[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56675.1

[Show Plain Result]


## Summary of Sequence Search
    1::607
  249::337     8e-04  29%  581 aa  SYR_SHESH RecName: Full=Arginyl-tRNA synthetase;       
    1::607

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxYQRLGSTVDLPVNDEIGSRLSDYCFGLWTNEDAGAVTGYQDYIDTLDGATL
SYR_SHESH       -------------------YERLGVSLESTYNDDLEQVVKDLDAKGLLSESNGAKVVFQDEFKTKDGDPL


                         .         *         .         .         .         .         +:350
query           TVTIEKADGSHATKSIELTAADVKAKLVPSExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       PVIIQKADGGYLYATSDLAAMRYRSNVLKAD---------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYR_SHESH       -----------------------------------------------