[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56234.1

[Show Plain Result]


## Summary of Sequence Search
    1::144
    9::138     2e-20  33%  147 aa  NIFU_BACSU RecName: Full=NifU-like protein;
    6::136     3e-17  34%  142 aa  NIFU_THEMA RecName: Full=NifU-like protein;
    4::100     6e-08  31%  274 aa  NIFU_KLEPN RecName: Full=Nitrogen fixation protein nifU;
    4::100     6e-06  30%  312 aa  NIFU_AZOVI RecName: Full=Nitrogen fixation protein nifU;
   82::169     6e-06  32%  213 aa  ISU1_CANGA RecName: Full=Iron sulfur cluster assembly protein 1,
    1::89      2e-05  24%  157 aa  NIFU_AQUAE RecName: Full=NifU-like protein;
   34::121     2e-05  30%  165 aa  ISU1_YEAST RecName: Full=Iron sulfur cluster assembly protein 1,
    4::98      3e-05  27%  309 aa  NIFU_AZOCH RecName: Full=Nitrogen fixation protein nifU;
   47::100     3e-05  24%  138 aa  ISU1_TRAHO RecName: Full=Iron sulfur cluster assembly protein
   28::96      6e-05  23%  140 aa  Y488_MYCPN RecName: Full=Uncharacterized protein MG337 homolog;
   35::88      8e-05  30%  128 aa  NIFU_SHIFL RecName: Full=NifU-like protein;
   35::88      8e-05  30%  128 aa  NIFU_ECOLI RecName: Full=NifU-like protein;
   35::88      8e-05  30%  128 aa  NIFU_ECOL6 RecName: Full=NifU-like protein;
   35::88      8e-05  30%  128 aa  NIFU_ECO57 RecName: Full=NifU-like protein;
   86::139     1e-04  34%  192 aa  ISU1_SCHPO RecName: Full=Iron sulfur cluster assembly protein 1,
   20::106     1e-04  29%  300 aa  NIFU_ANASP RecName: Full=Nitrogen fixation protein nifU;
   83::137     1e-04  32%  180 aa  ISU1_KLULA RecName: Full=Iron sulfur cluster assembly protein 1,
   35::88      2e-04  28%  128 aa  NIFU_BUCAP RecName: Full=NifU-like protein;
   35::88      2e-04  30%  127 aa  NIFU_BUCAI RecName: Full=NifU-like protein;
   20::106     2e-04  29%  300 aa  NIFU_ANAAZ RecName: Full=Nitrogen fixation protein nifU;
   14::100     2e-04  27%  140 aa  ISU1_ENCCU RecName: Full=Iron sulfur cluster assembly protein
   57::111     2e-04  32%  154 aa  ISU1_ASHGO RecName: Full=Iron sulfur cluster assembly protein 1,
   33::118     2e-04  30%  168 aa  ISCU_MOUSE RecName: Full=Iron-sulfur cluster assembly enzyme ISCU,
   32::117     2e-04  30%  167 aa  ISCU_HUMAN RecName: Full=Iron-sulfur cluster assembly enzyme ISCU,
   35::85      4e-04  32%  126 aa  NIFU_HAEIN RecName: Full=NifU-like protein;
   69::123     4e-04  30%  179 aa  ISU1_DEBHA RecName: Full=Iron sulfur cluster assembly protein 1,
    4::85      5e-04  29%  310 aa  NIFU_AZOBR RecName: Full=Nitrogen fixation protein nifU;
    1::144

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHGCAVSQAAADM
NIFU_BACSU      --TLYRQVIMDHYKNPRNKGVLNDSIVV-DMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASM
NIFU_THEMA      ---MYSEAILDYANSKKFRGKLDDATVIEEGKNISCGDEITLYLKVEDGVVKDAKFEGMGCVISQASASL
NIFU_KLEPN      ----YSEKVKDHFFNPRNARVVDNANAVGDVGSLSCGDALRLMLRVQSEIIEEAGFQTFGCGSAIASSSA
NIFU_AZOVI      ----YSEKVKEHFYNPKNAGAVEGANAIGDVGSLSCGDALRLTLKVETDVILDAGFQTFGCGSAIASSSA
ISU1_CANGA      ---MYHPKVIEHYTHPRNVGSMDK-TLPNVGTGPACGDVMRLQIKVNDKTIEDVKFKTFGCGSAIASSSY
NIFU_AQUAE      MSFEYNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGDAMLFTIKVNNDVIEDVRFKTFGCGSAIAVSSM
ISU1_YEAST      ---LYHPKVIEHYTHPRNVGSLDKPNVGTGLVGPACGDVMRLQIKVNDSTIEDVKFKTFGCGSAIASSSY
NIFU_AZOCH      ----YSEKVKEHFYNPKNAGAVEGANAIGDVGSLSCGDRLRLTLKVETDVILDAGFQTFGCGSAIASSSA
ISU1_TRAHO      ---------------------------------PACGDVMKLQIKVENDIIKDAKFRTFGCGSAIASSSL
Y488_MYCPN      --------------------------CLTTKADDNCEDFFNLGLQFQNNQLTALGFNGEGCIISTIASEL
NIFU_SHIFL      ---------------------------------PACGDVMKLQIKVNDEGIEDARFKTYGCGSAIASSSL
NIFU_ECOLI      ---------------------------------PACGDVMKLQIKVNDEGIEDARFKTYGCGSAIASSSL
NIFU_ECOL6      ---------------------------------PACGDVMKLQIKVNDEGIEDARFKTYGCGSAIASSSL
NIFU_ECO57      ---------------------------------PACGDVMKLQIKVNDEGIEDARFKTYGCGSAIASSSL
ISU1_SCHPO      ---------------------------------PACGDVMRLAIRVNKDGIEDVKFKTFGCGSAIASSSY
NIFU_ANASP      --------VIEENGEPGVK------VATGEVGSIACGDALRLHIKVESDKIVDSRFQTFGCTSAIASSSA
ISU1_KLULA      ---------------------------------PACGDVMKLQIQVNDETIENVKFKTFGCGSAIASSSY
NIFU_BUCAP      ---------------------------------PACGDVMKLQIKVNEQGIEDACFKTYGCGSAIASSSL
NIFU_BUCAI      ---------------------------------PACGDVMKLQIKVNEKGIEDACFKTYGCGSAIASSSL
NIFU_ANAAZ      --------VIEDNGEPGVK------VATGEVGSIACGDALRLHIKVESDKIVDSRFQTFGCTSAIASSSA
ISU1_ENCCU      ----YDSSVVDHFENPRNVGSLDK-TDPRVGTGPACGDVMKLQIKVGKDNIEDAKFKTFGCGSAIASSSL
ISU1_ASHGO      ---------------------------------PACGDVMRLQIQVDDSTIENVKFKTFGCGSAIASSSY
ISCU_MOUSE      -ARLYHKKVVDHYENPRNVGSLDK-TSKNVGTGPACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSL
ISCU_HUMAN      -ARLYHKKVVDHYENPRNVGSLDK-TSKNVGTGPACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSL
NIFU_HAEIN      ---------------------------------PACGDVMQLQIKVDDNGIEDAKFKTYGCGSAIASSSL
ISU1_DEBHA      ---------------------------------PACGDVMRLQIQVDDETIKDVKFKTFGCGSAIASSSY
NIFU_AZOBR      ----YTDKVKEHFFNPKNAGALDEADDVGEVGSITCGDALKLMMKVNPDQHRDANFQTFGCGSAIASRSA


                         .         .         *         .         .         .         .:140
query           MADLVTGETVGEARRLSGLYLDMIKGRPXXXXXXXXXXXXXXXXSIARMPARVKCAELAWRTLEKLLxxx
NIFU_BACSU      MTQAIKGKDIETALSMSKIFSDMMQGK--EYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEK-----
NIFU_THEMA      MLERIIGERVEEIFSLIEEAEKMSRGE---NFDEGKLKNVTLMSDIKNYPARVKCFILAWKTLKEAL---
NIFU_KLEPN      LTELIIGHTLAEAGQITNQQIDYLDGLP------------------------------------------
NIFU_AZOVI      LTEMVKGLTLDEALKISNQDIDYLDGLP------------------------------------------
ISU1_CANGA      MTELVHGMTLDDAAKI------------------------------------------------------
NIFU_AQUAE      LTEMVKGKPIQYALNLT-----------------------------------------------------
ISU1_YEAST      MTELVQGMTLDDAAKI------------------------------------------------------
NIFU_AZOCH      LTEMVKGADLDDALKISNRDIAHFLGR-------------------------------------------
ISU1_TRAHO      ATEWIKGKSISDSLKIT-----------------------------------------------------
Y488_MYCPN      TLSALEGKTIKEAIVLLEQFMEAVQ---------------------------------------------
NIFU_SHIFL      VTEWVKGKSLDEAQAI------------------------------------------------------
NIFU_ECOLI      VTEWVKGKSLDEAQAI------------------------------------------------------
NIFU_ECOL6      VTEWVKGKSLDEAQAI------------------------------------------------------
NIFU_ECO57      VTEWVKGKSLDEAQAI------------------------------------------------------
ISU1_SCHPO      VTTMVKGMTLEEASKI------------------------------------------------------
NIFU_ANASP      LTEMIKGLTLDEALKVSNKDIDYLGGLP------------------------------------------
ISU1_KLULA      MTELVRGKTLEDAAKI------------------------------------------------------
NIFU_BUCAP      VTEWIKGKSITEAEAI------------------------------------------------------
NIFU_BUCAI      VTEWVKGKSIEEAESI------------------------------------------------------
NIFU_ANAAZ      LTEMIKGLTLDEALKVSNKDIDYLGGLP------------------------------------------
ISU1_ENCCU      ATEWIKKKTIDESLKIS-----------------------------------------------------
ISU1_ASHGO      MTELVRGKTLADAEKI------------------------------------------------------
ISCU_MOUSE      ATEWVKGKTVEEA---------------------------------------------------------
ISCU_HUMAN      ATEWVKGKTVEEA---------------------------------------------------------
NIFU_HAEIN      ITEWVKGKSLEEA---------------------------------------------------------
ISU1_DEBHA      LTELVKGKTIEEAVKI------------------------------------------------------
NIFU_AZOBR      LTEMIIGKTVDEA---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxx
NIFU_BACSU      ----
NIFU_THEMA      ----
NIFU_KLEPN      ----
NIFU_AZOVI      ----
ISU1_CANGA      ----
NIFU_AQUAE      ----
ISU1_YEAST      ----
NIFU_AZOCH      ----
ISU1_TRAHO      ----
Y488_MYCPN      ----
NIFU_SHIFL      ----
NIFU_ECOLI      ----
NIFU_ECOL6      ----
NIFU_ECO57      ----
ISU1_SCHPO      ----
NIFU_ANASP      ----
ISU1_KLULA      ----
NIFU_BUCAP      ----
NIFU_BUCAI      ----
NIFU_ANAAZ      ----
ISU1_ENCCU      ----
ISU1_ASHGO      ----
ISCU_MOUSE      ----
ISCU_HUMAN      ----
NIFU_HAEIN      ----
ISU1_DEBHA      ----
NIFU_AZOBR      ----