33%  279 aa  CBIO1_ENTFA RecName: Full=Cobalt import ATP-binding protein cbiO
   37::105     9e-05  37%  263 aa  BZTD_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine
   11::74      9e-05  31%  253 aa  BCEA_BACHD RecName: Full=Bacitracin export ATP-binding protein
  942::982     9e-05  54% 1534 aa  ABCG6_DICDI RecName: Full=ABC transporter G family member
  917::957     9e-05  54% 1509 aa  ABCG5_DICDI RecName: Full=ABC transporter G family member
  153::214     9e-05  33% 1397 aa  AB41G_ARATH RecName: Full=ABC transporter G family member 41;      
  451::506     9e-05  36%  680 aa  AB24B_ARATH RecName: Full=ABC transporter B family member 24,
  430::505     9e-05  37%  678 aa  AB23B_ARATH RecName: Full=ABC transporter B family member 23,
 1018::1074    9e-05  35% 1245 aa  AB13B_ARATH RecName: Full=ABC transporter B family member 13;        
   23::71      1e-04  35%  242 aa  ZNUC_EHRCR RecName: Full=Zinc import ATP-binding protein znuC;   
    1::80      1e-04  25%  217 aa  YNJD_ECOLI RecName: Full=Uncharacterized ABC transporter
    3::55      1e-04  40%  642 aa  YDIF_BACSU RecName: Full=Uncharacterized ABC transporter
   21::54      1e-04  47%  245 aa  Y542_CHLPN RecName: Full=Probable metal transport system
   19::82      1e-04  36%  283 aa  Y4342_METAC RecName: Full=Putative ABC transporter ATP-binding
   25::64      1e-04  45%  564 aa  Y119_MYCGE RecName: Full=Putative carbohydrate transport
    1::68      1e-04  36%  273 aa  Y1056_DESVH RecName: Full=Putative ABC transporter ATP-binding
    5::95      1e-04  29%  511 aa  XYLG_BRUSU RecName: Full=Xylose import ATP-binding protein xylG; 
   21::77      1e-04  37%  231 aa  THIQ_SILST RecName: Full=Thiamine import ATP-binding protein
   20::77      1e-04  41%  232 aa  THIQ_SHISS RecName: Full=Thiamine import ATP-binding protein
    5::77      1e-04  41%  235 aa  THIQ_SALTY RecName: Full=Thiamine import ATP-binding protein
  363::413     1e-04  45%  566 aa  SYRD_PSESY RecName: Full=ATP-binding protein syrD;
   31::76      1e-04  37%  260 aa  SSUB1_STRAW RecName: Full=Aliphatic sulfonates import ATP-binding
    6::106     1e-04  30%  260 aa  PSTB_SPHAL RecName: Full=Phosphate import ATP-binding protein pstB;
   22::122     1e-04  30%  275 aa  PSTB_PSEHT RecName: Full=Phosphate import ATP-binding protein pstB;
    1::74      1e-04  26%  373 aa  POTA_MYCVP RecName: Full=Spermidine/putrescine import ATP-binding
    5::88      1e-04  29%  347 aa  POTA_BORAP RecName: Full=Spermidine/putrescine import ATP-binding
   26::89      1e-04  40%  277 aa  PHNC_POLSJ RecName: Full=Phosphonates import ATP-binding protein
   24::74      1e-04  39%  301 aa  PHNC_BURXL RecName: Full=Phosphonates import ATP-binding protein
   18::92      1e-04  38%  276 aa  PHNC_ALCFA RecName: Full=Phosphonates import ATP-binding protein
   18::92      1e-04  38%  272 aa  PHNC1_RHOPB RecName: Full=Phosphonates import ATP-binding protein
   43::229     1e-04  22%  334 aa  OPPF_SALTY RecName: Full=Oligopeptide transport ATP-binding protein
  351::403     1e-04  36%  599 aa  NDVA_BRUME RecName: Full=Beta-(1-->2)glucan export
  351::403     1e-04  36%  599 aa  NDVA_BRUAB RecName: Full=Beta-(1-->2)glucan export
  351::403     1e-04  36%  599 aa  NDVA_BRUA2 RecName: Full=Beta-(1-->2)glucan export
   41::113     1e-04  37%  360 aa  METN_CORGL RecName: Full=Methionine import ATP-binding protein
   25::208     1e-04  36%  340 aa  METN_CORDI RecName: Full=Methionine import ATP-binding protein
  463::536     1e-04  31%  773 aa  MDL2_YEAST RecName: Full=ATP-dependent permease MDL2,
   24::113     1e-04  39%  643 aa  MACB_WOLSU RecName: Full=Macrolide export ATP-binding/permease
   22::80      1e-04  39%  696 aa  MACB_HAEDU RecName: Full=Macrolide export ATP-binding/permease
   13::55      1e-04  37%  644 aa  MACB_CHRVO RecName: Full=Macrolide export ATP-binding/permease
   22::81      1e-04  35%  657 aa  MACB1_PSEPF RecName: Full=Macrolide export ATP-binding/permease
   20::82      1e-04  38%  227 aa  LOLD_VIBVY RecName: Full=Lipoprotein-releasing system ATP-binding
   20::82      1e-04  38%  227 aa  LOLD_VIBVU RecName: Full=Lipoprotein-releasing system ATP-binding
   21::83      1e-04  33%  230 aa  LOLD_THICR RecName: Full=Lipoprotein-releasing system ATP-binding
    4::83      1e-04  36%  224 aa  LOLD_RHOS4 RecName: Full=Lipoprotein-releasing system ATP-binding
   38::93      1e-04  39%  244 aa  LOLD_RALEJ RecName: Full=Lipoprotein-releasing system ATP-binding
    5::84      1e-04  36%  227 aa  LOLD_PSEF5 RecName: Full=Lipoprotein-releasing system ATP-binding
   21::72      1e-04  40%  224 aa  LOLD_METCA RecName: Full=Lipoprotein-releasing system ATP-binding
   21::71      1e-04  39%  229 aa  LOLD_MARMM RecName: Full=Lipoprotein-releasing system ATP-binding
    3::57      1e-04  41%  227 aa  LOLD_LEGPL RecName: Full=Lipoprotein-releasing system ATP-binding
    3::57      1e-04  41%  227 aa  LOLD_LEGPH RecName: Full=Lipoprotein-releasing system ATP-binding
    3::57      1e-04  41%  227 aa  LOLD_LEGPA RecName: Full=Lipoprotein-releasing system ATP-binding
    4::121     1e-04  29%  354 aa  FBPC_PSEF5 RecName: Full=Fe(3+) ions import ATP-binding protein
    1::89      1e-04  26%  353 aa  FBPC1_RHIME RecName: Full=Fe(3+) ions import ATP-binding protein
    3::80      1e-04  26%  338 aa  CYSA_ANASP RecName: Full=Sulfate/thiosulfate import ATP-binding
   18::65      1e-04  42%  358 aa  CYSA1_CHRVO RecName: Full=Sulfate/thiosulfate import ATP-binding
   18::95      1e-04  37%  278 aa  CMPD_SYNP6 RecName: Full=Bicarbonate transport ATP-binding
   18::95      1e-04  37%  278 aa  CMPD_SYNE7 RecName: Full=Bicarbonate transport ATP-binding
  873::1000    1e-04  26% 1501 aa  CDR1_CANAL RecName: Full=Multidrug resistance protein CDR1;
    1::86      1e-04  33%  216 aa  CCMA_PHOPR RecName: Full=Cytochrome c biogenesis ATP-binding
    1::84      1e-04  33%  271 aa  CBIO_AYWBP RecName: Full=Cobalt import ATP-binding protein cbiO; 
   18::90      1e-04  35%  398 aa  CBIO2_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO
    8::91      1e-04  33%  286 aa  CBIO1_CLOAB RecName: Full=Cobalt import ATP-binding protein cbiO
  468::531     1e-04  30%  727 aa  ATM1_ASPFU RecName: Full=Iron-sulfur clusters transporter atm1,
 1314::1407    1e-04  26% 1615 aa  ABCA4_DICDI RecName: Full=ABC transporter A family member 4;AltName:
  491::557     1e-04  35%  728 aa  AB25B_ARATH RecName: Full=ABC transporter B family member 25,
   48::92      1e-04  44%  271 aa  AB10I_ARATH RecName: Full=ABC transporter I family member 10,
    4::51      2e-04  35%  255 aa  ZNUC_SODGM RecName: Full=Zinc import ATP-binding protein znuC;   
   10::53      2e-04  36%  252 aa  YHDZ_ECOLI RecName: Full=Uncharacterized amino-acid ABC
   20::77      2e-04  33%  570 aa  Y2708_STAAC RecName: Full=Putative ABC transporter ATP-binding
   20::77      2e-04  33%  570 aa  Y2684_STAAM RecName: Full=Putative ABC transporter ATP-binding
   20::77      2e-04  33%  570 aa  Y2476_STAAN RecName: Full=Putative ABC transporter ATP-binding
   21::92      2e-04  34%  284 aa  Y2439_THEEB RecName: Full=Putative ABC transporter ATP-binding
   70::121     2e-04  40%  302 aa  SSUB_FRASC RecName: Full=Aliphatic sulfonates import ATP-binding
    6::100     2e-04  35%  253 aa  PSTB_METHJ RecName: Full=Phosphate import ATP-binding protein pstB;
   47::143     2e-04  29%  297 aa  PSTB_ALCBS RecName: Full=Phosphate import ATP-binding protein pstB;
    8::51      2e-04  41%  253 aa  PSTB_AERPE RecName: Full=Phosphate import ATP-binding protein
   26::58      2e-04  52%  338 aa  OPPD_LACLS RecName: Full=Oligopeptide transport ATP-binding
  374::561     2e-04  25%  600 aa  MSBA_SHEDO RecName: Full=Lipid A export ATP-binding/permease
  355::420     2e-04  36%  602 aa  MSBA_PSEPK RecName: Full=Lipid A export ATP-binding/permease
  355::409     2e-04  35%  582 aa  MSBA_PASMU RecName: Full=Lipid A export ATP-binding/permease
  350::410     2e-04  46%  579 aa  MSBA_CHRSD RecName: Full=Lipid A export ATP-binding/permease
    1::48      2e-04  38%  240 aa  MNTB_LISMO RecName: Full=Manganese transport system ATP-binding
    1::205     2e-04  27%  344 aa  METN_RALEH RecName: Full=Methionine import ATP-binding protein
   36::93      2e-04  41%  365 aa  METN_PROAC RecName: Full=Methionine import ATP-binding protein
   21::204     2e-04  32%  362 aa  METN_BORPE RecName: Full=Methionine import ATP-binding protein
   21::204     2e-04  32%  362 aa  METN_BORPA RecName: Full=Methionine import ATP-binding protein
   21::204     2e-04  32%  362 aa  METN_BORBR RecName: Full=Methionine import ATP-binding protein
    1::113     2e-04  30%  342 aa  METN3_BACSK RecName: Full=Methionine import ATP-binding protein
 1049::1238    2e-04  24% 1280 aa  MDR1_HUMAN RecName: Full=Multidrug resistance protein 1;       
    6::84      2e-04  28%  294 aa  MALK_ENTAE RecName: Full=Maltose/maltodextrin import ATP-binding
   21::76      2e-04  38%  651 aa  MACB_CHLTE RecName: Full=Macrolide export ATP-binding/permease
    2::81      2e-04  35%  657 aa  MACB1_PSEU2 RecName: Full=Macrolide export ATP-binding/permease
    5::81      2e-04  35%  656 aa  MACB1_PSESM RecName: Full=Macrolide export ATP-binding/permease
   31::92      2e-04  40%  240 aa  LOLD_XYLFT RecName: Full=Lipoprotein-releasing system ATP-binding
   31::92      2e-04  40%  240 aa  LOLD_XYLFA RecName: Full=Lipoprotein-releasing system ATP-binding
   24::83      2e-04  31%  225 aa  LOLD_SPHAL RecName: Full=Lipoprotein-releasing system ATP-binding
    9::81      2e-04  30%  228 aa  LOLD_SACD2 RecName: Full=Lipoprotein-releasing system ATP-binding
  481::663     2e-04  25%  708 aa  LKTB_PASTR RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKTB7_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB2B_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB2A_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB1B_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB1A_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB14_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  481::663     2e-04  25%  708 aa  LKB13_PASHA RecName: Full=Leukotoxin translocation ATP-binding
    4::40      2e-04  43%  251 aa  HMUV_SHEON RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::49      2e-04  39%  262 aa  HMUV_PLESH RecName: Full=Hemin import ATP-binding protein hmuV;  
   27::70      2e-04  41%  265 aa  HMUV_PASPI RecName: Full=Hemin import ATP-binding protein hmuV;  
    3::69      2e-04  28%  341 aa  CYSA2_AGRT5 RecName: Full=Sulfate/thiosulfate import ATP-binding
   25::59      2e-04  43%  215 aa  CCMA_XYLFT RecName: Full=Cytochrome c biogenesis ATP-binding
   16::95      2e-04  32%  211 aa  CCMA_GLUOX RecName: Full=Cytochrome c biogenesis ATP-binding
    1::85      2e-04  27%  264 aa  CBIO1_FUSNN RecName: Full=Cobalt import ATP-binding protein cbiO
  743::824     2e-04  27% 1394 aa  AUS1_YEAST RecName: Full=ATP-dependent permease AUS1;
   44::124     2e-04  32%  519 aa  ARAG2_BURCM RecName: Full=Arabinose import ATP-binding protein araG
    2::87      2e-04  36%  260 aa  ABCX_STRMU RecName: Full=Putative ABC transporter ATP-binding
  608::643     2e-04  47% 1593 aa  ABCC8_DICDI RecName: Full=ABC transporter C family member
 1947::2073    2e-04  29% 2310 aa  ABCA4_MOUSE RecName: Full=Retinal-specific ATP-binding cassette
   77::116     2e-04  42%  662 aa  AB25G_ARATH RecName: Full=ABC transporter G family member 25;      
  361::563     2e-04  33% 1225 aa  AB18B_ARATH RecName: Full=ABC transporter B family member 18;      
    3::52      2e-04  30%  257 aa  ZNUC_PHOPR RecName: Full=Zinc import ATP-binding protein znuC;   
   13::63      2e-04  35%  298 aa  ZNUC_BRUME RecName: Full=Zinc import ATP-binding protein znuC;   
   24::72      2e-04  29%  243 aa  ZNUC_ANAPZ RecName: Full=Zinc import ATP-binding protein znuC;   
    6::97      2e-04  24%  301 aa  YVFR_BACSU RecName: Full=Uncharacterized ABC transporter
   15::68      2e-04  41%  277 aa  YRIBC_METTM RecName: Full=Putative ABC transporter ATP-binding
    9::86      2e-04  36%  266 aa  YFMF_BACSU RecName: Full=Fe(3+)-citrate import ATP-binding
   15::85      2e-04  28%  360 aa  YCJV_ECOUT RecName: Full=Uncharacterized ABC transporter
   24::50      2e-04  56%  326 aa  Y334_MYCPN RecName: Full=Putative ABC transporter ATP-binding
   25::64      2e-04  42%  572 aa  Y258_MYCPN RecName: Full=Putative carbohydrate transport
    7::86      2e-04  39%  242 aa  Y1631_HALSA RecName: Full=Putative ABC transporter ATP-binding
   17::78      2e-04  38%  224 aa  Y1508_METJA RecName: Full=Uncharacterized ABC transporter
  364::420     2e-04  35%  589 aa  Y015_MYCGE RecName: Full=Putative ABC transporter ATP-binding
    2::145     2e-04  25%  503 aa  XYLG_HAEIN RecName: Full=Xylose import ATP-binding protein xylG;   
   15::77      2e-04  35%  234 aa  THIQ_VIBF1 RecName: Full=Thiamine import ATP-binding protein
   24::82      2e-04  34%  241 aa  THIQ_BRUSU RecName: Full=Thiamine import ATP-binding protein
   24::82      2e-04  34%  241 aa  THIQ_BRUME RecName: Full=Thiamine import ATP-binding protein
  497::546     2e-04  34%  725 aa  TAP1_RAT RecName: Full=Antigen peptide transporter 1;       
   46::129     2e-04  36%  466 aa  TAGH_LACLA RecName: Full=Teichoic acids export ATP-binding protein
 1532::1593    2e-04  31% 1906 aa  TAGB_DICDI RecName: Full=Prestalk-specific protein tagB;       
   11::51      2e-04  37%  242 aa  SSUB1_PARDP RecName: Full=Aliphatic sulfonates import ATP-binding
    2::98      2e-04  32%  251 aa  PSTB_THEMA RecName: Full=Phosphate import ATP-binding protein
   12::111     2e-04  33%  272 aa  PSTB_SYNS9 RecName: Full=Phosphate import ATP-binding protein pstB;
   28::121     2e-04  33%  274 aa  PSTB_RHOP2 RecName: Full=Phosphate import ATP-binding protein pstB;
   20::113     2e-04  31%  271 aa  PSTB3_SYNY3 RecName: Full=Phosphate import ATP-binding protein pstB
   22::115     2e-04  30%  268 aa  PSTB2_RHIL3 RecName: Full=Phosphate import ATP-binding protein pstB
    5::111     2e-04  31%  261 aa  PHNC_BDEBA RecName: Full=Phosphonates import ATP-binding protein
   33::77      2e-04  42%  273 aa  PHNC1_HALMA RecName: Full=Phosphonates import ATP-binding protein
   21::86      2e-04  33%  377 aa  MSMK_STRMU RecName: Full=Multiple sugar-binding transport
  345::425     2e-04  31%  589 aa  MSBA_XYLFT RecName: Full=Lipid A export ATP-binding/permease
  360::412     2e-04  36%  581 aa  MSBA_RHOFD RecName: Full=Lipid A export ATP-binding/permease
  333::403     2e-04  33%  582 aa  MSBA_ALCBS RecName: Full=Lipid A export ATP-binding/permease
   24::98      2e-04  37%  370 aa  MODC_RHILO RecName: Full=Molybdenum import ATP-binding protein
   17::120     2e-04  31%  344 aa  METN_VIBVY RecName: Full=Methionine import ATP-binding protein
   17::120     2e-04  31%  344 aa  METN_VIBVU RecName: Full=Methionine import ATP-binding protein
   18::80      2e-04  38%  341 aa  METN_PARUW RecName: Full=Methionine import ATP-binding protein
  411::464     2e-04  35% 1286 aa  MDR3_HUMAN RecName: Full=Multidrug resistance protein 3;       
 1046::1114    2e-04  36% 1268 aa  MDR3_CAEEL RecName: Full=Multidrug resistance protein 3;       
    6::84      2e-04  28%  369 aa  MALK_SALTY RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      2e-04  28%  369 aa  MALK_SALTI RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      2e-04  28%  369 aa  MALK_SALCH RecName: Full=Maltose/maltodextrin import ATP-binding
    3::76      2e-04  40%  652 aa  MACB1_PSEF5 RecName: Full=Macrolide export ATP-binding/permease
    5::82      2e-04  36%  227 aa  LOLD_PSEPK RecName: Full=Lipoprotein-releasing system ATP-binding
   26::78      2e-04  36%  227 aa  LOLD_PELCD RecName: Full=Lipoprotein-releasing system ATP-binding
   27::211     2e-04  27%  231 aa  LOLD_DESDG RecName: Full=Lipoprotein-releasing system ATP-binding
  481::663     2e-04  25%  708 aa  LKTB_MANGL RecName: Full=Leukotoxin translocation ATP-binding
  481::610     2e-04  31%  708 aa  LKB16_PASHA RecName: Full=Leukotoxin translocation ATP-binding
    1::67      2e-04  34%  273 aa  HMUV_BURS3 RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::84      2e-04  29%  242 aa  GLNQ_BACSU RecName: Full=Glutamine transport ATP-binding protein
    3::80      2e-04  27%  345 aa  CYSA_VIBVU RecName: Full=Sulfate/thiosulfate import ATP-binding
  854::981     2e-04  26% 1501 aa  CDR3_CANAL RecName: Full=Opaque-specific ABC transporter CDR3;
    4::92      2e-04  28%  269 aa  CBIO2_STAAW RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      2e-04  28%  269 aa  CBIO2_STAAS RecName: Full=Cobalt import ATP-binding protein cbiO
   22::136     2e-04  35%  278 aa  CBIO2_LACC3 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
   10::64      2e-04  45%  249 aa  BTUD_CITK8 RecName: Full=Vitamin B12 import ATP-binding protein
    3::44      2e-04  40%  243 aa  ARTP_HAEIN RecName: Full=Arginine transport ATP-binding protein
  398::533     2e-04  30% 1049 aa  ADP1_YEAST RecName: Full=Probable ATP-dependent permease;Flags:
  376::548     2e-04  25% 1230 aa  AB5B_ARATH RecName: Full=ABC transporter B family member 5;        
  137::217     2e-04  36% 1400 aa  AB30G_ARATH RecName: Full=ABC transporter G family member 30;      
  417::598     2e-04  25% 1292 aa  AB21B_ARATH RecName: Full=ABC transporter B family member 21;      
  377::441     2e-04  32% 1247 aa  AB14B_ARATH RecName: Full=ABC transporter B family member 14;      
  342::393     3e-04  35%  547 aa  YOJI_ECOLI RecName: Full=ABC transporter ATP-binding protein yojI;
  258::329     3e-04  31%  487 aa  YL44_SCHPO RecName: Full=Uncharacterized ABC transporter
   20::77      3e-04  33%  570 aa  Y2603_STAAW RecName: Full=Putative ABC transporter ATP-binding
   20::77      3e-04  33%  570 aa  Y2569_STAAS RecName: Full=Putative ABC transporter ATP-binding
  310::382     3e-04  35%  581 aa  Y1996_METMA RecName: Full=Putative ABC transporter ATP-binding
    4::87      3e-04  30%  239 aa  Y1388_BRUA2 RecName: Full=Putative ABC transporter ATP-binding
    4::87      3e-04  30%  239 aa  Y1368_BRUSU RecName: Full=Putative ABC transporter ATP-binding
    4::87      3e-04  30%  239 aa  Y1365_BRUAB RecName: Full=Putative ABC transporter ATP-binding
    8::67      3e-04  30%  539 aa  Y1242_METJA RecName: Full=Uncharacterized ABC transporter
   21::83      3e-04  30%  372 aa  UGPC_VIBCH RecName: Full=sn-glycerol-3-phosphate import
   57::110     3e-04  33%  319 aa  SSUB1_BURCH RecName: Full=Aliphatic sulfonates import ATP-binding
   57::110     3e-04  33%  319 aa  SSUB1_BURCA RecName: Full=Aliphatic sulfonates import ATP-binding
  193::226     3e-04  50%  366 aa  RSGA_STRCO RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   14::221     3e-04  24%  267 aa  PSTB_XYLFA RecName: Full=Phosphate import ATP-binding protein pstB;
   19::119     3e-04  28%  272 aa  PSTB_SHEDO RecName: Full=Phosphate import ATP-binding protein pstB;
    4::99      3e-04  30%  250 aa  PSTB_PYRAE RecName: Full=Phosphate import ATP-binding protein pstB;
    3::93      3e-04  33%  247 aa  PSTB_METCA RecName: Full=Phosphate import ATP-binding protein
   30::96      3e-04  40%  400 aa  PROV_SALTY RecName: Full=Glycine betaine/L-proline transport
   30::96      3e-04  40%  400 aa  PROV_ECOLI RecName: Full=Glycine betaine/L-proline transport
   24::91      3e-04  28%  361 aa  POTA_PSEPF RecName: Full=Spermidine/putrescine import ATP-binding
   20::108     3e-04  36%  257 aa  PHNC_STAES RecName: Full=Phosphonates import ATP-binding protein
   20::108     3e-04  36%  257 aa  PHNC_STAEQ RecName: Full=Phosphonates import ATP-binding protein
   21::71      3e-04  35%  281 aa  PHNC_RALEJ RecName: Full=Phosphonates import ATP-binding protein
  362::416     3e-04  36%  590 aa  MSBA_RALEJ RecName: Full=Lipid A export ATP-binding/permease
  358::411     3e-04  39%  597 aa  MSBA_NITOC RecName: Full=Lipid A export ATP-binding/permease
  365::424     3e-04  35%  596 aa  MSBA_BURPS RecName: Full=Lipid A export ATP-binding/permease
  365::424     3e-04  35%  596 aa  MSBA_BURP1 RecName: Full=Lipid A export ATP-binding/permease
  365::424     3e-04  35%  596 aa  MSBA_BURMA RecName: Full=Lipid A export ATP-binding/permease
  358::411     3e-04  33%  584 aa  MSBA_BLOPB RecName: Full=Lipid A export ATP-binding/permease
   18::72      3e-04  38%  367 aa  MODC_GRABC RecName: Full=Molybdenum import ATP-binding protein
   17::80      3e-04  39%  347 aa  METN_STRAW RecName: Full=Methionine import ATP-binding protein
   21::80      3e-04  37%  343 aa  METN_SHIFL RecName: Full=Methionine import ATP-binding protein
   21::80      3e-04  37%  343 aa  METN_SHIF8 RecName: Full=Methionine import ATP-binding protein
   21::80      3e-04  40%  344 aa  METN_PHOPR RecName: Full=Methionine import ATP-binding protein
   21::73      3e-04  42%  345 aa  METN_MANSM RecName: Full=Methionine import ATP-binding protein
   28::83      3e-04  39%  354 aa  METN_LACBA RecName: Full=Methionine import ATP-binding protein
   16::73      3e-04  34%  340 aa  METN_DESHY RecName: Full=Methionine import ATP-binding protein
   49::144     3e-04  44%  386 aa  METN2_BURXL RecName: Full=Methionine import ATP-binding protein
   21::80      3e-04  37%  343 aa  METN1_SALPA RecName: Full=Methionine import ATP-binding protein
    6::84      3e-04  28%  371 aa  MALK_SHISS RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_SHIFL RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_SHIF8 RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  369 aa  MALK_SALPA RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_ECOUT RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_ECOLI RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_ECOL6 RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_ECOL5 RecName: Full=Maltose/maltodextrin import ATP-binding
    6::84      3e-04  28%  371 aa  MALK_ECO57 RecName: Full=Maltose/maltodextrin import ATP-binding
   25::81      3e-04  35%  656 aa  MACB_PSE14 RecName: Full=Macrolide export ATP-binding/permease
    2::79      3e-04  28%  647 aa  MACB_PHOLL RecName: Full=Macrolide export ATP-binding/permease
   16::86      3e-04  34%  660 aa  MACB_BARQU RecName: Full=Macrolide export ATP-binding/permease
   18::87      3e-04  36%  232 aa  LOLD_ZYMMO RecName: Full=Lipoprotein-releasing system ATP-binding
   24::82      3e-04  39%  226 aa  LOLD_RHILO RecName: Full=Lipoprotein-releasing system ATP-binding
    5::82      3e-04  35%  227 aa  LOLD_PSEU2 RecName: Full=Lipoprotein-releasing system ATP-binding
    5::82      3e-04  35%  227 aa  LOLD_PSESM RecName: Full=Lipoprotein-releasing system ATP-binding
    5::82      3e-04  35%  227 aa  LOLD_PSE14 RecName: Full=Lipoprotein-releasing system ATP-binding
  481::540     3e-04  35%  708 aa  LKTB_PASSP RecName: Full=Leukotoxin translocation ATP-binding
  382::444     3e-04  30% 1323 aa  HST6_CANAL RecName: Full=Alpha-factor-transporting ATPase;       
  352::531     3e-04  24%  623 aa  GSIA_ERWCT RecName: Full=Glutathione import ATP-binding protein
   16::43      3e-04  57%  242 aa  GLNQ_BACST RecName: Full=Glutamine transport ATP-binding protein
  284::339     3e-04  29%  547 aa  EXPZ_BACSU RecName: Full=Nucleotide-binding protein expZ;
   21::92      3e-04  37%  281 aa  CBIO1_BACLD RecName: Full=Cobalt import ATP-binding protein cbiO
   77::147     3e-04  48%  678 aa  ABCG1_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  374::429     3e-04  41% 1241 aa  AB8B_ARATH RecName: Full=Putative ABC transporter B family member
  513::546     3e-04  47%  723 aa  AB4F_ARATH RecName: Full=ABC transporter F family member 4;        
 1056::1238    3e-04  24% 1286 aa  AB4B_ARATH RecName: Full=ABC transporter B family member 4;       
  174::250     3e-04  24% 1450 aa  AB37G_ARATH RecName: Full=ABC transporter G family member 37;      
   30::79      3e-04  40%  329 aa  YKFD_BACSU RecName: Full=Putative oligopeptide transport
  312::363     3e-04  40%  637 aa  YHES_ECOLI RecName: Full=Uncharacterized ABC transporter
  312::363     3e-04  40%  637 aa  YHES_ECO57 RecName: Full=Uncharacterized ABC transporter
    9::50      3e-04  45%  244 aa  YCXD_CYAPA RecName: Full=Probable ABC transporter ATP-binding
   20::100     3e-04  27%  371 aa  Y4OS_RHISN RecName: Full=Uncharacterized ABC transporter
   21::55      3e-04  43%  573 aa  Y1704_LACJO RecName: Full=Putative ABC transporter ATP-binding
    4::88      3e-04  26%  513 aa  XYLG_SHIFL RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_SHIF8 RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_SHIBS RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_ECOUT RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_ECOL6 RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_ECOL5 RecName: Full=Xylose import ATP-binding protein xylG; 
    4::88      3e-04  26%  513 aa  XYLG_ECO57 RecName: Full=Xylose import ATP-binding protein xylG; 
    5::95      3e-04  27%  511 aa  XYLG_BRUME RecName: Full=Xylose import ATP-binding protein xylG; 
    2::63      3e-04  31%  635 aa  UUP_ECOLI RecName: Full=ABC transporter ATP-binding protein uup;
   28::86      3e-04  36%  241 aa  THIQ_PHOPR RecName: Full=Thiamine import ATP-binding protein
    8::89      3e-04  30%  247 aa  SSUB3_BACSK RecName: Full=Aliphatic sulfonates import ATP-binding
    3::75      3e-04  27%  239 aa  SKFE_BACSU RecName: Full=SkfA peptide export ATP-binding protein
   37::98      3e-04  40%  437 aa  RFBB_MYXXA RecName: Full=O-antigen export system ATP-binding
   22::126     3e-04  34%  258 aa  PSTB_RHOSR RecName: Full=Phosphate import ATP-binding protein pstB;
   22::126     3e-04  36%  258 aa  PSTB_MYCSM RecName: Full=Phosphate import ATP-binding protein pstB;
   22::126     3e-04  36%  258 aa  PSTB_MYCS2 RecName: Full=Phosphate import ATP-binding protein pstB;
    3::104     3e-04  31%  257 aa  PSTB_CHRVO RecName: Full=Phosphate import ATP-binding protein pstB;
    3::132     3e-04  26%  251 aa  PSTB2_LACAC RecName: Full=Phosphate import ATP-binding protein pstB
   17::117     3e-04  32%  270 aa  PSTB1_YERPS RecName: Full=Phosphate import ATP-binding protein pstB
   17::117     3e-04  32%  270 aa  PSTB1_YERPN RecName: Full=Phosphate import ATP-binding protein pstB
   17::117     3e-04  32%  270 aa  PSTB1_YERPE RecName: Full=Phosphate import ATP-binding protein pstB
   17::117     3e-04  32%  270 aa  PSTB1_YERPA RecName: Full=Phosphate import ATP-binding protein pstB
    5::99      3e-04  29%  252 aa  PSTB1_STRA5 RecName: Full=Phosphate import ATP-binding protein
    5::99      3e-04  29%  252 aa  PSTB1_STRA3 RecName: Full=Phosphate import ATP-binding protein
    5::99      3e-04  29%  252 aa  PSTB1_STRA1 RecName: Full=Phosphate import ATP-binding protein
    4::87      3e-04  27%  519 aa  POTA_UREPA RecName: Full=Spermidine/putrescine import ATP-binding
    1::68      3e-04  31%  269 aa  PHNC_BRAJA RecName: Full=Phosphonates import ATP-binding protein
   32::75      3e-04  56%  272 aa  PHNC2_SILST RecName: Full=Phosphonates import ATP-binding protein
  165::247     3e-04  26% 1454 aa  PDR5_ORYSJ RecName: Full=Pleiotropic drug resistance protein 5;
  193::251     3e-04  31% 1468 aa  PDR1_ORYSJ RecName: Full=Probable pleiotropic drug resistance
   17::80      3e-04  34%  233 aa  OPPF2_STAAW RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAS RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAR RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAN RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAM RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAC RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAAB RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAA8 RecName: Full=Putative oligopeptide transport
   17::80      3e-04  34%  233 aa  OPPF2_STAA3 RecName: Full=Putative oligopeptide transport
  353::403     3e-04  35%  584 aa  NDVA_AGRVI RecName: Full=Beta-(1-->2)glucan export
  373::562     3e-04  26%  601 aa  MSBA_SHESR RecName: Full=Lipid A export ATP-binding/permease
  373::562     3e-04  26%  601 aa  MSBA_SHESM RecName: Full=Lipid A export ATP-binding/permease
  357::410     3e-04  31%  588 aa  MSBA_LEGPL RecName: Full=Lipid A export ATP-binding/permease
  357::410     3e-04  31%  588 aa  MSBA_LEGPH RecName: Full=Lipid A export ATP-binding/permease
  357::410     3e-04  31%  588 aa  MSBA_LEGPA RecName: Full=Lipid A export ATP-binding/permease
   17::73      3e-04  39%  358 aa  METN_STRGR RecName: Full=Methionine import ATP-binding protein
   21::73      3e-04  38%  328 aa  METN2_YERPE RecName: Full=Methionine import ATP-binding protein
   21::73      3e-04  38%  328 aa  METN2_YERPA RecName: Full=Methionine import ATP-binding protein
   53::145     3e-04  39%  376 aa  METN2_PSEU2 RecName: Full=Methionine import ATP-binding protein
   53::145     3e-04  39%  376 aa  METN2_PSE14 RecName: Full=Methionine import ATP-binding protein
   21::134     3e-04  36%  341 aa  METN2_BACLD RecName: Full=Methionine import ATP-binding protein
   21::73      3e-04  38%  328 aa  METN1_YERPS RecName: Full=Methionine import ATP-binding protein
   21::73      3e-04  38%  328 aa  METN1_YERPN RecName: Full=Methionine import ATP-binding protein
    4::80      3e-04  32%  650 aa  MACB_ERWCT RecName: Full=Macrolide export ATP-binding/permease
    1::64      3e-04  31%  258 aa  HMUV_IDILO RecName: Full=Hemin import ATP-binding protein hmuV;  
    1::78      3e-04  29%  242 aa  GLUA_CORGL RecName: Full=Glutamate transport ATP-binding protein
   18::69      3e-04  40%  222 aa  FTSE_SHIFL RecName: Full=Cell division ATP-binding protein ftsE;
   18::69      3e-04  40%  222 aa  FTSE_ECOLI RecName: Full=Cell division ATP-binding protein ftsE;
   18::69      3e-04  40%  222 aa  FTSE_ECOL6 RecName: Full=Cell division ATP-binding protein ftsE;
   18::69      3e-04  40%  222 aa  FTSE_ECO57 RecName: Full=Cell division ATP-binding protein ftsE;
    3::44      3e-04  38%  255 aa  FECE_ECOLI RecName: Full=Fe(3+) dicitrate transport ATP-binding
 1211::1254    3e-04  43% 1481 aa  CFTR_COLGU RecName: Full=Cystic fibrosis transmembrane conductance
    3::65      3e-04  38%  215 aa  CCMA_RHIET RecName: Full=Cytochrome c biogenesis ATP-binding
    3::65      3e-04  38%  215 aa  CCMA_RHIEC RecName: Full=Cytochrome c biogenesis ATP-binding
   12::79      3e-04  42%  258 aa  CCMA_GRABC RecName: Full=Cytochrome c biogenesis ATP-binding
    3::51      3e-04  35%  211 aa  CCMA2_RALME RecName: Full=Cytochrome c biogenesis ATP-binding
   15::87      3e-04  33%  280 aa  CBIO_SYNAS RecName: Full=Cobalt import ATP-binding protein cbiO; 
   16::90      3e-04  42%  278 aa  CBIO_METST RecName: Full=Cobalt import ATP-binding protein cbiO; 
    3::200     3e-04  27%  279 aa  CBIO2_STRA5 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    3::200     3e-04  27%  279 aa  CBIO2_STRA3 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    3::200     3e-04  27%  279 aa  CBIO2_STRA1 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    3::214     3e-04  23%  308 aa  AMIF_STRPN RecName: Full=Oligopeptide transport ATP-binding protein
  434::486     3e-04  36% 1321 aa  ABCBB_RABIT RecName: Full=Bile salt export pump;AltName:
   99::206     3e-04  31%  467 aa  AB21G_ARATH RecName: Full=ABC transporter G family member 21;      
  353::407     4e-04  33%  576 aa  Y691_RICTY RecName: Full=Putative export ATP-binding/permease
   26::58      4e-04  55%  569 aa  Y1589_THETN RecName: Full=Putative ABC transporter ATP-binding
   11::85      4e-04  27%  263 aa  Y1272_HAEIN RecName: Full=Uncharacterized ABC transporter
    5::72      4e-04  34%  254 aa  Y089_METJA RecName: Full=Uncharacterized ABC transporter
  465::531     4e-04  31% 1063 aa  WBC30_ARATH RecName: Full=Putative white-brown complex homolog
   19::77      4e-04  37%  231 aa  THIQ_RHOS4 RecName: Full=Thiamine import ATP-binding protein
    4::76      4e-04  33%  214 aa  THIQ_HAES1 RecName: Full=Thiamine import ATP-binding protein
   23::83      4e-04  33%  238 aa  THIQ_AGRT5 RecName: Full=Thiamine import ATP-binding protein
   20::77      4e-04  31%  240 aa  SSUB_ZYMMO RecName: Full=Aliphatic sulfonates import ATP-binding
   15::86      4e-04  31%  268 aa  SSUB_PSEPF RecName: Full=Aliphatic sulfonates import ATP-binding
   12::69      4e-04  33%  241 aa  SSUB_DELAC RecName: Full=Aliphatic sulfonates import ATP-binding
   17::64      4e-04  38%  270 aa  SSUB3_PSE14 RecName: Full=Aliphatic sulfonates import ATP-binding
   19::119     4e-04  28%  272 aa  PSTB_SHEFN RecName: Full=Phosphate import ATP-binding protein pstB;
   21::114     4e-04  31%  267 aa  PSTB_RHILO RecName: Full=Phosphate import ATP-binding protein pstB;
   31::124     4e-04  33%  277 aa  PSTB_PSEPF RecName: Full=Phosphate import ATP-binding protein pstB;
   22::127     4e-04  35%  258 aa  PSTB_MYCSS RecName: Full=Phosphate import ATP-binding protein pstB;
   28::118     4e-04  35%  271 aa  PSTB_BACHK RecName: Full=Phosphate import ATP-binding protein pstB;
   47::125     4e-04  39%  278 aa  PSTB_BACHD RecName: Full=Phosphate import ATP-binding protein pstB;
   28::118     4e-04  35%  271 aa  PSTB_BACCZ RecName: Full=Phosphate import ATP-binding protein pstB;
   28::118     4e-04  35%  271 aa  PSTB_BACCR RecName: Full=Phosphate import ATP-binding protein pstB;
   28::118     4e-04  35%  271 aa  PSTB_BACC1 RecName: Full=Phosphate import ATP-binding protein pstB;
   28::118     4e-04  35%  271 aa  PSTB_BACAN RecName: Full=Phosphate import ATP-binding protein pstB;
    3::99      4e-04  27%  252 aa  PSTB2_STRT2 RecName: Full=Phosphate import ATP-binding protein
    3::99      4e-04  27%  252 aa  PSTB2_STRT1 RecName: Full=Phosphate import ATP-binding protein
    2::96      4e-04  30%  249 aa  PSTB2_SHEON RecName: Full=Phosphate import ATP-binding protein
    3::105     4e-04  30%  258 aa  PSTB2_ERWCT RecName: Full=Phosphate import ATP-binding protein pstB
   32::97      4e-04  30%  370 aa  POTA_SILST RecName: Full=Spermidine/putrescine import ATP-binding
   24::89      4e-04  30%  363 aa  POTA_ROSDO RecName: Full=Spermidine/putrescine import ATP-binding
    3::76      4e-04  28%  417 aa  POTA_ONYPE RecName: Full=Spermidine/putrescine import ATP-binding
   26::58      4e-04  48%  338 aa  OPPD_LACLA RecName: Full=Oligopeptide transport ATP-binding
    3::85      4e-04  27%  303 aa  NODI_RALME RecName: Full=Nod factor export ATP-binding protein I;
   16::69      4e-04  33%  304 aa  NODI_BURTA RecName: Full=Nod factor export ATP-binding protein I;
  369::434     4e-04  33%  600 aa  NIST_LACLA RecName: Full=Nisin transport ATP-binding protein nisT;
  353::415     4e-04  36%  595 aa  NDVA_BARQU RecName: Full=Beta-(1-->2)glucan export
  354::402     4e-04  39%  581 aa  MSBA_WIGBR RecName: Full=Lipid A export ATP-binding/permease
  372::561     4e-04  26%  600 aa  MSBA_SHEFN RecName: Full=Lipid A export ATP-binding/permease
  365::554     4e-04  27%  596 aa  MSBA_BURTA RecName: Full=Lipid A export ATP-binding/permease
   21::89      4e-04  37%  344 aa  METN_VIBPA RecName: Full=Methionine import ATP-binding protein
   20::76      4e-04  42%  351 aa  METN_RHORT RecName: Full=Methionine import ATP-binding protein
   21::107     4e-04  42%  344 aa  METN_HAEDU RecName: Full=Methionine import ATP-binding protein
    8::50      4e-04  37%  341 aa  METN_CHLCV RecName: Full=Methionine import ATP-binding protein
   23::205     4e-04  28%  341 aa  METN3_OCEIH RecName: Full=Methionine import ATP-binding protein
   48::165     4e-04  36%  369 aa  METN2_PSEPK RecName: Full=Methionine import ATP-binding protein
   17::142     4e-04  31%  335 aa  METN2_PSEAE RecName: Full=Methionine import ATP-binding protein
   17::142     4e-04  31%  335 aa  METN2_PSEAB RecName: Full=Methionine import ATP-binding protein
   53::145     4e-04  38%  376 aa  METN1_PSESM RecName: Full=Methionine import ATP-binding protein
   17::70      4e-04  33%  335 aa  METN1_PSEPK RecName: Full=Methionine import ATP-binding protein
   21::72      4e-04  42%  344 aa  METN1_BURS3 RecName: Full=Methionine import ATP-binding protein
 1047::1117    4e-04  35% 1276 aa  MDR2_MOUSE RecName: Full=Multidrug resistance protein 2;       
   22::81      4e-04  33%  657 aa  MACB2_PSEF5 RecName: Full=Macrolide export ATP-binding/permease
   21::56      4e-04  47%  226 aa  LOLD_PSYA2 RecName: Full=Lipoprotein-releasing system ATP-binding
   20::77      4e-04  33%  232 aa  LOLD_PSEHT RecName: Full=Lipoprotein-releasing system ATP-binding
   19::82      4e-04  31%  227 aa  LOLD_PSEA6 RecName: Full=Lipoprotein-releasing system ATP-binding
   21::57      4e-04  43%  227 aa  LOLD_PASMU RecName: Full=Lipoprotein-releasing system ATP-binding
   40::98      4e-04  39%  247 aa  LOLD_BURXL RecName: Full=Lipoprotein-releasing system ATP-binding
   21::81      4e-04  34%  229 aa  LOLD_BUCAP RecName: Full=Lipoprotein-releasing system ATP-binding
   22::85      4e-04  37%  228 aa  LOLD_ALCBS RecName: Full=Lipoprotein-releasing system ATP-binding
  279::342     4e-04  28%  608 aa  HFAC_CAUCR RecName: Full=Holdfast attachment protein C;       
   20::53      4e-04  50%  216 aa  CTRD_NEIMB RecName: Full=Capsule polysaccharide export
   20::53      4e-04  50%  216 aa  CTRD_NEIMA RecName: Full=Capsule polysaccharide export
  150::206     4e-04  40%  322 aa  CPHB_THEEB RecName: Full=Cyanophycinase;         EC=3.4.15.6;
  150::206     4e-04  40%  322 aa  CPHB_SYNEL RecName: Full=Cyanophycinase;         EC=3.4.15.6;
 1211::1254    4e-04  40% 1481 aa  CFTR_PAPAN RecName: Full=Cystic fibrosis transmembrane conductance
 1211::1254    4e-04  40% 1481 aa  CFTR_MACNE RecName: Full=Cystic fibrosis transmembrane conductance
 1211::1254    4e-04  40% 1481 aa  CFTR_MACMU RecName: Full=Cystic fibrosis transmembrane conductance
 1211::1254    4e-04  40% 1481 aa  CFTR_MACFU RecName: Full=Cystic fibrosis transmembrane conductance
 1211::1254    4e-04  40% 1481 aa  CFTR_MACFA RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     4e-04  36% 1480 aa  CFTR_HUMAN RecName: Full=Cystic fibrosis transmembrane conductance
 1211::1254    4e-04  40% 1481 aa  CFTR_CERAE RecName: Full=Cystic fibrosis transmembrane conductance
   15::89      4e-04  42%  279 aa  CBIO_METJA RecName: Full=Putative cobalt import ATP-binding
  157::265     4e-04  26%  408 aa  CBIO2_MYCMS RecName: Full=Cobalt import ATP-binding protein cbiO 2;
   24::201     4e-04  26%  280 aa  CBIO2_LACSS RecName: Full=Cobalt import ATP-binding protein cbiO 2;
    3::72      4e-04  35%  279 aa  CBIO2_LACBA RecName: Full=Cobalt import ATP-binding protein cbiO
    4::51      4e-04  38%  234 aa  ADCC_STRR6 RecName: Full=Zinc transport system ATP-binding
    4::51      4e-04  38%  234 aa  ADCC_STRPN RecName: Full=Zinc transport system ATP-binding
  524::630     4e-04  29% 1662 aa  ABCA5_DICDI RecName: Full=ABC transporter A family member
   82::155     4e-04  32%  345 aa  AB13I_ARATH RecName: Full=Protein TRIGALACTOSYLDIACYLGLYCEROL 3,
    4::70      6e-04  28%  257 aa  ZURA_LISMO RecName: Full=Zinc uptake system ATP-binding protein
   31::167     6e-04  30%  303 aa  ZNUC_RHIL3 RecName: Full=Zinc import ATP-binding protein znuC;     
   23::85      6e-04  27%  337 aa  YDCT_ECOLI RecName: Full=Uncharacterized ABC transporter
  334::375     6e-04  50%  561 aa  Y5847_STRAW RecName: Full=Putative ABC transporter ATP-binding
  311::414     6e-04  32%  553 aa  Y3323_BACC1 RecName: Full=Putative ABC transporter ATP-binding
  309::412     6e-04  33%  551 aa  Y3105_BACHK RecName: Full=Putative ABC transporter ATP-binding
  328::440     6e-04  26%  590 aa  Y3016_METMA RecName: Full=Putative ABC transporter ATP-binding
  497::558     6e-04  40%  697 aa  Y2353_MYCBO RecName: Full=Uncharacterized ABC transporter
  497::558     6e-04  40%  697 aa  Y2326_MYCTU RecName: Full=Uncharacterized ABC transporter
  383::437     6e-04  31%  623 aa  Y018_MYCPN RecName: Full=Putative ABC transporter ATP-binding
  496::543     6e-04  33%  724 aa  TAP1_MOUSE RecName: Full=Antigen peptide transporter 1;       
   60::110     6e-04  33%  319 aa  SSUB1_BURS3 RecName: Full=Aliphatic sulfonates import ATP-binding
  370::437     6e-04  35%  614 aa  SPAT_BACSU RecName: Full=Subtilin transport ATP-binding protein
    4::96      6e-04  31%  249 aa  PSTB2_THETN RecName: Full=Phosphate import ATP-binding protein
   20::69      6e-04  44%  259 aa  PHNC_THIDA RecName: Full=Phosphonates import ATP-binding protein
    1::68      6e-04  31%  269 aa  PHNC_PSEPK RecName: Full=Phosphonates import ATP-binding protein
   41::228     6e-04  24%  332 aa  OPPF_HAEIN RecName: Full=Oligopeptide transport ATP-binding protein
   25::80      6e-04  34%  670 aa  NRTC_SYNY3 RecName: Full=Nitrate transport ATP-binding protein
  346::425     6e-04  30%  589 aa  MSBA_XYLFA RecName: Full=Lipid A export ATP-binding/permease
  373::562     6e-04  26%  601 aa  MSBA_SHEON RecName: Full=Lipid A export ATP-binding/permease
   10::58      6e-04  35%  260 aa  MNTA_SYNY3 RecName: Full=Manganese transport system ATP-binding
   46::233     6e-04  28%  368 aa  METN_CORJK RecName: Full=Methionine import ATP-binding protein
   17::89      6e-04  31%  335 aa  METN2_PSEE4 RecName: Full=Methionine import ATP-binding protein
   21::80      6e-04  37%  343 aa  METN1_SALTI RecName: Full=Methionine import ATP-binding protein
   23::73      6e-04  37%  338 aa  METN1_LISMO RecName: Full=Methionine import ATP-binding protein
   23::73      6e-04  37%  338 aa  METN1_LISMF RecName: Full=Methionine import ATP-binding protein
   21::73      6e-04  43%  333 aa  METN1_BACLD RecName: Full=Methionine import ATP-binding protein
  350::411     6e-04  36%  590 aa  MDLA_ECOLI RecName: Full=Multidrug resistance-like ATP-binding
    3::80      6e-04  35%  654 aa  MACB_VIBPA RecName: Full=Macrolide export ATP-binding/permease
   16::86      6e-04  32%  660 aa  MACB_BARHE RecName: Full=Macrolide export ATP-binding/permease
   29::88      6e-04  35%  668 aa  MACB2_PSESM RecName: Full=Macrolide export ATP-binding/permease
   19::72      6e-04  39%  219 aa  LOLD_CYTH3 RecName: Full=Lipoprotein-releasing system ATP-binding
  667::723     6e-04  36% 1047 aa  EF3_SCHPO RecName: Full=Elongation factor 3;         Short=EF-3;
   25::225     6e-04  21%  327 aa  DPPF_HAEIN RecName: Full=Dipeptide transport ATP-binding protein
    3::83      6e-04  26%  348 aa  CYSA_MESVI RecName: Full=Probable sulfate/thiosulfate import
   16::50      6e-04  43%  367 aa  CYSA2_RHIME RecName: Full=Sulfate/thiosulfate import ATP-binding
  369::419     6e-04  33%  588 aa  CYDD_ECOLI RecName: Full=ATP-binding/permease protein cydD;
   25::80      6e-04  38%  663 aa  CMPC_SYNP6 RecName: Full=Bicarbonate transport ATP-binding
   25::80      6e-04  38%  663 aa  CMPC_SYNE7 RecName: Full=Bicarbonate transport ATP-binding
  438::487     6e-04  34% 1483 aa  CFTR_ATEAB RecName: Full=Cystic fibrosis transmembrane conductance
  871::998     6e-04  25% 1499 aa  CDR2_CANAL RecName: Full=Multidrug resistance protein CDR2;
    1::49      6e-04  35%  204 aa  CCMA_VIBF1 RecName: Full=Cytochrome c biogenesis ATP-binding
    1::49      6e-04  35%  208 aa  CCMA_PANCI RecName: Full=Cytochrome c biogenesis ATP-binding
   17::50      6e-04  41%  215 aa  CCMA_BRUSU RecName: Full=Cytochrome c biogenesis ATP-binding
   17::50      6e-04  41%  215 aa  CCMA_BRUME RecName: Full=Cytochrome c biogenesis ATP-binding
   17::50      6e-04  41%  215 aa  CCMA_BRUAB RecName: Full=Cytochrome c biogenesis ATP-binding
   17::50      6e-04  41%  215 aa  CCMA_BRUA2 RecName: Full=Cytochrome c biogenesis ATP-binding
    1::49      6e-04  35%  271 aa  CBIO_ONYPE RecName: Full=Putative cobalt import ATP-binding
    2::78      6e-04  32%  278 aa  CBIO_METMP RecName: Full=Cobalt import ATP-binding protein cbiO; 
    4::92      6e-04  28%  269 aa  CBIO2_STAAR RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAAN RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAAM RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAAC RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAAB RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAA8 RecName: Full=Cobalt import ATP-binding protein cbiO
    4::92      6e-04  28%  269 aa  CBIO2_STAA3 RecName: Full=Cobalt import ATP-binding protein cbiO
   21::93      6e-04  41%  285 aa  CBIO2_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO
   19::81      6e-04  32%  286 aa  CBIO1_STAES RecName: Full=Cobalt import ATP-binding protein cbiO
   19::81      6e-04  32%  286 aa  CBIO1_STAEQ RecName: Full=Cobalt import ATP-binding protein cbiO
   21::144     6e-04  33%  282 aa  CBIO1_LACDA RecName: Full=Cobalt import ATP-binding protein cbiO 1;
    2::76      6e-04  35%  251 aa  BTUD_VIBC3 RecName: Full=Vitamin B12 import ATP-binding protein
  447::502     6e-04  36%  691 aa  ATM1_ASHGO RecName: Full=Iron-sulfur clusters transporter ATM1,
    1::66      6e-04  27%  240 aa  ARTM_BACSU RecName: Full=Arginine transport ATP-binding protein
   77::147     6e-04  47%  666 aa  ABCG1_MOUSE RecName: Full=ATP-binding cassette sub-family G member
  455::490     6e-04  44% 1295 aa  AB8C_ARATH RecName: Full=ABC transporter C family member 8;        
 1041::1090    6e-04  36% 1286 aa  AB1B_ARATH RecName: Full=ABC transporter B family member 1;       
   27::163     7e-04  27%  299 aa  ZNUC_AGRT5 RecName: Full=Zinc import ATP-binding protein znuC;     
    1::50      7e-04  28%  540 aa  YKPA_BACSU RecName: Full=Uncharacterized ABC transporter
  347::398     7e-04  33%  573 aa  YFIB_BACSU RecName: Full=Uncharacterized ABC transporter
    4::84      7e-04  34%  228 aa  YBBA_SHIFL RecName: Full=Uncharacterized ABC transporter
    4::84      7e-04  34%  228 aa  YBBA_ECOLI RecName: Full=Uncharacterized ABC transporter
    4::84      7e-04  34%  228 aa  YBBA_ECO57 RecName: Full=Uncharacterized ABC transporter
   21::82      7e-04  34%  308 aa  YADG_ECOLI RecName: Full=Uncharacterized ABC transporter
  325::381     7e-04  30%  560 aa  Y663_HAEIN RecName: Full=Uncharacterized ABC transporter
   18::71      7e-04  31%  444 aa  Y394_METAC RecName: Full=Putative ABC transporter ATP-binding
    4::88      7e-04  26%  513 aa  XYLG_ECOLI RecName: Full=Xylose import ATP-binding protein xylG; 
   20::77      7e-04  40%  232 aa  THIQ_ECOUT RecName: Full=Thiamine import ATP-binding protein
   20::77      7e-04  40%  232 aa  THIQ_ECOL6 RecName: Full=Thiamine import ATP-binding protein
   20::77      7e-04  40%  232 aa  THIQ_ECOL5 RecName: Full=Thiamine import ATP-binding protein
   19::73      7e-04  36%  268 aa  TAUB_ROSDO RecName: Full=Taurine import ATP-binding protein tauB;
   25::79      7e-04  40%  265 aa  TAUB1_BURXL RecName: Full=Taurine import ATP-binding protein tauB
   71::129     7e-04  42%  327 aa  SSUB_BURPS RecName: Full=Aliphatic sulfonates import ATP-binding
   79::137     7e-04  42%  335 aa  SSUB_BURP1 RecName: Full=Aliphatic sulfonates import ATP-binding
   79::137     7e-04  42%  335 aa  SSUB_BURMA RecName: Full=Aliphatic sulfonates import ATP-binding
   17::64      7e-04  38%  270 aa  SSUB3_PSEU2 RecName: Full=Aliphatic sulfonates import ATP-binding
   27::227     7e-04  28%  273 aa  PSTB_RHOPA RecName: Full=Phosphate import ATP-binding protein pstB;
   43::121     7e-04  37%  275 aa  PSTB_HYPNA RecName: Full=Phosphate import ATP-binding protein pstB;
    4::100     7e-04  36%  253 aa  PSTB_CARHZ RecName: Full=Phosphate import ATP-binding protein pstB;
    3::100     7e-04  28%  253 aa  PSTB1_LACLA RecName: Full=Phosphate import ATP-binding protein pstB
   13::140     7e-04  27%  372 aa  POTA_PSEF5 RecName: Full=Spermidine/putrescine import ATP-binding
   19::76      7e-04  36%  327 aa  POTA_BACHK RecName: Full=Spermidine/putrescine import ATP-binding
   19::76      7e-04  36%  327 aa  POTA_BACCZ RecName: Full=Spermidine/putrescine import ATP-binding
   19::76      7e-04  36%  327 aa  POTA_BACC1 RecName: Full=Spermidine/putrescine import ATP-binding
   19::76      7e-04  36%  327 aa  POTA_BACAN RecName: Full=Spermidine/putrescine import ATP-binding
   19::76      7e-04  36%  327 aa  POTA_BACAH RecName: Full=Spermidine/putrescine import ATP-binding
   20::108     7e-04  38%  257 aa  PHNC_STAAW RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAS RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAR RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAN RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAM RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAC RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAAB RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAA8 RecName: Full=Phosphonates import ATP-binding protein
   20::108     7e-04  38%  257 aa  PHNC_STAA3 RecName: Full=Phosphonates import ATP-binding protein
   19::113     7e-04  33%  265 aa  PHNC_PSEPF RecName: Full=Phosphonates import ATP-binding protein
   23::109     7e-04  39%  256 aa  PHNC_LACDB RecName: Full=Phosphonates import ATP-binding protein
   23::109     7e-04  39%  256 aa  PHNC_LACDA RecName: Full=Phosphonates import ATP-binding protein
   27::62      7e-04  44%  268 aa  PHNC_CORGL RecName: Full=Phosphonates import ATP-binding protein
  742::824     7e-04  23% 1411 aa  PDR11_YEAST RecName: Full=ATP-dependent permease PDR11;
  357::409     7e-04  32%  582 aa  MSBA_VIBF1 RecName: Full=Lipid A export ATP-binding/permease
  362::415     7e-04  33%  589 aa  MSBA_POLSJ RecName: Full=Lipid A export ATP-binding/permease
  365::419     7e-04  35%  593 aa  MSBA_BURCA RecName: Full=Lipid A export ATP-binding/permease
 1208::1286    7e-04  33% 1436 aa  MRP5_RAT RecName: Full=Multidrug resistance-associated protein
 1208::1286    7e-04  33% 1436 aa  MRP5_MOUSE RecName: Full=Multidrug resistance-associated protein
 1209::1287    7e-04  33% 1437 aa  MRP5_HUMAN RecName: Full=Multidrug resistance-associated protein
   21::119     7e-04  34%  343 aa  METN_SODGM RecName: Full=Methionine import ATP-binding protein
    8::50      7e-04  40%  341 aa  METN_CHLAB RecName: Full=Methionine import ATP-binding protein
   46::142     7e-04  40%  373 aa  METN1_RHOPA RecName: Full=Methionine import ATP-binding protein
   23::73      7e-04  37%  338 aa  METN1_LISIN RecName: Full=Methionine import ATP-binding protein
 1049::1236    7e-04  25% 1278 aa  MDR2_RAT RecName: Full=Multidrug resistance protein 2;       
  347::378     7e-04  50%  589 aa  MDLA_BUCAI RecName: Full=Multidrug resistance-like ATP-binding
   12::112     7e-04  32%  648 aa  MACB_SHIFL RecName: Full=Macrolide export ATP-binding/permease
   13::80      7e-04  28%  647 aa  MACB_SHESW RecName: Full=Macrolide export ATP-binding/permease
    2::79      7e-04  32%  648 aa  MACB1_AERHH RecName: Full=Macrolide export ATP-binding/permease
   21::56      7e-04  47%  226 aa  LOLD_PSYCK RecName: Full=Lipoprotein-releasing system ATP-binding
   23::83      7e-04  33%  234 aa  LOLD_PHOLL RecName: Full=Lipoprotein-releasing system ATP-binding
   24::85      7e-04  35%  229 aa  LOLD_GRABC RecName: Full=Lipoprotein-releasing system ATP-binding
  351::428     7e-04  32%  607 aa  HEPA_ANASP RecName: Full=Heterocyst differentiation ATP-binding
    4::71      7e-04  28%  269 aa  FHUC_BACSU RecName: Full=Iron(3+)-hydroxamate import ATP-binding
    5::89      7e-04  25%  353 aa  FBPC_BRUME RecName: Full=Fe(3+) ions import ATP-binding protein
    1::67      7e-04  30%  346 aa  FBPC2_ERWCT RecName: Full=Fe(3+) ions import ATP-binding protein
    3::61      7e-04  42%  215 aa  CCMA_RHIL3 RecName: Full=Cytochrome c biogenesis ATP-binding
   18::80      7e-04  35%  226 aa  CCMA_RALEJ RecName: Full=Cytochrome c biogenesis ATP-binding
    3::106     7e-04  34%  207 aa  CCMA_METCA RecName: Full=Cytochrome c biogenesis ATP-binding export
    7::64      7e-04  36%  204 aa  CCMA_CAUCR RecName: Full=Cytochrome c biogenesis ATP-binding
    2::139     7e-04  33%  214 aa  CCMA_AZOSE RecName: Full=Cytochrome c biogenesis ATP-binding export
   18::55      7e-04  42%  279 aa  CBIO_ENTFC RecName: Full=Cobalt import ATP-binding protein cbiO; 
    2::90      7e-04  32%  278 aa  CBIO2_STRSV RecName: Full=Cobalt import ATP-binding protein cbiO
    3::90      7e-04  32%  279 aa  CBIO1_GEOKA RecName: Full=Cobalt import ATP-binding protein cbiO
    3::48      7e-04  39%  242 aa  ARTP_SHIFL RecName: Full=Arginine transport ATP-binding protein
    3::48      7e-04  39%  242 aa  ARTP_ECOLI RecName: Full=Arginine transport ATP-binding protein
    3::48      7e-04  39%  242 aa  ARTP_ECOL6 RecName: Full=Arginine transport ATP-binding protein
    3::48      7e-04  39%  242 aa  ARTP_ECO57 RecName: Full=Arginine transport ATP-binding protein
   22::81      7e-04  28%  328 aa  APPD_BACSU RecName: Full=Oligopeptide transport ATP-binding
 4708::4777    7e-04  29% 5034 aa  ABCAD_MOUSE RecName: Full=ATP-binding cassette sub-family A member
  385::563     7e-04  25% 1273 aa  AB12B_ARATH RecName: Full=ABC transporter B family member 12;      
  398::576     7e-04  24% 1278 aa  AB11B_ARATH RecName: Full=ABC transporter B family member 11;      
    2::70      0.001  28%  257 aa  ZURA_LISIN RecName: Full=Zinc uptake system ATP-binding protein
   27::70      0.001  36%  302 aa  ZNUC_RHIME RecName: Full=Zinc import ATP-binding protein znuC;   
   31::101     0.001  28%  250 aa  YJKB_BACSU RecName: Full=Putative ABC transporter ATP-binding
    1::78      0.001  26%  311 aa  YFIL_BACSU RecName: Full=Uncharacterized ABC transporter
    3::70      0.001  32%  578 aa  YBHF_SHIFL RecName: Full=Uncharacterized ABC transporter
    3::70      0.001  32%  578 aa  YBHF_ECOLI RecName: Full=Uncharacterized ABC transporter
    3::52      0.001  30%  257 aa  Y4TH_RHISN RecName: Full=Probable amino-acid ABC transporter
   98::137     0.001  40%  311 aa  Y467_MYCGE RecName: Full=Putative ABC transporter ATP-binding
  309::412     0.001  32%  551 aa  Y3364_BACAN RecName: Full=Putative ABC transporter ATP-binding
   16::58      0.001  45%  260 aa  Y3161_STRCO RecName: Full=Putative ABC transporter ATP-binding
    2::202     0.001  25%  257 aa  Y1078_HAEIN RecName: Full=Probable amino-acid ABC transporter
  353::407     0.001  33%  576 aa  Y1073_RICCN RecName: Full=Putative export ATP-binding/permease
   10::56      0.001  36%  259 aa  Y068_CHLTR RecName: Full=Probable metal transport system
  662::693     0.001  44% 1016 aa  UVRA_DEIRA RecName: Full=UvrABC system protein A;       
   13::53      0.001  46%  253 aa  THIQ_RHILO RecName: Full=Thiamine import ATP-binding protein
    2::53      0.001  40%  264 aa  TAUB3_BURXL RecName: Full=Taurine import ATP-binding protein tauB
   12::59      0.001  33%  255 aa  SSUB_SHIFL RecName: Full=Aliphatic sulfonates import ATP-binding
   12::59      0.001  33%  255 aa  SSUB_SHIF8 RecName: Full=Aliphatic sulfonates import ATP-binding
   15::60      0.001  37%  250 aa  SSUB2_STRAW RecName: Full=Aliphatic sulfonates import ATP-binding
   46::116     0.001  35%  246 aa  RFBB1_KLEPN RecName: Full=O-antigen export system ATP-binding
   31::124     0.001  33%  277 aa  PSTB_PSEF5 RecName: Full=Phosphate import ATP-binding protein pstB;
   19::76      0.001  36%  327 aa  POTA_BACCR RecName: Full=Spermidine/putrescine import ATP-binding
   13::63      0.001  37%  272 aa  PHNC_THICR RecName: Full=Phosphonates import ATP-binding protein
   22::56      0.001  49%  244 aa  PHNC_ANAVT RecName: Full=Phosphonates import ATP-binding protein
   18::119     0.001  35%  258 aa  PHNC3_BACHD RecName: Full=Phosphonates import ATP-binding protein
   22::56      0.001  49%  244 aa  PHNC2_ANASP RecName: Full=Phosphonates import ATP-binding protein
   15::44      0.001  53%  252 aa  PHNC1_TRIEI RecName: Full=Phosphonates import ATP-binding protein
  501::556     0.001  29%  724 aa  PEDD_PEDAC RecName: Full=Pediocin PA-1 transport/processing
   24::217     0.001  23%  323 aa  OPPD_HAEIN RecName: Full=Oligopeptide transport ATP-binding protein
  354::408     0.001  29%  581 aa  MSBA_PHOLL RecName: Full=Lipid A export ATP-binding/permease
  366::422     0.001  32%  601 aa  MSBA_METCA RecName: Full=Lipid A export ATP-binding/permease
  364::414     0.001  35%  587 aa  MSBA_HAEIN RecName: Full=Lipid A export ATP-binding/permease
  364::414     0.001  35%  587 aa  MSBA_HAEI8 RecName: Full=Lipid A export ATP-binding/permease
  365::419     0.001  35%  593 aa  MSBA_BURS3 RecName: Full=Lipid A export ATP-binding/permease
  639::677     0.001  38% 1527 aa  MRP3_HUMAN RecName: Full=Canalicular multispecific organic anion
   17::73      0.001  35%  345 aa  METN_SYNWW RecName: Full=Methionine import ATP-binding protein
    4::49      0.001  35%  340 aa  METN_CHLFF RecName: Full=Methionine import ATP-binding protein
   24::113     0.001  38%  338 aa  METN_BACHD RecName: Full=Methionine import ATP-binding protein
   23::82      0.001  35%  341 aa  METN2_BACSK RecName: Full=Methionine import ATP-binding protein
   21::89      0.001  31%  335 aa  METN1_PSEPF RecName: Full=Methionine import ATP-binding protein
 1052::1122    0.001  35% 1281 aa  MDR3_CRIGR RecName: Full=Multidrug resistance protein 3;       
  402::461     0.001  37% 1277 aa  MDR1_RAT RecName: Full=Multidrug resistance protein 1;       
   17::74      0.001  34%  684 aa  MACB_RHOBA RecName: Full=Macrolide export ATP-binding/permease
   22::80      0.001  31%  643 aa  MACB_MANSM RecName: Full=Macrolide export ATP-binding/permease
   16::125     0.001  28%  226 aa  LOLD_TREDE RecName: Full=Lipoprotein-releasing system ATP-binding
  435::488     0.001  35% 1492 aa  CFTR_SQUAC RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1481 aa  CFTR_SAIBB RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_PONAB RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_PANTR RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_HYLLE RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_GORGO RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1482 aa  CFTR_DASNO RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1483 aa  CFTR_CANFA RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_CALMO RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1481 aa  CFTR_CALJA RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1480 aa  CFTR_ATEGE RecName: Full=Cystic fibrosis transmembrane conductance
  438::487     0.001  34% 1481 aa  CFTR_AOTNA RecName: Full=Cystic fibrosis transmembrane conductance
    3::74      0.001  29%  280 aa  CBIO2_STRMU RecName: Full=Cobalt import ATP-binding protein cbiO
    3::71      0.001  30%  277 aa  CBIO2_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO
   24::95      0.001  35%  281 aa  CBIO2_CLOAB RecName: Full=Cobalt import ATP-binding protein cbiO
   17::72      0.001  32%  253 aa  BCEA_BACSU RecName: Full=Bacitracin export ATP-binding protein
 1319::1349    0.001  48% 1642 aa  ABCA5_HUMAN RecName: Full=ATP-binding cassette sub-family A member 5;
   10::61      0.001  33%  282 aa  AB21I_ARATH RecName: Full=ABC transporter I family member 21;    
   78::259     0.001  28%  648 aa  AB14G_ARATH RecName: Full=ABC transporter G family member 14;      
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
ABCX_PORPU      ------DYILEIKDLHASVNDVPILKGVNLSIKPGEIHAIMGPNGSGKSTLSKVIAGHPAYSLLNGDILF
ABCX_PORYE      -------TILEIKDLYASVGETTILKGVNLSIRAGEIHAIMGPNGSGKSTLSKVIAGHPAYSLISGDILF
ABCX_ANTSP      --------LLNIKNLDVTIGETQILNSLNLSIKPGEIHAIMGKNGSGKSTLAKVIAGHPSYKITNGQILF
Y075_SYNY3      -------TILSIKNLTASVDGNQILKGVNLEIKAGEVHAIMGRNGSGKSTLSKVITGHPDYEITGGEIIY
V296_BACSU      -------STLTIKDLHVEIEGKEILKGVNLEIKGGEFHAVMGPNGTGKSTLSAAIMGHPKYEVTKGSITL
ABCX_ODOSI      --MNTNYPILEIKNLKACINENEILKDLNLKIHKGEIHAIMGPNGSGKSTFSKVLAGHPAYNILSGDILF
SUFC_ECOLI      --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
ABCX_GUITH      -----KKKILEVTNLHAAVNEIKIVKGLNLVVNAGEIHAIMGKNGSGKSTFAKIIAGHPDYTITNGDITY
ABCX_CYAPA      ---TEKTKILEVKNLKAQVDGTEILKGVNLTINSGEIHAIMGPNGSGKSTFSKILAGHPAYQVTGGEILF
ABCX_CYACA      -------SVLTIQNLKACVNEFEVLHNINLQIKTNETHVIMGPNGSGKSSLLKVIAGHPSYKVIEGKIFV
AB6I_ARATH      -----RIPLLEVRDLRAVIAESEILKGVNLVVYEGEVHAVMGKNGSGKSTFSKVLVGHPDYEVTGGSIVF
Y285_STRP1      -------SILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQGQILL
Y273_STRP6      -------SILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQGQILL
Y208_STRP3      -------SILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQGQILL
Y273_STRP8      -------SILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQGQILL
ABCX_GALSU      -------SLLQIKNLHVKLANTEILNGINLNVNQGEIHAIMGPNGSGKSTLSKVIAGHSLYKVVKGEIIF
Y035_METJA      --------LLKVEDLHVYRGNREILKGVNLTVEENEIHAIIGPNGAGKSTLAYTIMGISGYKPTKGRIIF
RBSA_GEOKA      --------MIDMRSIQKSFGANIVLNGVDFEVLPGEVHALMGENGAGKSTLIKVLTG--IYERDGGTIVV
LSRA_YERE8      --------LLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--VLPPDSGTIEI
LSRA_PHOTE      --------LLEVSGISKQFSGVMVLKHIDFTLLPGQIHALLGGNGAGKSTLMKIIAG--IEQPDKGSIKI
LSRA_YERPY      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPS      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPP      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPN      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPG      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPE      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPB      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERPA      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
LSRA_YERP3      -TVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAG--ILPPDTGVIEM
UGPC1_RHIL3     ---------ISIRGVKKNYGKTPVVHGVDLDIQSGEFIVILGPSGCGKSTLLRMIAG--LEEITGGEIAI
RBSA1_RUBXD     --------LLEMRGITKRFPGVVALDGVDFELLPGEVHVLLGENGAGKSTLIKILSG--AYRPDGGEILM
RBSA_ANAVT      ----TATPVLEMQGIAKRFHGVPALQGVNLTIYPGEVHALMGENGAGKSTLMKILAG--AYIADEGEIRI
UGPC2_RHIEC     ---------ISIRDVKKSYGKHPVVHGVDLEIQSGEFIVILGPSGCGKSTLLRMIAG--LEEITGGEIAI
LIVG_ARCFU      --------ILQTQNLSKFFDGLKALNRVNIGVEKGSITLVIGPNGSGKTTFINTVSG--FYRADEGKVFF
AGLK_RHIME      ---------LLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAG--LEEITGGDMFI
LSRA_SALTY      ----TASPLICVQNIYKSYSGVEVLKGIDFTLHAGEVHALLGGNGAGKSTLMKIIAG--IVPPDGGTIDI
LSRA_SALTI      ----TASPLICVQNIYKSYSGVEVLKGIDFTLHAGEVHALLGGNGAGKSTLMKIIAG--IVPPDGGTIDI
LSRA_SALPB      ----TASPLICVQNIYKSYSGVEVLKGIDFTLHAGEVHALLGGNGAGKSTLMKIIAG--IVPPDGGTIDI
LSRA_SALPA      ----TASPLICVQNIYKSYSGVEVLKGIDFTLHAGEVHALLGGNGAGKSTLMKIIAG--IVPPDGGTIDI
LSRA_SALCH      ----TASPLICVQNIYKSYSGVEVLKGIDFTLHAGEVHALLGGNGAGKSTLMKIIAG--IVPPDGGTIDI
HMUV_JANSC      --------MLTVENIEVTLGATPVLHGIDMVAQPGQVTAIVGHNGSGKTTLLRAMTQETPYT---GTIRL
RBSA_SILST      ----TGDVILQISNLTKSFGPVKALKGVDFELRRGEIHAIAGENGAGKSTLMNII--DGILQPDSGEIRL
LSRA_PHOLU      --------LLEVSGISKQFSGVMVLKHIDFTLLPGQIHALLGGNGAGKSTLMKIIAG--IEQPDKGILKI
RBSA2_BURP1     --------LLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGENGAGKSTLMKILSG--AYQADGGEILI
RBSA_BURPS      --------LLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGENGAGKSTLMKILSG--AYQADGGEILI
RBSA1_STRCO     --------VLALRDVSKSFGAVRALRDVSLELFPGEVHALAGENGAGKSTLIKTLAG--VHRPDAGHVLL
LPTB_HAEIN      -------SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVG--LVRQDQGKIVI
RGMG_BURXL      -------SLISVKRLNKSFPGVRALHEVQFELMAGEVHALMGENGAGKSTLMKILAG--VYTRDSGEILY
RBSA2_PASMU     --------LLEMKGIAKRFGTFYALQDVDLSIYRGEIHALMGENGAGKSTLMKILAG--AYTASAGEILI
RBSA1_BURCH     --------LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSG--AYRADGGEILI
RBSA1_BURCA     --------LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSG--AYRADGGEILI
LSRA_PHOLL      --------LLEVSGISKQFSGVMVLKHIDFTLFPGQIQALLGGNGAGKSTLMKIIAG--LEQPDKGTLKI
Y382_RHIME      ------DGTLIARGLTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITG--LVPVDEGSIEI
WTPC_PYRKO      --------VLMVEGISKDYREFH-LRDVTFSVEKGEHFIILGPSGAGKTVLLEVIAG--IIEPDSGRIFL
RBSA2_STRAW     --------VLALEDISKSFGAVRALRDVSLELFPGEVHALAGENGAGKSTLIKTLAG--VHRPDAGQVLL
MACB_SYNFM      --------------------DVPVLRGISLKVSPGDFVALMGTSGSGKTTLMNIL--GCLDRPTSGHYRF
RBSA_LACLS      ---------IEMKNISKSFGTNKVLEAIDLPINSGEVHALMGENGAGKSTLMNILTG--LFPASGGEIEI
RBSA_HAHCH      ------NSLLSLEHISKGFPGVRALNDISFELQSGEIHALLGENGAGKSTLMKILCG--VYKQDAGRILI
RBSA1_RHILO     --------LFQMEGISKRYGGVRALEKAELVVTSGSIHAILGENGAGKSTLIKVMAGVVA--PDEGRMTL
RBSA1_BURS3     --------LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSG--AYRADGGEILI
LSRA_ECOLI      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
LSRA_ECODH      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
RBSA_DEIGD      --------MLALQHASKSFGPVRALSDVSLELYSGEAHALLGENGAGKSTLVKILSG--VHRADGGELWV
LSRA_ECO57      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITS--ADSGTLEI
LSRA_ENT38      --------LIEAHGIHKQFSGVPVLRGIDFTLLSGQVHALMGGNGAGKSTLMKIIAG--VETPDSGELNV
LSRA_ECO24      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
LIVF_SALTY      -------TMLTFEKVSAHYGKIQALHDVSLHINQGEIVTLIGANGAGKTTLLGTLCGDP--RASSGRVVF
LIVF_SALTI      -------TMLTFEKVSAHYGKIQALHDVSLHINQGEIVTLIGANGAGKTTLLGTLCGDP--RASSGRVVF
Y3926_AZOC5     ----TAEGSLAAFGLAKSYGGRKVVRDVSLDVRRGEAVGLLGPNGAGKTTVFYMITG--LVKADQGRIEL
UGPC_RHILO      ---------ITIRGVKKNYAKTQVVHGVDLDFASGEFVVILGPSGCGKSTLLRMIAG--LEEISDGEISI
SMOK_RHOSH      ---------ITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAG--LEDVSDGQIMI
RBSA_BACHD      --------IVEMTGIHKSFSGNPVLKDVSFTLEKGEIHALMGENGAGKSTLMKILTG--IYERDSGTVKI
LSRA_SHIFL      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
LSRA_SHIF8      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
LSRA_ECOLC      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
RBSA2_ECO57     --------VLEMRNIAKAFGKFYALKGVDLTVYPGEIHALMGENGAGKSTLMKVLAG--AYTATSGEILI
RBSA2_BURTA     --------LLEMRGISKTFPAVRALAGVSLTVHPGEIHSLMGENGAGKSTLIKILSG--AYQADGGEILI
RBSA2_AGRT5     --------ILSMTNIHKAFGPVRALRSAALELQRGEIHALAGENGAGKSTLMHII--DGILQPDGGEILL
RBSA1_STRAW     --MSNADELLRIEGIRKTFPGVVALDGVDFDLRRGEVHVLLGENGAGKSTL--IKMLSGAYRPDGGRVLV
POTA_HAEI8      --------IIELRSIKKSYGSNTIINDFNLAINNGEFVTILGPSGCGKTTVLRLLAG--LEELDSGSIIL
RBSA_YERPS      --------LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAG--AYTTTSGEILI
RBSA_YERPN      --------LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAG--AYTTTSGEILI
RBSA_YERPE      --------LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAG--AYTTTSGEILI
RBSA_YERPA      --------LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAG--AYTTTSGEILI
RBSA_BACCR      ---------IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTG--VYKKDGGTIKI
MGLA_SODGM      --------LLEMKNISKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFG--IYSKDAGSIIF
HMUV_PSEPK      --------MLQVEGLYLCRGSNEVLHDIHLQLPPGQVVGVLGPNGAGKSSLLSVLCGELA--PDRGRVTL
Y4MK_RHISN      MTDASKD-IVSVRSLTKSYGATVVLKGVDFSVARGEIHALLGGNGAGKSTLIRVITGTAA--KDGGELVF
UGPC_PARDP      -----------------------VIHGITMEIADGEFVVIVGPSGCGKSTLLRMVAGLEA--ISAGTVEI
UGPC2_AGRT5     ---------IDIRQVRKSYGKTPTLHGVDLSFDSGEFVVILGPSGCGKSTLLRMIAG--LEEITSGEIAI
RBSA1_BURCM     --------LLEMRRISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSG--AYRADGGEILI
MGLA_SALTY      --------LLEMRGINKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGSIVF
HMUV_ROSDO      --------------ITVKLGRTPILHGIGFCAKPGEVSAIVGPNGSGKTTLLRAITGDLPF---DGTVRL
CYSA_BACCR      ---------IQIQGVSKQYGTFQALTDIHLDIPKGELVALLGPSGSGKTTLLRIIAG--LEEADGGSISF
RBSA_JANSC      ------DPVLRLTGITKTFPGVKALNAVSLELYPGEVTALIGENGAGKSTIVKVLTG--IYRADGGEITV
RBSA_BACHK      ---------IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTG--VYKRDGGTITI
RBSA_BACCZ      ---------IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTG--VYKRDGGTITI
RBSA_BACAN      ---------IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTG--VYKRDGGTITI
Y5482_VIBPA     ---TPAETLLEVRGLTYSYDEKNALEDVSFDIKRGEFVSVLGKNGSGKSTITKLIMG--VIEADSGSMSM
RBSA_LACLA      ---------IEMKNISKSFGTNKVLEAIDLTINSGEVHALMGENGAGKSTLMNILTG--LFPASGGEIEI
RBSA_BURXL      ---------LELRRASKSFGRVRALSDGDLALWPGEVHALLGENGAGKSTLVKILAG--VHQPDTGELLV
RBSA_BACC1      ---------IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTG--VYKKDGGTITI
PSTB2_MAGSA     -------SKISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCIMND---MVDGGSLTL
POTA_HAEIN      --------IIELRSIKKSYGSNTIINDFNLTINNGEFVTILGPSGCGKTTVLRLLAG--LEELDSGSIIL
MGLA_YERPS      -TAQPRDWLLEMSNIDKSFPGVKALDNVNLKVRPYSIHALMGENGAGKSTLLKCLFG--IYKKDSGSIIF
MGLA_YERPN      -TAQPRDWLLEMSNIDKSFPGVKALDNVNLKVRPYSIHALMGENGAGKSTLLKCLFG--IYKKDSGSIIF
MGLA_YERPE      -TAQPRDWLLEMSNIDKSFPGVKALDNVNLKVRPYSIHALMGENGAGKSTLLKCLFG--IYKKDSGSIIF
MGLA_YERPA      -TAQPRDWLLEMSNIDKSFPGVKALDNVNLKVRPYSIHALMGENGAGKSTLLKCLFG--IYKKDSGSIIF
LSRA_ECOSM      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
Y3745_BRUSU     ---------VSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKSTLLRMVAG--LEPISGGDLVI
Y2993_BRUA2     ---------VSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKSTLLRMVAG--LEPISGGDLVI
Y2787_BRUAB     ---------VSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKSTLLRMVAG--LEPISGGDLVI
XYLG_BURCM      ------EPLLTMRGIVKAFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVYPHGTWDGEIRW
XYLG_BURCH      ------EPLLTMRGIVKAFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVYPHGTWDGEIRW
XYLG_BURCA      ------EPLLTMRGIVKAFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVYPHGTWDGEIRW
RGMG_THETN      --------LIRMENISKEFPGVKALKNVNFEIKKGEVHALVGENGAGKSTLIKILSG--VYSKDSGKIYF
RBSA_CLOPE      -----RTPMLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSG--VYKKDEGKIFI
RBSA1_PASMU     ------ETLLHIQGIDKSFPGVKALSNACLSVYAGRAMALMGENGAGKSTLMKVLTG--IYSKDAGTIEY
MGLA_ECO57      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYKKDSGTILF
LOLD2_CAUCR     ------DPVLALRGLETEAGDLPVLRGVDLDVYPGEVVGLIGPSGSGKSSLLH--SAGLLERPDAGLVAL
XYLG_BURTA      ------EPLLTMRGIVKDFDGVKALDGIDLTVRPGECVGLCGENGAGKSTLMKVLSGVHPHGTWDGEIHW
WTPC_PYRFU      --------MLEVQGISKKWKDFH-LKDISFSVMDGEYFIVLGPSGAGKTVLLEIIAG--IIPPDGGKVLL
RBSA_CLOPS      -----RTPMLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSG--VYKKDEGKIFI
RBSA_CLOP1      -----RTPMLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSG--VYKKDEGKIFI
RBSA_CHRVO      ---------VTMRGISKAFGPVKVLENVEFTLRGGEIHALMGENGAGKSTLMKILSG--VHRADAGEILL
POTA_MANSM      --------IIELRSLKKSYNENTIIDNFNLTINNGEFLTILGPSGCGKTTVLRLIAG--FEEANGGQIIL
MGLA_SHISS      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_SHIFL      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_SHIF8      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCMFG--IYQKDSGTILF
MGLA_ECOUT      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_ECOLI      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_ECOL6      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_ECOL5      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
LSRA_ECOHS      --------LLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITP--ADSGTLEI
LIVG_METJA      --------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITG--FLKADEGRVYF
HMUV_RHOP2      -----------------------LVHNVDLAVAQGELIAIVGPNGAGKSTLLRMLSGD--LRPTSGSVRL
Y1303_MYCBO     ---------------------TPVIRDLSLVAEPGSTVAIVGPTGAGKTTLVNLLM--RFYEIGSGRILI
Y1272_MYCTU     ---------------------TPVIRDLSLVAEPGSTVAIVGPTGAGKTTLVNLLM--RFYEIGSGRILI
RGMG1_AGRT5     MARAERSVLLRLENISKEFPGVKALSNVHFDLRSGEVHAVCGENGAGKSTLMKIISG--VYQPSEGTILH
RBSA_STRA5      ---------IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTG--LFPASTGTIYI
RBSA_STRA3      ---------IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTG--LFPASTGTIYI
RBSA_STRA1      ---------IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTG--LFPASTGTIYI
RBSA_SALPA      ------DALLQLKGIDKAFPGVKALSGAALNVYPGRVMALMGENGAGKSTMMKVLTG--IYTRDAGSLLW
RBSA_ERWCT      --------LLQLQGITKSFPGVKALSGAALNVYPGKVMALVGENGAGKSTMMKVLTG--IYRKDAGSIHF
RBSA2_BURS3     ------DTILRLSHITKSFPGVKALADIDLEIARGEIHALLGENGAGKSTLMKILCG--IHQPDTGTIEI
RBSA2_BURCH     ------DTILRLSHITKSFPGVKALSDIDLEIARGEIHALLGENGAGKSTLMKILCG--IHQPDAGTIEI
RBSA2_BURCA     ------DTILRLSHITKSFPGVKALSDIDLEIARGEIHALLGENGAGKSTLMKILCG--IHQPDAGTIEI
POTA_MYCPU      ---------ISLKNVDKNYGDKKILDDVNLSIKKGEFVTLLGPSGSGKTTILRLIGG--FEWTTRGEILF
HMUV_MESSB      --------MIEARDLNVSIGGKRILSHVNFAAEPGIVTAIVGPNGSGKSTLIKTISGDLPY---GGSITL
UGPC_SILST      ---------ITLKDLVKSYGDTEVLHHIDGEINDGEFIVIVGPSGCGKSTLLRMIAG--LETVTSGDIKI
UGPC_RALSO      ---------LSLRNVQKHYAGLQVVHGIDMEIGDGEFIVIVGPSGCGKSTLLRMVAGLEA--ITGGEVWI
UGPC_ERWCT      ---------LKLQAVTKSYDKTQIIQPIDLDVADGEFVVMVGPSGCGKSTLLRMVAG--LERTTSGDIYI
RGMG_RHOFD      -------SLISVKNLSKSFPGVKALDQVHFDLRAGEVHALMGENGAGKSTLMKILAG--VYRKDSGEMLL
RBSA_BACLD      ---------IKMKDIFKAFGQNQVLSGVSFELQEGEVHALMGENGAGKSTLMNLLTG--LHKLDSGTIEI
RBSA1_RHIL3     --MTLPEPLFRMEGISKRYGGAVALKDADIAIRPGAIHAVLGENGAGKSTLIKIMAGVVA--PDEGRMLL
POTA_ACTAC      --------IIELRSITKSYGSNTIIKDFNLTINNGEFLTILGPSGCGKTTVLRLLAG--LEELDSGNIIL
RGMG1_BURCM     ----TARTVLQLQGVGKRFPGVVALDGIDLDLRAGEVHAVCGENGAGKSTLMKIISGQ--YRADDGVVLY
RBSA1_RHIEC     ------EPIFRMEGISKRYGGAIALKDADIAIRRGAIHAVLGENGAGKSTLIKIMAG--VVTPDEGRMLL
POTA_LEUMM      --------IIAFNQVDLSFGDTHVLNNVDLEIEAGKFYTLLGPSGSGKSTILKLISGQLT--ADSGDISF
LSRA_KLEP7      --------LLEARQICKQFSGVAVLKGIDFTLGAGQVHALMGGNGAGKSTLMKIIAG--VETPDSGELTI
UGPC_BORA1      ---------LSFRNLKKTAGNVPVIHGIDMEIKDGEFIVIVGPSGCGKSTLMRMVAG--LETVTSGEILI
RGMG_PSEU2      --------LLEISHVSKGFPGVVALNDVQLRVRPGSVLALMGENGAGKSTLMKIIAG--IYQPDAGEIRL
RGMG_PSE14      --------LLEISHISKGFPGVIALNDVQLRVRPGSVLALMGENGAGKSTLMKIIAG--IYQPDSGEIRL
RBSA1_RHIME     ---------IALEGISKSFPGVRALSDVSLALYPGSVTALVGENGAGKSTLVKILTG--IYQPDAGTIRL
METN_MYCSS      --------MIEIDNLTKRFGDRTVLDDISLSVGAGEILAVVGPSGAGKSTLSRCV--SFLERPTSGSVRV
LOLD_DECAR      ------ESILIARGVSKVFREVPVLSGIDLAVQPGETVAIIGASGSGKSTLLHLLGG--LDTPSAGSVTL
ZNUC_SALTY      -------SLVSLENVSVSFGQRRVLSDVSLELSPGKILTLLGPNGAGKSTLVRVVLGLVA--PDEGVIKH
XYLG_BURXL      --------LMTMRGIVKTFSGVKALDGIDLTIAPGECVGLCGENGAGKSTLMKVLSGVYPWGTWDGEIIW
UGPC_YERE8      ---------LKLQAVTKSYDGTPVIKQIDLDVTDGEFIVMVGPSGCGKSTLLRMVAG--LERTTSGDIYI
UGPC3_RHIEC     ---------INIVDVKKNYGSVPAVKGINLAVADGEFIVLVGPSGCGKSTLLRMIAG--LESITGGRVEI
RGMG3_BURCM     --------LIELTGVSKRFPGVQALDDCRFDLRAGEVHALMGENGAGKSTLMKILAG--VYQKDGGEIRM
RBSA_SALCH      ------DALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGSLLW
RBSA2_STRCO     MSSRSPDELLRIEGIRKTFPGVVALDSVDFDLRRGEVHVLLGENGAGKSTL--IKMLSGAYTPDAGRILA
RBSA2_RUBXD     -----------LRGITKRFGGVTAVEGVDFELLPGEVHALVGENGAGKSTLMKIVGG--LYAPDEGSLEV
RBSA2_RHIEC     ------EPVLTIHGVTKHFGAVKALRDVDFTLERGEVHALCGENGAGKSTLMNIIAG--VLQPTEGEIRV
RBSA1_BURTA     ------DTILALTGITKRFPGVVALRGIDLRVARGEIHALLGENGAGKSTLMKILCG--IYPPDEGTIAI
RBSA1_AGRT5     --------VLEMRGISQIFPGVKALDGVDIALYPGKVTALIGENGAGKSTLVKILTG--IYRPNEGEILL
POTA_HAEDU      -------TIVELRNVTKSYGDKTILKDLNLTINDGEFLTILGPSGCGKTTALRLIAG--FEDLTEGSIIL
METN_MYXXD      --------MIAFRGVSAGGREVAALRNVSLRVEAGEIHGVLGQSGAGKSTL--IRCANLLERPTEGSVSV
ARAG_RHIEC      -------AFLEFNNVSKGYPGVQALANVSFTVEKGVVHGLMGENGAGKSTLIRVLSGDQA--ADGGNIFI
RGMG2_BURCH     ----TTQPLIALTGIGKRFPGVQALDDCRFDLRAGEVHALMGENGAGKSTLMKILAG--VYQRDAGEIRM
RGMG2_BURCA     ----TTQPLIALTGIGKRFPGVQALDDCRFDLRAGEVHALMGENGAGKSTLMKILAG--VYQRDAGEIRM
RBSA_SHIDS      --------VLEMRNIAKAFGKFYALKGVDLTVYPSENHALMGENGAGKSTLMKVLAG--AYTATSGEILI
RBSA_LACC3      ---------IEMKKITKSFGANRVLEGVDFTVESGEVHALMGENGAGKSTLMNILTG--LYQANSGEILV
POTA_OENOB      MTEETVQPLIEFKNVSLDYGETKVLKKVDLEIEEGKFYTLLGPSGSGKSTILSLISG--RLQPTGGDILI
HMUV_AGRT5      -----------------------LLDDVSVDLKPGKVNVIIGPNGAGKSTLMKVLSGE--MRAEGGSVTY
ZNUC_SALTI      -------SLVSLENVSVSFGQRRVLSDVSLELSPGKILTLLGPNGAGKSTLVRVVLGLVA--PDEGVIKR
ZNUC_SALPA      -------SLVSLENVSVSFGQRRVLSDVSLELSPGKILTLLGPNGAGKSTLVRVVLGLVA--PDEGVIKR
ZNUC_SALCH      -------SLVSLENVSVSFGQRRVLSDVSLELSPGKILTLLGPNGAGKSTLVRVVLGLVA--PDEGVIKR
ZNUC_MAGSM      --------LLTARNLCADRGGRRVLEGIDLSIGAGEVVTIIGPNGAGKSTLLKVLLGVEPY---------
RGMG_PSESM      --------LLEISHISKGFPGVIALDDVQLRLRPGSVLALMGENGAGKSTLMKIIAG--IYQPDTGEIRL
RBSA_VIBPA      -------AILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTG--IYHMDAGSIQY
RBSA_SALTY      ------DALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGSLLW
RBSA_SALTI      ------DALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGSLLW
POTA_LACAC      ------------------------LKDINITIESGKFYSLLGPSGSGKSTILRIIAGFT--QPSSGQVFF
POTA_DESDG      -----QDYIFELRGVSKYFDDTCALENIDLQIRNGEFLTLLGPSGCGKTTILRLLSGFET--PSSGDVIL
MSBA_SYNAS      ---------IEIRNISFAYDDTPVLRNINLTIRAGEVVAFVGMSGGGKTTLVNLI--PRFYDVTAGQILI
MGLA_SHIBS      -TPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYQKDSGTILF
MGLA_CLOTE      --------ILEMNGISKNFPGVKALDGVDLKVKKGTVHALMGENGAGKSTLMKCLFG--IYRSDDGEIVL
CBIO1_SYMTH     ------------------------LDDVSLTIPDGEFWGIIGPTGSGKSTLIQHMNG--LLRPTTGRVLV
ARAG_RHIL3      -------AFLEFSNISKGYPGVQALANVSFTVEKGAVHGLMGENGAGKSTLIRVLSGDQA--ADAGNILI
ARAG_CHRSD      ------EAFLRFDGISVEFPGVKALDEVSFSARAGEVHALMGENGAGKSTLLKVLSG--VNRPSSGQLWI
Y2240_PHOPR     --------------------EKPTLKNINLTIGKGEKVVIVGPSGSGKSTLGQCLNGLIPFAVKGGSLKI
Y1934_STRMU     ----------------------PTLKEITLSIEKGEKVLIIGPSGSGKSTIGHCLNGIIPNIYKGGSLTI
XYLG_PSESM      ------DYLLQMNGIVKTFDGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPYGTWEGEILW
UGPC_YERPS      ---------LKLQAVTKSYDGTPVIKQIDLDVADGEFIVMVGPSGCGKSTLLRMVAG--LERTTTGDIYI
UGPC_YERPN      ---------LKLQAVTKSYDGTPVIKQIDLDVADGEFIVMVGPSGCGKSTLLRMVAG--LERTTTGDIYI
UGPC_YERPE      ---------LKLQAVTKSYDGTPVIKQIDLDVADGEFIVMVGPSGCGKSTLLRMVAG--LERTTTGDIYI
UGPC_YERPA      ---------LKLQAVTKSYDGTPVIKQIDLDVADGEFIVMVGPSGCGKSTLLRMVAG--LERTTTGDIYI
UGPC_SILPO      ---------ITLDNLVKAYGDTEVLHHVAGQIEDGEFIVIVGPSGCGKSTLLRMVAG--LETVTAGQISI
UGPC_BURXL      ---------LTLQSVKKTYDGKQVLHGIDVDVADGEFVVMVGPSGCGKSTLLRMVAG--LERISEGSISI
RGMG_BACHD      ------------------------LDRVQLKVRKGSVHALMGENGAGKSTLMKILIG--MYKPNEGKIIF
RBSA_VIBCH      -------AILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTG--IYSKDAGSIEY
RBSA_THETN      ------EPILQMKGISKKFGNVKVLDNVDLTLYRGRVLALLGENGAGKSTLMKILCG--IYEKDEGSIYL
RBSA2_BURCM     ------DTILRLSHITKSFPGVKALSDIHLEIVRGEIHALLGENGAGKSTLMKILCG--IHQPDAGTIEI
POTA_VIBF1      -----KEAVIKLTGISKSFDGKEVISNFDLDVNHGEFLTILGPSGCGKTTVLRMIAGFET--ADAGTILL
POTA_THEMA      ---------VSIKNVSKFFDDFQVLKNVSLDIKKGEFFSILGPSGCGKTTLLRVIAGFEG--VESGDVLL
POTA_DESVH      -----KDNIIELRGVTKNFEDTCALDNIDLEIRNGEFLTLLGPSGCGKTTILRLISG--FEKPDAGVITL
MSBA_THIDA      -------------GLTYPGKQTPALARISLDIAPGETVALVGASGSGKTTLANLV--PRFYDPDAGRIEL
MGLA2_PHOPR     -TINKNEFLLEMTGISKEFPGVKALDKVNLKVRPHSIHALMGENGAGKSTLLKCLFG--IYEKNEGDIVF
METN1_RHOSR     -----------------------VLHDIDFSVGTGQIAAVIGQSGAGKTTLSRII--SLLERPSEGRILL
FBPC_STRCO      -------SLLSLEGATVRFGGRAVLDDVGLGVAEHEVVCVLGPSGSGKSTLLRAVAG--LQPLDAGRVTL
CYSA_BACC1      ---------IQIQGVSKQYGTFQALTDIHLDIPKGELVALLGPSGSGKTTLLRIIAG--LEEADEGSISF
ZNUC_ALCBS      ------EPLVTVQSVSVTLGGNAVLSDVSLSLAPGRITTLIGPNGAGKSTLARLVLG-------------
UGPC_RHOS1      ---------ISLRDVRKSYAGIEVIHGVDLEIADGEFVVIVGPSGCGKSTLLRMVAG--LEEITAGEIAI
RGMG_PSEF5      --------LLEVLNVSKGFPGVVALANVQLRVRPGTVLALMGENGAGKSTLMKIIAG--IYQPDSGELRL
POTA_PSYCK      --------LLQLTGLKKTYDNTEVLKDINLDIKHGEFITLLGPSGCGKTTLLRLIAG--FEQPSAGAIYL
POTA_PHOPR      ---TSKKPVIQLKGLNKSFDGKQIIAGLDLNVNDGEFLTILGPSGCGKTTVLRLIAG--FENSDAGQVII
POTA_MYCS5      -------------------DEKLVLDNVNLNIKRGEFVTLLGPSGSGKTTILRLIGGEWATR---GEIKF
POTA_MYCMO      --------IIELKSITKEYGDKTILNNINLSIKDEEFITILGPSGSGKTTILSLI-GGFEY-PNRGEIKF
POTA_ENTFA      -----RNHVISFENVVKQFDDEPVLKNVSFEIEEGKFYTLLGPSGCGKTTILRIIAG--FNDVTSGDVYF
POTA_CLONN      ------ENIIEIKNVYKEFNGVPILKDINLNIKKNEFLTLLGPSGCGKTTTLRILGGDAT----NGEVIF
MACB_SODGM      --------LIELQGVSRSYCQVNVLNDIHLRIDPGEMVAIIGSSGSGKSTLMNIL--GCLDRPSGGEYRI
HMUV_RHOPS      ------------------IGSVALVERVDLRVEPGELIAIVGPNGAGKSTLLRMLSGDV--RPTAGAVRM
XYLG_PSEU2      ------DYLLQMNGIVKSFGGVKALNGIDITVKPGECVGLCGENGAGKSTLMKVLSAVYPYGTWEGEILW
XYLG_GEOKA      --------VLEMKGITKEFPGVRALDNVTFSVRKGEIHALCGENGAGKSTLMKVLSGVYPYGSYDGKIYI
UGPC_RALME      ---------------------TQVVHGIDMEIADGEFIVIVGPSGCGKSTLLRMVAG--LETITGGEIHI
UGPC_CHRSD      ------------------------LHSIDLSVADGELIVVVGPSGCGKSTLLRILAG--LEPITAGELAI
RGMG1_BURS3     --------LIALTGIGKRFPGVQALDDCHFDLRAGEVHALMGENGAGKSTLMKILAG--VYQRDDGEIRM
RBSA_RHOSR      MSVPPAVPLLEVRDVTKSFGNVAAVQGVSFPLYGGEAHALVGENGAGKSTIVKMLAG--VHGPDTGSLLV
RBSA_PSEPK      --------VLELRGIVKTFGATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAG--IHRPDAGSLLL
RBSA_HAEIN      ------ETLLKISGVDKSFPGVKALNNACLSVYAGRVMALMGENGAGKSTLMKVLTG--IYSKDAGTIEY
RBSA_HAEI8      ------ETLLKISGVDKSFPGVKALNNACLSVYAGRVMALMGENGAGKSTLMKVLTG--IYSKDAGTIEY
POTA_SALTY      --------LVLLSGISKSFDGKEVISQLDLTINNGEFLTLLGPSGCGKTTVLRLIAG--LETVDAGHIML
POTA_SALTI      --------LVLLSGISKSFDGKEVISQLDLTINNGEFLTLLGPSGCGKTTVLRLIAG--LETVDAGHIML
POTA_SALPA      --------LVLLSGISKSFDGKEVISQLDLTINNGEFLTLLGPSGCGKTTVLRLIAG--LETVDAGHIML
POTA_SALCH      --------LVLLSGISKSFDGKEVISQLDLTINNGEFLTLLGPSGCGKTTVLRLIAG--LETVDAGHIML
POTA_LEGPL      --------LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISGFEQPTL--GEIFI
ZNUC_SHISS      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_SHIFL      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_SHIF8      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_SHIDS      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_SHIBS      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECOUT      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECOLI      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECOL6      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECOL5      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECOK1      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
ZNUC_ECO57      -------SLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLG--LVTPDEGVIKR
SSUB2_BURS3     --------LLDLRITRKLYGDRTILADVPLQVARGEIVCVVGPSGCGKSTLLRIVAGDTDFR---GSVKL
RBSA_RHOS4      ---------IDMTGISKAFGPVKALVDADLRVARGTIHGLVGQNGAGKSTIIKVLAG--ILKPDSGRITI
RBSA_OCEIH      ---------IVMENIHKSFGSNNVLEGVDFSLEPGEIHALMGENGAGKSTLMNILTG--LFPSNQGSITI
RBSA_ECOUT      ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
RBSA_ECOLI      ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
RBSA_ECOL6      ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
RBSA_ECOL5      ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
RBSA1_ECO57     ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
POTA_PASMU      --------IIELRSITKSYGDKTIIENFNLTINNGEFLTILGPSGCGKTTVLRLLAG--LEELDSGNIIL
POTA_LEGPH      --------LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISG--FEQPTQGEIFI
POTA_LEGPA      --------LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISG--FEQPTQGEIFI
POTA_CHRVO      -------ALLEIKNVVKRFGDYTAVNDVSLSVEAGEFFTLPGPSGCGKTTLLRMLAG--FEQPDAGQILL
LIVF_ECOLI      --------MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDP--RATSGRIVF
LIVF_ARCFU      --------------LNAGYKELHILFDVDADIKKNSITAVVGPNGSGKSTLLKSIFGLAT--VHSGQVFL
HMUV_SALRD      --------MIALRDITVHIGDATLIERVSAAVRPGQMTAVVGPNGAGKTTLLRVASGELT--PSEGAVQL
CCMA_XANAC      ----TAPPLLAAHDLAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAG--LLHVERGQIQI
XYLG_PSE14      ------DYLLQMNGIVKTFDGVKALNGIDIKVRPGECVGLCGENGTGKSTLMKVLSAVYPYGTWDGEILW
WTPC_PYRHO      ------------------------LREISFDVREGEHFIILGPSGSGKTVLLEIIAG--IISPDRGRILL
UGPC_BORPE      ----------------------PVIHGIDMDVADGEFIVIVGPSGCGKSTLMRMVAG--LETVTEGEILI
UGPC_BORBR      ----------------------PVIHGIDMDVADGEFIVIVGPSGCGKSTLMRMVAG--LETVTEGEILI
TLRC_STRFR      ---TSPSSQLSLHGVTKRYDDRVVLSQVSLAISPGEKAGIIGDNGAGKSTLLRLLAGEE--RPDAGEV--
RBSA_PHOLL      --------VLELKGISKSFPGVKALSGAALRVYPGKVMALVGENGAGKSTMMKVLTG--IYTRDTGTVHY
RBSA2_RHIL3     -------AILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTG--IYRPNEGEILV
POTA_VIBVY      --------VIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFET--ADNGQITI
POTA_VIBVU      --------VIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFET--ADNGQITI
POTA_STAS1      ------EPLLSFKSVSKQYDDMQILDKIDIDIESGYFYTLLGPSGCGKTTILKLIAG--FEEADNGDIIY
POTA_HAHCH      ----SKPPILTLADITKRFDTQEVLSGFNLSIEDGEFFTILGPSGCGKTTVLRLIAGFEG--ADEGRIML
POTA_FRAAA      ----------------------PAVSRVDLAIRPGEFFSLLGPSGCGKSTTLRMIAG--FEEPTRGRILL
NIKE_BRUSU      MSLISADNIVKIHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVG--LERPTSGEVRF
MGLA_TREPA      --------VLTIRDLSKSFARNRVLNGVNFRMGKGAVVGLMGENGAGKSTLMKCLFG--MYAKDTGQILV
HMUV_PSEE4      --------MLDVEGLHLKRGSSEVLSDIRLQLRPGQILGVLGPNGAGKSSLLGALCGELS--PSAGQVRL
HMUV_NOCFA      --ITLRARGLVVERRGGSGPARRVLDQVDFAVAAGEIVALVGPNGAGKSTLLAALAGELT--PAAGGVEL
FBPC_YERPS      -------STLELHHIGKSYQSVMVLDRIDLHVPPGSRTAIVGPSGSGKTTLLRIIAGDAGKVILQGKAMF
FBPC_YERPN      -------STLELHHIGKSYQSVMVLDRIDLHVPPGSRTAIVGPSGSGKTTLLRIIAGDAGKVILQGKAMF
FBPC_YERPE      -------STLELHHIGKSYQSVMVLDRIDLHVPPGSRTAIVGPSGSGKTTLLRIIAGDAGKVILQGKAMF
FBPC_YERPA      -------STLELHHIGKSYQSVMVLDRIDLHVPPGSRTAIVGPSGSGKTTLLRIIAGDAGKVILQGKAMF
CYSA_CAUCR      ---------IAIRSVEKQFGRYPALNKVDLEIADGELLALLGPSGSGKTTLLRTIAG--LEFPDAGQVLF
ZNUC_YERPS      --------LVTLNKISVTFGSRRVLNDISLSLRPGKILTLLGPNGAGKSTLVRVVLG-------------
ZNUC_YERPN      --------LVTLNKISVTFGSRRVLNDISLSLRPGKILTLLGPNGAGKSTLVRVVLG-------------
ZNUC_YERPE      --------LVTLNKISVTFGSRRVLNDISLSLRPGKILTLLGPNGAGKSTLVRVVLG-------------
ZNUC_YERPA      --------LVTLNKISVTFGSRRVLNDISLSLRPGKILTLLGPNGAGKSTLVRVVLG-------------
ZNUC_YERE8      -------TLVTLNKISVTFGSRRVLNDISLSLRPGRILTLLGPNGAGKSTLVRVVLG-------------
UGPC_RHOS4      ---------ISLRDVRKSYAGIEVIHGVDFEIADGEFVVIVGPSGCGKSTLLRMVAG--LEEITAGEIAI
UGPC_BURTA      ---------LSLKGVRKSYDGAQVLHGIDVDIADGEFVVLVGPSGCGKSTLLRMIAG--LETVTEGEIAI
RBSA_SHISS      ------EALLQLKGIDKAFPGVKALSGAALNVYPGRVIALVGENGAGKSTMMKVLTG--IYTRDAGTLLW
RBSA_PHOPR      --------ILELKGIEKAFPGVKALDNACLNVYPGKVMALMGENGAGKSTLMKSLTG--IYAMDAGEIRY
RBSA_BURMA      ------DTILALTGITKRFPGVVALRGIDLRVARGEIHALLGENGAGKSTLMKILCG--IHPPDEGVIAL
RBSA_BACSU      ---------IEMKDIHKTFGKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTG--LHKADKGQISI
RBSA_BACSK      --------------ISKSFSGNQVLKNVSFTLEKGEIHALMGENGAGKSTLMKILTG--IYPRDEGVVRV
RBSA1_BURP1     ------DTILALTGITKRFPGVVALRGIDLRVARGEIHALLGENGAGKSTLMKILCG--IHPPDEGVIAL
POTA_MYCGE      -------SLIEIEGLNKTFDDGYVIRDISLNIKKGEFITILGPSGCGKTTLLRLLAGDPTY----GKIKV
POTA_MESFL      ------NNILELRNVTKDYDGKVVLKGIDLNIKEGEFITLLGPSGCGKTTTLRIVAG--FEKPNSGQIMF
NIKE_SHIBS      -------------GFSGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVG--LESPSQGNISW
HMUV_RHIEC      --------MIEVSGLSVRLSGKSIISDVTFAAKAGELTAIAGPNGSGKTTTMKAISGELAY---DGSVRI
CYSA_NOCFA      --------MITVTNARKNYGNFAALDDVTIEIPSGELTALLGPSGSGKSTLLRSIAGLEA--LDDGVVVI
ARAG_PSE14      ---TSINGALRFNGIGKVFPGVKALSDISFEARPGSVHALMGENGAGKSTLLKILGG--SYQPNSGTLQI
UGPC_RALEJ      -----------------------VVHGIDMEIADGEFIVIVGPSGCGKSTLLRMVAG--LETITGGDIHI
SSUB_BACSU      -----------------------VLENIELSIAPGEFLTLIGPSGCGKSTLLKIIAGDSEY---DGSVEI
RBSA_CORGL      --------ILQLDKVSKSFGPVNVINQVSIDVRPGRVLALLGENGAGKSTL--IKMMSGVYQPDGGQILV
RBSA2_RHIME     ----TSETVLEIRNVSKHFGAVKALTAVDFRLARGEVHALCGENGAGKSTLMNVIAG--VLQPSEGEVLI
RBSA2_RHILO     ----TQSDFFSLDGISKRFGVVQALDNVSIAFRPGEVLALVGENGAGKSTMMRILEGVSG--PDTGTVRH
POTA_PSEAB      --------LLEIRNVTRRFGDFTAVDNVSLTINTGEFFTLLGPSGCGKTTLLRMLAG--FDQPDSGEIRL
POTA2_PSEAE     --------LLEIRNVTRRFGDFTAVDNVSLTINTGEFFTLLGPSGCGKTTLLRMLAG--FDQPDSGEIRL
NIKE_BRUME      MSLISADNIVKIHSLVGASARKTMLHDISISIGQGETVALLGRSGCGKSTLARLLVG--LERPTSGEVRF
NIKE_BRUAB      MSLISADNIVKIHSLVGASARKTMLHDISISIGQGETVALLGRSGCGKSTLARLLVG--LERPTSGEVRF
NIKE_BRUA2      MSLISADNIVKIHSLVGASARKTMLHDISISIGQGETVALLGRSGCGKSTLARLLVG--LERPTSGEVRF
MGLA_VIBVY      MVNQTHEFLLEMTGVSKEFPGVKALDKVNLNVRPHSIHALMGENGAGKSTLLKCLFG--IYEKNEGNILF
MGLA_VIBVU      MVNQTHEFLLEMTGVSKEFPGVKALDKVNLNVRPHSIHALMGENGAGKSTLLKCLFG--IYEKNEGNILF
HMUV_RHILE      --------MIEVSGVSVRLSGKTIISDVAFTAKAGELTAIAGPNGSGKTTTMKAISGELAY---GGSVRI
HMUV_RHIL3      --------MIEVSGVSVRLSGKTIISDVAFTARAGELTAIAGPNGSGKTTTMKAISGELAY---GGSVRI
FBPC1_ERWCT     ITLNTEKSFVELKHITKRFGNNTVIDDLNLAIPQGKMVTLLGPSGCGKTTVLRAVAG--LEKPTEGQIFI
YTFR_ECOLI      MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTG--VYHADRGTIWL
YTFR_ECO57      MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTG--VYHADRGTIWL
UGPC_RHOPA      ---------------------------VDFAVGDGQFCVLVGPSGCGKSTLLRMVAG--LETITAGEIEI
SSUB2_BURCH     --------LLDLRIARKLYGDRTILSDIALQVARGEIVCVVGPSGCGKSTLLRIVAGDPDFR---GSVTL
SSUB2_BURCA     --------LLDLRIARKLYGDRTILSDIALQVARGEIVCVVGPSGCGKSTLLRIVAGDPDFR---GSVTL
RGMG_HAHCH      ------------------------LDNVSLRIRPGTVHALMGENGAGKSTLMKIIAG--IYQPDKGQVLL
RGMG_GEOKA      ----SEDYVLEMIDITKEFPGVKALDGVQLKVKRGTVHALMGENGAGKSTLMKILIG--IYTPDRGKIIL
RBSA_VIBF1      -------AILELNGIEKAFPGVKALDGACLNVYPGKVMALMGENGAGKSTLMKSLTG--IYAMDAGEIRY
RBSA3_RUBXD     ------EPVVRLRGVSKEFPGVVAVDGVDLDILPGEVHVVAGENGAGKSTLMKLL--SQVERPTSGEIYI
POTA_NITEU      -------ALLELRDVTRRFGDFTAVDCVNLSIEAGELFTLLGPSGCGKTTLLRMIAGFDV--PDSGQILL
POTA_NITEC      -------ALLELRNVIRRFGDFTAVDNVSLSIQAGEFFTLLGPSGCGKTTLLRMIAGFDV--PDSGQILL
PHNC_PSEE4      ------------------------LNNVDLQIGKGERVAIIGPSGAGKSSLLHLMA--TAVRPSAGQLDL
MGLA_VIBCH      MVNQTHEFLLEMTGVSKEFPGVKALDKVNLKVRPHSVHALMGENGAGKSTLLKCLFG--IYEKDEGDIIF
HMUV_BRAJA      -------AVIEARHLSKRAGRAKLLDGVGLTVAAGEMVAIIGPNGAGKSTLLRLLSGD--LRPSQGEVWL
ARAG_RALSO      -------AFLEFRGISKVFPGVRALSEVSFGIECGRVHGLLGENGAGKSTLLKILGGD--YQPDGGQIAV
ARAG_PSEU2      ---------LRFNGIGKVFPGVKALSDISFEARPGSVHALMGENGAGKSTLLKILGG--SYQPNSGTLQI
ZNUC_PSEE4      ------DALIRLEQVGVSFAGEAVLDSIDLAVAPGQIVTLIGPNGAGKTTLVRAVLG-------------
Y5533_VIBVU     ------ETLLDVRNLTYSYDEKNALEGVSFNVQRGEFVSILGKNGSGKSTITKLIMG--VIEPDDGAIYL
Y4347_VIBVY     ------ETLLDVRNLTYSYDEKNALEGVSFNVQRGEFVSILGKNGSGKSTITKLIMG--VIEPDDGTMHL
Y2655_BACCR     --------LLKVENLSFSYNKQKVLENVNLLIYEGEIVALLGHNGAGKSTLAHSLIG--INKMKNGKIAL
UGPC_RHIME      -TITLKDVHKTYHGDIAAI------RGVSLAIADGEFIVLVGPSGCGKSTLLRMIAG--LESITSGEISI
TAUB_PSEPU      -------ALLELERISAQYPETPVLADINLSLGPRQLLVALGPSGSGKTSLLNLIAGFVA--PSGGRITL
SSUB1_RHOSR     ---------LDLVGIGHRYRDTTVLHDIDLTVEPGEFVSFLGPSGVGKSTLLRIIAG-------------
PSTB2_NATPD     ---------LAVAGVSHGFDGTAVLESVTLAVDRGETVAIIGPSGTGKTTLLRLLA--LFSEPDDGTIGL
POTA_LACJO      ------------------------LKDINLTIESGKFYSLLGPSGSGKTTILRIIAGFS--EPTSGQVFF
POTA_LACDB      ------------------------LKDINLELESGKFYSLLGPSGSGKTTILRIIAGFT--EASAGKVYF
POTA_LACDA      ------------------------LKDINLELESGKFYSLLGPSGSGKTTILRIIAGFT--EASAGKVYF
NIKE_ECOUT      -------------GFSGKHQHQAVLNNVSLALKSGETVALLGRSGCGKSTLARLLVG--LESPSQGNISW
NIKE_ECOL6      -------------GFSGKHQHQAVLNNVSLALKSGETVALLGRSGCGKSTLARLLVG--LESPSQGNISW
NIKE_ECOL5      -------------GFSGKHQHQAVLNNVSLALKSGETVALLGRSGCGKSTLARLLVG--LESPSQGNISW
HMUV_THEFY      --VTSGTVVLGARHLSKSYGARTVLDDVSLDVRTGEVLALVGPNGAGKSTLLSILTGDTP--PDRGEVTV
GLNQ_ECOLI      --------MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCI--NKLEEITSGDLIV
CYSA_NITEU      ---------IEIHDLSKQFGSFTALNDINLKVNPGELLALLGPSGSGKTTLLRVIAG--LETADSGQVLF
CYSA_BORBR      ---------IEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAG--LESADAGSVLF
CBIO_MOOTA      ----------------------PALEKIDLAIEPGEFLAITGPNGSGKSTLARLLNG--LLRPRQGRVLV
ARAG_PSESM      ---TATGGALRFNGICKVFPGVKALSDISFEARPGSVHALMGENGAGKSTLLKILGG--SYQPNSGTLQI
ABCB6_XENTR     ------------------LDGKEILRDISFTVMPGQSIALVGPSGSGKSTIIRLLF--RFYDVKGGTIKV
AB23G_ARATH     ---------LTVTNLSYTINHTPILNSVSLAAESSKILAVVGPSGTGKSTLLKIISGRVNHKAPSSAVLM
ZNUC_PSEU2      ------DALIRLDKVAVTLSGQNVLDDIQLSVKPGEIVTLIGPNGAGKTTLVRAVLG--LLKPDSGTV--
XYLG_PSEPF      ------DYLLQMNGIVKTFGGVKALNGIDLKVRPGECVGLCGENGAGKSTLMKILSAVYPHGTWDGEILW
UGPC_RHOP5      ---------------------------IDFAVGDGQFCVLVGPSGCGKSTLLRMVAG--LETITAGEIDI
UGPC_RALEH      -----------------------VVHGIDMEIADGEFIVIVGPSGCGKSTLLRMVAG--LETITGGEIHI
UGPC_BURCM      ---------LSLKGIRKSYDKQHVLHGIDVEIADGEFVVLVGPSGCGKSTLLRMIAG--LETVTDGEIAI
UGPC_BURCH      ---------LSLKGVRKSYDKQHVLHGIDVEIADGEFIVLVGPSGCGKSTLLRMIAG--LESVTDGEIAI
UGPC_BURCA      ---------LSLKGVRKSYDKQHVLHGIDVEIADGEFIVLVGPSGCGKSTLLRMIAG--LESVTDGEIAI
TAUB_PSEAE      -------SRLTAEAISLSFEQRAILRDLSLGLAKGESLVVLGPSGCGKSTLLNILAG--FQKPDQGRVQI
RGMG2_BURCM     ------DCLLEVRGVGKSFPGVVALDGVQFRVRRGTVHALMGENGAGKSTLMKIIAG--VYTPDQGEILI
RGMG1_RHIME     --------LVSLSGISKNFSGVQALKGVDFDLRAGEVHA