[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56703.1

[Show Plain Result]


## Summary of Sequence Search
    1::471
   28::414     1e-54  36%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   28::415     1e-47  31%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
   10::423     1e-43  31%  479 aa  LMRB_BACSU RecName: Full=Lincomycin resistance protein lmrB;
   16::419     2e-38  24%  471 aa  LMRB_LISMO RecName: Full=Lincomycin resistance protein lmrB;
   16::419     2e-38  24%  471 aa  LMRB_LISIN RecName: Full=Lincomycin resistance protein lmrB;
   64::431     5e-24  29%  538 aa  TCMA_STRGA RecName: Full=Tetracenomycin C resistance and export
   21::416     1e-23  24%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   21::416     1e-23  24%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
    9::361     2e-17  24%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
   22::371     2e-16  25%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
   15::420     2e-15  20%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
   58::405     1e-14  22%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   58::405     1e-14  22%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
   16::340     1e-14  26%  475 aa  MMR_STRCO RecName: Full=Methylenomycin A resistance
    8::354     2e-14  26%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoD;
   28::354     1e-13  18%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
   28::354     1e-13  18%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
   28::354     1e-13  18%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
   28::354     1e-13  18%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
   13::326     3e-13  19%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
   32::424     4e-13  27%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
    3::163     9e-13  27%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
   13::321     5e-12  24%  459 aa  TCR_STAES RecName: Full=Tetracycline resistance protein;
   13::321     5e-12  24%  459 aa  TCR_STAAU RecName: Full=Tetracycline resistance protein;AltName:
   28::354     5e-12  21%  458 aa  TCRB_BACSU RecName: Full=Tetracycline resistance protein;
   28::354     1e-11  18%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
   15::168     1e-11  26%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
   14::167     1e-11  26%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
    5::157     2e-11  30%  388 aa  PBUE_BACSU RecName: Full=Purine efflux pump pbuE;
   14::167     2e-11  26%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
   14::167     2e-11  26%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
    5::160     2e-11  28%  386 aa  PBUE_BACAM RecName: Full=Purine efflux pump pbuE;
   25::424     3e-11  26%  512 aa  EMRY_ECOLI RecName: Full=Multidrug resistance protein Y;
    7::333     6e-10  19%  444 aa  YVKA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvkA;
   16::414     7e-10  22%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
   14::167     1e-09  24%  397 aa  YFHI_BACSU RecName: Full=Uncharacterized MFS-type transporter yfhI;
    2::371     1e-09  22%  466 aa  MMR_BACSU RecName: Full=Methylenomycin A resistance
    4::167     2e-09  28%  396 aa  YTBD_BACSU RecName: Full=Uncharacterized MFS-type transporter ytbD;
   16::385     4e-09  23%  541 aa  YUSP_BACSU RecName: Full=Uncharacterized MFS-type transporter yusP;
   28::354     1e-08  21%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
   14::136     1e-08  26%  471 aa  MDTD_CITK8 RecName: Full=Putative multidrug resistance protein
   14::136     2e-08  26%  470 aa  MDTD_SALPB RecName: Full=Putative multidrug resistance protein
   14::136     2e-08  26%  470 aa  MDTD_SALHS RecName: Full=Putative multidrug resistance protein
   24::136     2e-08  28%  471 aa  MDTD_ENTS8 RecName: Full=Putative multidrug resistance protein
   14::413     4e-08  23%  471 aa  MDTD_KLEP3 RecName: Full=Putative multidrug resistance protein
  129::498     5e-08  27%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
    5::170     5e-08  25%  396 aa  SOTB_HAEIN RecName: Full=Probable sugar efflux transporter;
    5::170     5e-08  25%  396 aa  SOTB_HAEIG RecName: Full=Probable sugar efflux transporter;
   14::136     5e-08  25%  470 aa  MDTD_SALTY RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALTI RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALSV RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALPK RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALPA RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALNS RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALEP RecName: Full=Putative multidrug resistance protein
   14::136     5e-08  25%  470 aa  MDTD_SALA4 RecName: Full=Putative multidrug resistance protein
   14::413     5e-08  23%  471 aa  MDTD_KLEP7 RecName: Full=Putative multidrug resistance protein
   15::409     7e-08  23%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
   14::136     9e-08  25%  470 aa  MDTD_SALDC RecName: Full=Putative multidrug resistance protein
  129::247     1e-07  27%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
   57::194     2e-07  25%  582 aa  VBA5_YEAST RecName: Full=Vacuolar basic amino acid transporter 5;
    5::170     2e-07  25%  402 aa  SOTB_HAEI8 RecName: Full=Probable sugar efflux transporter;
   14::136     2e-07  25%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ENT38 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
   14::136     2e-07  25%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
    9::162     3e-07  24%  390 aa  YBCL_BACSU RecName: Full=Uncharacterized MFS-type transporter ybcL;
    1::170     3e-07  23%  394 aa  SOTB_ERWT9 RecName: Full=Probable sugar efflux transporter;
   14::136     3e-07  24%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
   11::170     4e-07  25%  396 aa  SOTB_SALTY RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALTI RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALSV RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALPK RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALPC RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALPB RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALPA RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALNS RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALHS RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALG2 RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALEP RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALDC RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALCH RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALAR RecName: Full=Probable sugar efflux transporter;
   11::170     4e-07  25%  396 aa  SOTB_SALA4 RecName: Full=Probable sugar efflux transporter;
   11::170     6e-07  25%  397 aa  SOTB_CITK8 RecName: Full=Probable sugar efflux transporter;
   13::135     6e-07  26%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
    1::165     8e-07  27%  511 aa  YUBD_BACSU RecName: Full=Uncharacterized MFS-type transporter yubD;
   14::171     8e-07  23%  402 aa  SOTB_PSE14 RecName: Full=Probable sugar efflux transporter;
   14::169     1e-06  23%  402 aa  SOTB_PSEU2 RecName: Full=Probable sugar efflux transporter;
    1::124     1e-06  23%  474 aa  VBA2_YEAST RecName: Full=Vacuolar basic amino acid transporter 2;
   47::165     1e-06  28%  543 aa  SGE1_YEAST RecName: Full=Protein SGE1;AltName: Full=Crystal violet
   11::170     2e-06  25%  399 aa  SOTB_KLEP7 RecName: Full=Probable sugar efflux transporter;
   87::224     2e-06  21%  613 aa  AZR1_YEAST RecName: Full=Azole resistance protein 1;
   62::155     3e-06  28%  396 aa  YWOG_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoG;
  251::360     3e-06  27%  463 aa  NORB_STAAR RecName: Full=Quinolone resistance protein norB;
    5::162     5e-06  20%  389 aa  YDHP_ECOLI RecName: Full=Inner membrane transport protein ydhP;
    5::162     5e-06  20%  389 aa  YDHP_ECO57 RecName: Full=Inner membrane transport protein ydhP;
   11::170     5e-06  25%  399 aa  SOTB_KLEP3 RecName: Full=Probable sugar efflux transporter;
  251::360     5e-06  26%  463 aa  NORB_STAAW RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAAS RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAAN RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAAM RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAA9 RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAA2 RecName: Full=Quinolone resistance protein norB;
  251::360     5e-06  26%  463 aa  NORB_STAA1 RecName: Full=Quinolone resistance protein norB;
   18::173     6e-06  22%  407 aa  SOTB_PSESM RecName: Full=Probable sugar efflux transporter;
   11::170     6e-06  24%  395 aa  SOTB_ERWCH RecName: Full=Sugar efflux transporter B;
   31::158     8e-06  23%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
  251::360     8e-06  26%  463 aa  NORB_STAAB RecName: Full=Quinolone resistance protein norB;
  118::229     1e-05  28%  535 aa  YKH4_CAEEL RecName: Full=Uncharacterized transporter C02C2.4;
  251::360     1e-05  25%  463 aa  NORB_STAAT RecName: Full=Quinolone resistance protein norB;
  251::360     1e-05  25%  463 aa  NORB_STAAE RecName: Full=Quinolone resistance protein norB;
  251::360     1e-05  25%  463 aa  NORB_STAAC RecName: Full=Quinolone resistance protein norB;
  251::360     1e-05  25%  463 aa  NORB_STAA8 RecName: Full=Quinolone resistance protein norB;
  251::360     1e-05  25%  463 aa  NORB_STAA3 RecName: Full=Quinolone resistance protein norB;
  169::323     2e-05  23%  614 aa  TPO2_YEAST RecName: Full=Polyamine transporter 2;
   11::170     2e-05  23%  396 aa  SOTB_SHISS RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_SHIFL RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_SHIF8 RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_SHIBS RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_SHIB3 RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOSM RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOSE RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOLU RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOLI RecName: Full=Sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOLC RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOHS RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECODH RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECOBW RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO8A RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO7I RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO5E RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO57 RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO55 RecName: Full=Probable sugar efflux transporter;
   11::170     2e-05  23%  396 aa  SOTB_ECO24 RecName: Full=Probable sugar efflux transporter;
   64::163     3e-05  23%  403 aa  YDHC_ECOLI RecName: Full=Inner membrane transport protein ydhC;
   11::170     3e-05  23%  396 aa  SOTB_ECOUT RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECOL6 RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECOL5 RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECOK1 RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECO81 RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECO45 RecName: Full=Probable sugar efflux transporter;
   11::170     3e-05  23%  396 aa  SOTB_ECO27 RecName: Full=Probable sugar efflux transporter;
   69::163     4e-05  29%  457 aa  XYLT_LACBR RecName: Full=D-xylose-proton symporter;AltName:
  178::332     4e-05  23%  622 aa  TPO3_YEAST RecName: Full=Polyamine transporter 3;
   10::172     7e-05  21%  422 aa  YITG_BACSU RecName: Full=Uncharacterized MFS-type transporter yitG;
  200::359     9e-05  24%  397 aa  YTTB_BACSU RecName: Full=Uncharacterized MFS-type transporter yttB;
   84::177     9e-05  29%  396 aa  NEPI_ECO27 RecName: Full=Purine ribonucleoside efflux pump nepI;
   96::247     9e-05  28%  546 aa  FLVC2_RAT RecName: Full=Feline leukemia virus subgroup C
   96::253     9e-05  28%  551 aa  FLVC2_MOUSE RecName: Full=Feline leukemia virus subgroup C
   12::170     1e-04  21%  404 aa  SOTB_PASMU RecName: Full=Probable sugar efflux transporter;
    4::160     1e-04  21%  394 aa  ARAJ_ECOLI RecName: Full=Protein araJ;
  100::258     1e-04  18%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   14::98      2e-04  37%  507 aa  MOT9_CHICK RecName: Full=Monocarboxylate transporter 9;       
   68::153     2e-04  35%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
  169::292     3e-04  35%  485 aa  NUON_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit N;    
   75::116     3e-04  38%  484 aa  MOT2_MESAU RecName: Full=Monocarboxylate transporter 2;       
   76::118     4e-04  42%  470 aa  MOT4_MOUSE RecName: Full=Monocarboxylate transporter 4;       
   80::121     4e-04  40%  489 aa  MOT2_RAT RecName: Full=Monocarboxylate transporter 2;       
   46::121     4e-04  25%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   46::121     4e-04  25%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   69::230     4e-04  26%  526 aa  FLVC2_HUMAN RecName: Full=Feline leukemia virus subgroup C
   51::127     5e-04  38%  405 aa  Y4RN_RHISN RecName: Full=Uncharacterized MFS-type transporter y4rN;
   89::181     5e-04  29%  508 aa  PLT3_ARATH RecName: Full=Probable polyol transporter 3;
  169::292     5e-04  40%  485 aa  NUON_SALAR RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     5e-04  39%  485 aa  NUON_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit N;    
   76::118     5e-04  42%  465 aa  MOT4_HUMAN RecName: Full=Monocarboxylate transporter 4;       
   11::170     6e-04  24%  398 aa  SOTB_ENT38 RecName: Full=Probable sugar efflux transporter;
  169::292     6e-04  40%  485 aa  NUON_SHISS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALTY RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALTI RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALSV RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  38%  485 aa  NUON_SALPC RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALPB RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALNS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALHS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALG2 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALEP RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALDC RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALCH RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     6e-04  40%  485 aa  NUON_ECO81 RecName: Full=NADH-quinone oxidoreductase subunit N;    
   32::172     6e-04  23%  505 aa  MOT6_HUMAN RecName: Full=Monocarboxylate transporter 6;       
   95::159     6e-04  31%  564 aa  LAT3_MOUSE RecName: Full=Large neutral amino acids transporter
  169::292     8e-04  38%  485 aa  NUON_SALPA RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOSE RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECOBW RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO8A RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO7I RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO5E RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO55 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO27 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  169::292     8e-04  40%  485 aa  NUON_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit N;    
   76::118     8e-04  40%  471 aa  MOT4_RAT RecName: Full=Monocarboxylate transporter 4;       
   74::115     8e-04  40%  478 aa  MOT2_HUMAN RecName: Full=Monocarboxylate transporter 2;       
    1::471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTEGRRHAGMKRVKSERMGVYALFAIVVLASASGNLSQTAVNAMLGDIMLQFGLTVDLGQWLTTSY
YHCA_BACSU      ---------------------------------------LNQTLLNVAMPHLMTEFGVSATTIQWLTTGY
YCNB_BACSU      ---------------------------------------LNQTLLITALPHIMRDFNVDANQAQWLTTSF
LMRB_BACSU      ------------------SQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMKELNITAATVQWLTTGY
LMRB_LISMO      --------------------------IIASFLMAGFIGLFSETALNMALSDLIQVFDISSATVQWXXXXX
LMRB_LISIN      --------------------------IIASFLMAGFIGLFSETALNMALSDLIQVFDISSATVQWXXXXX
TCMA_STRGA      ---------------------------------------------------------------QWITNGY
EMRB_ECOLI      --------------------------------LATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSF
EMRB_ECO57      --------------------------------LATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSF
YFIU_BACSU      -----------------KSQKWAI-SLFTIGVFMAA---LDNGIISAALTTINESFSVSPSWGSWGITLY
BMR3_BACSU      -------------------------------ILMSAMDN---TIVATAMGNIVADLG-SFDKFAWVTASY
YEBQ_ECOLI      ------------------------YGAILTIVIGISMAVLDGAIANVALPTIATDLHATPASSIWVVNAY
QACA_STAAU      ----------------------------------------------------------------WIVDIY
QACA_STAAM      ----------------------------------------------------------------WIVDIY
MMR_STRCO       -----------AGGRRDVPSGVKITALATGFVMAT----LDVTVVNVAGATIQESLDTTLTQLTWIVDGY
YWOD_BACSU      ----------------------------AVFLTAVASGTLNSSMISLALHSIQHEFHLSFTTVSWLISSF
TCR_STRPN       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
TCR_BACSU       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
TCR_BACST       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
TCR_BACCE       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
MDTD_PECCP      -----------------------------IVAFGFFMQTLDTTIVNTALPSMAASLNESPLHMHSVIVSY
EMRB_HAEIN      ---------------------------------------LDSTIANVAIPTIAGDLGASFSQGTWVITSF
MDTD_YERE8      ----------------------GIRAQLWIVAFGFFMQTLDTTIVNTALPSMAASLGENPLRMQSVIVSY
TCR_STAES       ------------------------YSVLFWLCILSFFSVLNEMVLNVSLPDIANHFNTTPGITNWVNTAY
TCR_STAAU       ------------------------YSVLFWLCILSFFSVLNEMVLNVSLPDIANHFNTTPGITNWVNTAY
TCRB_BACSU      ---------------------------------------LNEMVLNVSLPDIANEFNKLPASANWVNTAF
TCR_STRAG       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
MDTD_SERP5      -----------------------------IVAFGFFMQTLDTTIVNTALPSMAVSLGENPLRMQSVIVSY
MDTD_YERPS      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
PBUE_BACSU      -------------------------------VFLLAASTIAVGLVELIVGGILPQIANDLDIGQ-LISVF
MDTD_YERPY      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPP      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPN      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPG      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPE      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPB      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERPA      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
MDTD_YERP3      -----------------------------IVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSY
PBUE_BACAM      -------------------------------VFLLAASTIAVGLVELIVGGILPQIASDLDIGQ-LISVF
EMRY_ECOLI      --------------------------------LATFMQMLDSTISNVAIPTISGFLGASTDEGTWVITSF
YVKA_BACSU      ------------------------WALIVSLLLGAILVPINSTMIAVALSSISHTYNESIASITWVVTVY
BAIG_EUBSP      ---------------------------FAIALLVSLIGGFTAVLGPAFVADQGIDYNNTT----WIXXXX
YFHI_BACSU      -----------------------------VLMICTFSIGYTEYAVMGILTSIANDFHIQVSSAGLLVTAY
MMR_BACSU       ---------KNSGSIQESTSSTGISVLI-VLALGFLMATLDVTVVNVAMADMKNTLSMSLSGVTWVVDGY
YTBD_BACSU      ------------------ANKSNIPALLALAVSAFAIGTTEFISVGXXXXXXXXXXXXVTTAG--LTVS-
YUSP_BACSU      -----------------------ITGLIIAMFFSALDGTIVGTAMPKIVGDLG---GLS--MMTWLTTAY
TCR_STAHY       ---------------------------------------LNEMVLNVSLPDIANDFNKPPASTNWVNTAF
MDTD_CITK8      -----------------------------IVAFGFFMQSLDTTIVNTALPSMALSLGESPLHMHMVVVSY
MDTD_SALPB      -----------------------------IVALGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALHS      -----------------------------IVALGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_ENTS8      ---------------------------------------LDTTIVNTALPSMAASLGESPLRMHMVIVSY
MDTD_KLEP3      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMIIVSY
YI32_SCHPO      ----------------------------------------------------------------WIGTAY
SOTB_HAEIN      ----------------LKAEKIQSWRVL-IMACAGFIFNTTEFVPVAMLSDIAQSFDMTADTGLMMTVYA
SOTB_HAEIG      ----------------LKAEKIQSWRVL-IMACAGFIFNTTEFVPVAMLSDIAQSFDMTADTGLMMTVYA
MDTD_SALTY      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALTI      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALSV      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALPK      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALPA      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALNS      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALEP      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_SALA4      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
MDTD_KLEP7      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMIIVSY
HSRA_ECOLI      -----------------------------IAAMAFFMQALDATILNTALPAIAHSLNRSPLAMQSAIISY
MDTD_SALDC      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSY
YAN6_SCHPO      ----------------------------------------------------------------WIGTAY
VBA5_YEAST      --------------------------------------------VGTIIDVVAEQFGNYSKTG-WLVTGY
SOTB_HAEI8      ----------------LKAEKIQSWRVL-IMACAGFIFNTTEFVPVAMLSDIAQSFDMTADTGLMMTVYA
MDTD_ESCF3      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ENT38      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVIVSY
MDTD_SHISS      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_SHIFL      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_SHIBS      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_SHIB3      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOUT      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOSM      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOSE      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOLU      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOLI      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOLC      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOL6      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOL5      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOK1      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOHS      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECODH      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECOBW      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO8A      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO81      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO7I      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO5E      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO57      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO55      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO45      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO27      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
MDTD_ECO24      -----------------------------IVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSY
YBCL_BACSU      -----------------------------ILAIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQLITIF
SOTB_ERWT9      -------------MQTTPVSRKTAWLRVLMLAIAAFIFNTTEFVPVGLLSDIGSSFSMTAQVGLMLTIYA
MDTD_SHIF8      -----------------------------IVAFGFFMQSLDTTIVNTAIPSMAQSLGESPLHMHMVIVSY
SOTB_SALTY      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALTI      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALSV      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALPK      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALPC      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALPB      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALPA      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALNS      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALHS      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALG2      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALEP      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALDC      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALCH      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALAR      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_SALA4      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAESFHMTAQVGIMLTIYA
SOTB_CITK8      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIARSFAMTAQVGIMLTIYA
MDTD_ERWCT      -----------------------------IVAFGFFMQTLDTTIVNTALPSMAASLNESPLHMHSVIVSY
YUBD_BACSU      ----------------MKTKHYWVISLLA--VLAVGPGLMSNTALSSVQGLVQKTVGTSVFTSVNPILIG
SOTB_PSE14      ---------------------LGVFAL----ALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIY
SOTB_PSEU2      ---------------------LGVFAL----ALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIY
VBA2_YEAST      -----------------------------------------------------------MSISNWITTAY
SGE1_YEAST      ----------------------------------------------------------------WLVTGY
SOTB_KLEP7      -------------------------AWLRVVTLAIAAFNTTEFAPVGLLSDIADSFGMTAQVGMMLTIYA
AZR1_YEAST      --------------------------------------------VSTIIEEVAKQFGSYSEIG-WLFTGY
YWOG_BACSU      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YDHP_ECOLI      ------------------------YPLLALAIGAFGIGT-TEFSPMGLLPVIARGVDVSIPAAGMLISAY
YDHP_ECO57      ------------------------YPLLALAIGAFGIGT-TEFSPMGLLPVIARGVDVSIPAAGMLISAY
SOTB_KLEP3      -------------------------AWLRVVTLAIAAFNTTEFAPVGLLSDIAGSFGMTAQVGMMLTIYA
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
NORB_STAAN      ----------------------------------------------------------------------
NORB_STAAM      ----------------------------------------------------------------------
NORB_STAA9      ----------------------------------------------------------------------
NORB_STAA2      ----------------------------------------------------------------------
NORB_STAA1      ----------------------------------------------------------------------
SOTB_PSESM      ---------------------LGVFAL----ALAAFIFNTTEFVPIGLLSNIGQSFDMTPAQVGLMLTIY
SOTB_ERWCH      -------------------------AWLRVVTLAIAAFNTTEFIPVGLLSDIANSFAMTEDVGLMITI-Y
YCEJ_BACSU      ------------------------------------------------------QFHVSTDLSGWMVSAY
NORB_STAAB      ----------------------------------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
NORB_STAAT      ----------------------------------------------------------------------
NORB_STAAE      ----------------------------------------------------------------------
NORB_STAAC      ----------------------------------------------------------------------
NORB_STAA8      ----------------------------------------------------------------------
NORB_STAA3      ----------------------------------------------------------------------
TPO2_YEAST      --------------------RWSYTVLLSILVICVAYGS---ACISGGLGTVEKKYHVGMEAA--ILSCS
SOTB_SHISS      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_SHIFL      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_SHIF8      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_SHIBS      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_SHIB3      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOSM      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOSE      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOLU      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOLI      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOLC      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOHS      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECODH      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECOBW      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO8A      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO7I      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO5E      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO57      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO55      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
SOTB_ECO24      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAQSFHMTAQVGIMLTIYA
YDHC_ECOLI      ----------------------------------------------------------------------
SOTB_ECOUT      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECOL6      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECOL5      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECOK1      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECO81      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECO45      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
SOTB_ECO27      -------------------------AWLRVVTLAVAAFNTTEFVPVGLLSDIAHSFHMTAQVGIMLTIYA
XYLT_LACBR      ----------------------------------------------------------------------
TPO3_YEAST      --------------------RWSYTVLLSILVICVAYGS---ACISGGLGTVEKKYHVGMEAA--ILSVS
YITG_BACSU      -----------------------------MTIVAIGSIPLILTLGNSMLIPILPKMKSELHLSQFVITVF
YTTB_BACSU      -------------------------AKFAALIILSGGGWLAYSQWSTTIASYTQSIGISLSLYSWTVNGI
NEPI_ECO27      ----------------------------------------------------------------------
FLVC2_RAT       ---------------KVSKRRWAVVLVFSCYSLCNAFQWIQYGSINNIF---MNFYGVSAFAIDWLSMCY
FLVC2_MOUSE     ---------REDSVIKVSKRRWVVVLVFSCYSLCNAFQWIQYGSINNIF---MNFYGVSAFAIDWLSMCY
SOTB_PASMU      ---------------------------FARVITFALAGNTTEFIPVALLSDIAQSFAMPVSQTGLIITVY
ARAJ_ECOLI      ------------------------------VILSLALGTMAEFGIMGVLTELAHNVGISIPAAGHMISYY
AQR1_YEAST      ------------------------WGMVAILTMCGFWSSLGSPIYYPALRQLEKQFXXXXXXXXXXXXXY
MOT9_CHICK      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
NUON_ENT38      ------------------------FLLFGIALLYAQSGNLSFVALGKSLGDNMLHLGFKLSLVPFHLWTP
MOT2_MESAU      ----------------------------------------------------------------------
MOT4_MOUSE      ----------------------------------------------------------------------
MOT2_RAT        ----------------------------------------------------------------------
GALP_ECOLI      ------------------------------------------------------EFQITSHTQEWVVSSM
GALP_ECOL6      ------------------------------------------------------EFQITSHTQEWVVSSM
FLVC2_HUMAN     -----SSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIF---MHFYGVSAFAIDWLSMCY
Y4RN_RHISN      ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
NUON_SALAR      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLRFGLIVGLGLWTPDVY
NUON_CITK8      ------------------------FLLFGMALVYAQSGNLSFVALGKSLGDGMLHFGLIVGLGLWTPDVY
MOT4_HUMAN      ----------------------------------------------------------------------
SOTB_ENT38      -------------------------AWLRVVTLAIAAFNTTEFVPVGLLSDIAQSFQMTAQVGIMLTIYA
NUON_SHISS      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_SALTY      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALTI      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALSV      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALPC      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGFKLSLAP
NUON_SALPB      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALNS      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALHS      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALG2      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALEP      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALDC      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALCH      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_SALA4      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLIVGLGLWTPDVY
NUON_ECO81      ------------------------FLLFGMALVYAQSGDLSFVALGKKLGDGMLNFGLIVGLGLWTPDVY
MOT6_HUMAN      ------------------------------------------TCIGIFFTELQWEFQASNSETSWFPSIL
LAT3_MOUSE      ----------------------------------------------------------------------
NUON_SALPA      ------------------------FLLFGMALVYAQSGNLSFEALGKSLGDGMLHFGLLVPFHLWTPDVY
NUON_ECOUT      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOSM      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOSE      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOLI      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOLC      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOL6      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOL5      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOK1      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOHS      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECOBW      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO8A      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO7I      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO5E      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO57      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO55      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO27      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
NUON_ECO24      ------------------------FLLFGMALVYAQSGDLSFVALGKNLGDGMLNFGLIVGLGLWTPDVY
MOT4_RAT        ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAGRVFQAISTGMLMPLMQTIAM
YHCA_BACSU      MLVNGVLIPLSAFLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTIL
YCNB_BACSU      MLTNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMMPLMQTVFL
LMRB_BACSU      LLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIXXXXXXXXXXXXXRIVQALGTGLLLPLMFNTIL
LMRB_LISMO      XXXXXXXVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTIL
LMRB_LISIN      XXXXXXXVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTIL
TCMA_STRGA      LLALAVSLITAGKLGDRFGHRQTFLVGVAGFAVTSAAIGLSGSVAAIVVFRVLQGLFGALMQPSALGLLR
EMRB_ECOLI      GVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLL
EMRB_ECO57      GVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLL
YFIU_BACSU      TLGLSVSVPIVGKLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHIL
BMR3_BACSU      MVAVMAGMPIYGKLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGALLPIAFTIIF
YEBQ_ECOLI      QIAIVISLLSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAALMSVNTALIR
QACA_STAAU      SLVLGFIIPLSAFADK-WGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIR
QACA_STAAM      SLVLGFIIPLSAFADK-WGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIR
MMR_STRCO       VLTFASLLMLAGGLANRIGAKTVYLWGMGVFFLASLACALAPTAETLIAARLVQGAGAAXXXXXXXXXXX
YWOD_BACSU      YLASAVAQPVTGKLGDLIGRKRLFLFGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAIYPSGVGLIR
TCR_STRPN       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
TCR_BACSU       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
TCR_BACST       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
TCR_BACCE       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
MDTD_PECCP      VLTVAVMLPASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLNELLASRVIQGIGGAMMVPVGRLTVM
EMRB_HAEIN      GVANAISIPITGWLAKRFGEVRLFLVSTFLFVVSSWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLL
MDTD_YERE8      VLTVAVMLPASGWLADRVGVKWVFFSAIILFTLGSLLCAQAETLNELISSRVIQGIGGAMMVPVGRLTVM
TCR_STAES       MLTFSIGTAVYGKLSDYINXXXXXXXXXXXXXXXXXXAFIGHNFFILIFGRLVQGVGSAAFPSLIMVVVA
TCR_STAAU       MLTFSIGTAVYGKLSDYINXXXXXXXXXXXXXXXXXXAFIGHNFFILIFGRLVQGVGSAAFPSLIMVVVA
TCRB_BACSU      MLTFSIGTALYGKLSDQLGIKNLLLFGIMVNGLGSIIGFVGHSFPILILARFIQGIGAAAFPALVMVVVA
TCR_STRAG       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
MDTD_SERP5      VLTVAVMLPASGWLADRVGVQRVFFSAIVLFTLGSILCARSETLNELIASRVVQGIGGAMMVPVGRLTVM
MDTD_YERPS      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGDAMMVPVGRLTVM
PBUE_BACSU      ALGYAVSGPLLLALTAKIERKRLYLIALFVFFLSNLVAYFSPNFATLMVSRVLAAMSTGLIVVLSLTIAP
MDTD_YERPY      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPP      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPN      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPG      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPE      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPB      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERPA      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
MDTD_YERP3      VLTVAVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVM
PBUE_BACAM      ALGYAVSGPLLLAVTAKAERKRLYLIALFVFFLSNLVAYFSPNFAVLMVSRVLASMSTGLIVVLSLTIAP
EMRY_ECOLI      GVANAIAIPVTGRLAQRIGEXXXXXXXXXXXXXXXXXXXXXTNLDVLIFFRVVQGLMAGPLIPLSQSLLL
YVKA_BACSU      LIVMAVTQPIAGKLGDMYGNKTMYLWGVGLFLIAXXXXXXXXXXXXXIVFRALQAVGGALLTPNSIAIIR
BAIG_EUBSP      XXXXXXXXPILGKLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAAISPIVMAYIV
YFHI_BACSU      AASVCLTGPLVTIISVKLPRKPVLLGLMAIFILSNLMSALAPNFAVLAISRILSASIHGAFFAIAMVFAS
MMR_BACSU       ILTFXXXXXXXXXXXDRFGSKTIYILGLAVFVMASCLCAASINGQMLIAGRLIQGIGXXXXXXXXXXXXX
YTBD_BACSU      LYALGVTAPILTSLTSSMSRKTLLLWIMFIFIAGNTMAATASSIGILLAARVISAFSHGVFMSIGSTIAA
YUSP_BACSU      LLTSTTIVPIAGKLADLLGRRIVYVSGLIIFMAASALCGMANNMTELXXXXXXXXXXXXXXXXXXXXXXX
TCR_STAHY       MLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVA
MDTD_CITK8      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCAWSSTLNELVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALPB      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALHS      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_ENTS8      VLTVAVMLPASGWLADRVGVRNIFFTAIVLFTLGSLFCAQSSTLNELVAARVLQGIGGAMMVPVGRLTVM
MDTD_KLEP3      VLTVAVMLPASGWLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGIGGAMMVPVGRLTVM
YI32_SCHPO      SLAETSILPFCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGIMSLVTIVIA
SOTB_HAEIN      WTVLIMSLP-AMLATGNMERKSXXXXXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVM
SOTB_HAEIG      WTVLIMSLP-AMLATGNMERKSXXXXXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVM
MDTD_SALTY      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALTI      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALSV      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALPK      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALPA      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALNS      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALEP      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_SALA4      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
MDTD_KLEP7      VLTVAVMLPASGWLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGVGGAMMVPVGRLTVM
HSRA_ECOLI      TLTVAMLIPVSGWLADRFGTRRIFTLAVSLFTLGSLACALSNSLPQLVVFRVIQGIGGAMMMPVARLALL
MDTD_SALDC      VLTVAVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVM
YAN6_SCHPO      TLAQTSILPFCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGITSLVTIVIA
VBA5_YEAST      SLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGC
SOTB_HAEI8      WTVLIMSLP-AMLATGNMERKSXXXXXXXXXXVGHILLVIAWNFWILLLARMCIALAHSVFWSITASLVM
MDTD_ESCF3      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSATLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ENT38      VLTVAVMLPASGWMADKIGVRNIFFTAIVLFTLGSLFCAKADTLNELVMSRVLQGVGGAMMVPVGRLTVM
MDTD_SHISS      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_SHIFL      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_SHIBS      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_SHIB3      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOUT      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOSM      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOSE      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOLU      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOLI      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOLC      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOL6      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOL5      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOK1      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOHS      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECODH      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECOBW      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO8A      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO81      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO7I      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO5E      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO57      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO55      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO45      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO27      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
MDTD_ECO24      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
YBCL_BACSU      SLVYALSTPVLMALTASMDRRKLMMYALGLFVFGNVLAFVLPGYGWFXXXXXXXXXXXXXXXXXXXXXXX
SOTB_ERWT9      WVVALMSLPMM-LLTRNVERRMLLMIIFVMFVASHALSSVAWDFTTLLISRIGIALSHAIFWSITASLAI
MDTD_SHIF8      VLTVAVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVM
SOTB_SALTY      WVVAVMSLPFM-LLTSQMERRKLLIYLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALTI      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALSV      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALPK      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALPC      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALPB      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALPA      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALNS      WVVAVMSLPFM-LLTSQMERRKLLIYLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALHS      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALG2      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALEP      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALDC      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALCH      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_SALAR      WVVAVMSLPFM-LLTSQIERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFTHAIFWSITASLAI
SOTB_SALA4      WVVAVMSLPFM-LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAI
SOTB_CITK8      WVVALMSLPFM-LLTSQVERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAVFWSITASLAI
MDTD_ERWCT      VLTVAVMLPASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLDELLISRVIQGIGGAMMVPVGRLTVM
YUBD_BACSU      NMAFALLVPAGPLLRKKFGARPVYLASLPVFILGSLLIACSGDIALMAAGRFLQGAATGXXXXXXXXXXX
SOTB_PSE14      AWVVSLMSLPMMLATRNIERRKLLMFVFGLFVVSHVLSAISPSFAILLVSRVGIAFAHAVFWSVTASLAV
SOTB_PSEU2      AWVVSLMSLPMMLATRNIERRKLLMFVFGLFVVSHVLSAIAPSFAILLVSRVGIAFAHAVFWSVTASLAV
VBA2_YEAST      LITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAXXXXXXXXXXXXXXXVNS
SGE1_YEAST      ALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVFGGSGIESLAFVVGTSIV
SOTB_KLEP7      WVVALMSLPFM-LLTSKVEXXXXXXXXXXXXXASHVLSFFAWNFDVLVISRIGIAFAHAVFWSITSALAI
AZR1_YEAST      SLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLXXXXXXXXXXXXXXQSLSFVIGS
YWOG_BACSU      ------TRPFSGAIVERFGKKRMAIVSMALFALSSFLYMPIHNFSLLLGLRFFQGIWFSILTTVTGAIAA
NORB_STAAR      ----------------------------------------------------------------------
YDHP_ECOLI      AVGVMVGAPLMTXXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAA
YDHP_ECO57      AVGVMVGAPLMTXXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAA
SOTB_KLEP3      WVVALMSLPFM-LLTSKMEXXXXXXXXXXXXXASHVLSFFAWSFDVLVISRIGIAFAHAVFWSITSALAI
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
NORB_STAAN      ----------------------------------------------------------------------
NORB_STAAM      ----------------------------------------------------------------------
NORB_STAA9      ----------------------------------------------------------------------
NORB_STAA2      ----------------------------------------------------------------------
NORB_STAA1      ----------------------------------------------------------------------
SOTB_PSESM      AWVVSLMSLPMMLATRNIERRKLLMFVFGLFVVSHVISAMASSFAILLVSRVGIAFAHAVFWSVTASLAV
SOTB_ERWCH      AWIVAVASLICMLLTSGIERRKXXXXXXXXXXXXXXXXAVAWNFTVLVISRAGVALAHSVFWSITASLAI
YCEJ_BACSU      ALGYALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAFVTPQIWASIP
NORB_STAAB      ----------------------------------------------------------------------
YKH4_CAEEL      -----ITVLPSMFFIERFSPRHVLQISVALYLVTVITPFLATHFGYVFLARIGMGLGEGFVFPTNNAIIG
NORB_STAAT      ----------------------------------------------------------------------
NORB_STAAE      ----------------------------------------------------------------------
NORB_STAAC      ----------------------------------------------------------------------
NORB_STAA8      ----------------------------------------------------------------------
NORB_STAA3      ----------------------------------------------------------------------
TPO2_YEAST      LMVIGFSLPVSDLYGRRVAY----FVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIA
SOTB_SHISS      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_SHIFL      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_SHIF8      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_SHIBS      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_SHIB3      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOSM      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOSE      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOLU      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOLI      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOLC      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOHS      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECODH      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOBW      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO8A      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO7I      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO5E      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO57      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO55      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO24      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
YDHC_ECOLI      -------------LSDRYGRKPVLLIGLTIFALGSLGMLWVENAATLLVLRFVQAVGVCAAAVIWQALVT
SOTB_ECOUT      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOL6      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOL5      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECOK1      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO81      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO45      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
SOTB_ECO27      WVVALMSLPFMLMTSQ-VERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAI
XYLT_LACBR      ----------------RFGRRKLLLLSAIIFFVGALGSAFSPEFWTLIISRIILGMAVGAASALIPTYLA
TPO3_YEAST      LMVIGFSLPVSDLYGRRVAY----FVSMGLYVIFNIPCALAPNLGSLLACRFLCGVWSSSGLCLVGGSIA
YITG_BACSU      SLIAAFAIPIVGYLADRFSRKVIIIPCLILYXXXXXXXXXXXXYPWVMAGRALQGIGAAGTGPIAMALTG
YTTB_BACSU      LIVLG--QPLVSFVVKKWSLKAQMXXXXXXXXXXXXMLLTAKQFPMFLAAMVILTIGEMLVWPAVPTIAN
NEPI_ECO27      --------------------RRYVVILFAVLLLSCLLVSFANSFSLLLIGRACLGLALGGFWAISASLTM
FLVC2_RAT       MLTIPLLLPVAWML-EKFGLRTIAITGSALNCLGALGSLEPHLFPVTMVGQVICSVAQVFILGMPSRIAS
FLVC2_MOUSE     MLTIPLLLPVAWML-EKFGLRTIAITGSALNCLGALGSLEPHLFPVTMVGQVICSVAQVFILGMPSRIAS
SOTB_PASMU      AWVVSLMSLPFMLLTAKAERRGXXXXXXXXXXXXXXXXXXAWDFWVLVLARIGVALTHSIFWAITASLVI
ARAJ_ECOLI      ALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFG-VGAIVL
AQR1_YEAST      LLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVG
MOT9_CHICK      ----------------------------------------------------------------------
CSBC_BACSU      --------------SDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGALVPVLSEMAP
NUON_ENT38      DVYQGAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGVIAFASIIFGNLMALSQT---
MOT2_MESAU      ----------------------------------------------------------------------
MOT4_MOUSE      ----------------------------------------------------------------------
MOT2_RAT        ----------------------------------------------------------------------
GALP_ECOLI      MFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGV----------
GALP_ECOL6      MFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGV----------
FLVC2_HUMAN     MLTIPLLLPVA-WLLEKFGLRTIALTGSALNCLGALGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIAS
Y4RN_RHISN      ----------------------------------------------------------------------
PLT3_ARATH      --------------------RYTIALSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGMIAPVYSAEIS
NUON_SALAR      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_CITK8      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--IVLGVIAFASIIFGNLMALSQT---
MOT4_HUMAN      ----------------------------------------------------------------------
SOTB_ENT38      WVVALMSLPFMLLTSQM--ERRKLLIGLVLFIASHVLSFLAWNFNVLVISRIGIAFAHAIFWSITASLAI
NUON_SHISS      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPMGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_SALTY      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALTI      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALSV      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALPC      FVYQGAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALPB      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALNS      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALHS      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALG2      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALEP      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALDC      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALCH      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_SALA4      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_ECO81      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
MOT6_HUMAN      TAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGF-ITGLGMCFSFQSSITV
LAT3_MOUSE      ----------------------------------------------------------------------
NUON_SALPA      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEAVR--VVLGIIAFASIIFGNLMALSQT---
NUON_ECOUT      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOSM      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOSE      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOLI      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOLC      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOL6      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOL5      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOK1      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOHS      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECOBW      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO8A      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO7I      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO5E      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO57      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO55      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO27      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
NUON_ECO24      Q---GAPAPVSTFLATASKIA--IFVVMRLFLYAPVGDSEA--IRVVLAIIAFASIIFGNLMALSQT---
MOT4_RAT        ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWRSFFXXXXXXXXXXXXXXXXXXKPSAAPDKS
YHCA_BACSU      LIFPPESRGKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFYGLVPIGXXXXXXXXXXXKNMVEPQK-
YCNB_BACSU      TIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVIDLILASILMK-NVTTLRK
LMRB_BACSU      VIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWISLPFLVLALVFGIAYMQ-NVSETTK
LMRB_LISMO      LIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTK-
LMRB_LISIN      LIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTK-
TCMA_STRGA      VTFPPGKLNMAIGIWSGVVGASTAAGPIIGGLLVQHVGWEAVFFINVPXXXXXXXXXXXILTDARAERAP
EMRB_ECOLI      NNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVAVVLMXXXXXXXXXXXXXX
EMRB_ECO57      NNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVAVVLMXXXXXXXXXXXXXX
YFIU_BACSU      ATLPKEKQGKALGLLGAMNGMAAVLGPNIGSLLDWTGSWHWLFLINLPIAVLLVVFGACFIAETKAPE-A
BMR3_BACSU      DLFPPEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSISWHWVFYINVPIGALSLFFIIRYYKESLEHRKQ
YEBQ_ECOLI      LIYPQRFLGRGMGINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLGIIALLLAMRFLPPNGSRASK
QACA_STAAU      VIFENPKEATALAVWSIASSIGAVFGPIIGGALLEQFSWHSFLINVPFAIIAVVAGLFLLPESKLSKEKS
QACA_STAAM      VIFENPKEATALAVWSIASSIGAVFGPIIGGALLEQFSWHSFLINVPFAIIAVVAGLFLLPESKLSKEKS
MMR_STRCO       XXXPEKRQRTRMGLWSAIVATSSGLGPTVGGLMVSAFGWESIFLLNLPIGAIGMAMTYRYI--AATESRA
YWOD_BACSU      NHI-HERQASALAVLSIFASAMTALGPTAGGFLIVWGGWPAIFFIILSFLLGLYMFPKDQKKGAGIKTII
TCR_STRPN       RYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRI---K
TCR_BACSU       RYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRI---K
TCR_BACST       RYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRI---K
TCR_BACCE       RYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRI---K
MDTD_PECCP      KIVPRDQYMAAMTFVTLPGQIGPLMGPALGGFLVEYASWHWIFLINLPVGIIGALATWFLMPNYTM--RT
EMRB_HAEIN      NNYPPEKRGMALAFWSMTIVVAPIFGPILGGWISDNIHWGWIF---------------------------
MDTD_YERE8      KIVPREQYMSAMAFVTLPGQIGPLVGPALGGFLVEYASWHWIF---------------------------
TCR_STAES       RNITRKKQGKAFGFIGSIVALGEGLGPSIGGIIAHYIHW-SYLLILPMITIVTIPFLIKVMVPGKSTKNT
TCR_STAAU       RNITRKKQGKAFGFIGSIVALGEGLGPSIGGIIAHYIHW-SYLLILPMITIVTIPFLIKVMVPGKSTKNT
TCRB_BACSU      RYIPKENRGKAFGLIGSLVAMGEGVGPAIGGMVAHYIHWSYLLLIPTATIITVPFLIKLLKKEERI---R
TCR_STRAG       RYIPKENRGKAFGLIGSIVAMGEGVGPAIVGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRI---K
MDTD_SERP5      KIVPREQYMAAMTFVTLPGQIGPLMGPALGGFLVQYASWHWIF---------------------------
MDTD_YERPS      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
PBUE_BACSU      KIVAPEYRARAIGIIFMGFSSAIALGVPLGILISDSFGWR------------------------------
MDTD_YERPY      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPP      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPN      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPG      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPE      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPB      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERPA      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
MDTD_YERP3      KIVPREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIF---------------------------
PBUE_BACAM      KIVAPEYRARAIGIIFMGFSSAIALGVPVGIIISNAFGWRVLF---------------------------
EMRY_ECOLI      RNYPPEKRTFALALWSMTVIIAPICGPILGGYINFSWGW-------------------------------
YVKA_BACSU      HVVSEKRLPKVXXXXXXXXXXXXXXXPFIGSILIDSFSWHSIFWVNIPFLAIALFTALTMFPQYKENKSD
BAIG_EUBSP      TEYPQEETGKAFGLYMLISSGAVVVGPTCGGLIMNAAGWRVMMWVCVALCVVVFLICTFSIKKTAFEKKS
YFHI_BACSU      EMVPPEKRAAAAASMNGGLTVALMLGVPFGSYLGDVLNWRAVF---------------------------
MMR_BACSU       XXYLDERRARMFGLWXXXXXXXXXXGPFIGGVLVQLAGWQSIFLINVPIGAAALISAYRIL--SRVPGKS
YTBD_BACSU      DIVPEDKRASAISIMFTGLTVATVTGVPFGTFIGQQFGWRFAF---------------------------
YUSP_BACSU      DLFTGKQRAKFQGVFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGIIAVIFIARGLQ-GRQQTGP
TCR_STAHY       RYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW-------------------------------
MDTD_CITK8      KIVPREQYMAAM----------------------------------------------------------
MDTD_SALPB      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALHS      KIVPRAQYMAAM----------------------------------------------------------
MDTD_ENTS8      KIVPRDQYMAAM----------------------------------------------------------
MDTD_KLEP3      KIVPRDQYMAAM----------------------------------------------------------
YI32_SCHPO      DITPLQTRPYYTGCMGVTWGVASVMGPLIGGAISQNTTWRWIF---------------------------
SOTB_HAEIN      RISPKHKKTQALGMLAIGTALATILGLPIGRIVGQLVGWRVTF---------------------------
SOTB_HAEIG      RISPKHKKTQALGMLAIGTALATILGLPIGRIVGQLVGWRVTF---------------------------
MDTD_SALTY      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALTI      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALSV      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALPK      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALPA      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALNS      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALEP      KIVPRAQYMAAM----------------------------------------------------------
MDTD_SALA4      KIVPRAQYMAAM----------------------------------------------------------
MDTD_KLEP7      KIVPRDQYMAAM----------------------------------------------------------
HSRA_ECOLI      RAYPR-----------------------------------------------------------------
MDTD_SALDC      KIVPRTQYMAAM----------------------------------------------------------
YAN6_SCHPO      DITPLQTRPYYTGCMGVTWGLASVMGPLIGGAISQKASWRWIF---------------------------
VBA5_YEAST      TMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTWRWCF---------------------------
SOTB_HAEI8      RISPKHKKTQALGMLAIGTALATILGLPIGRIVGQLVGWRVTF---------------------------
MDTD_ESCF3      KIVPREQYMAAM----------------------------------------------------------
MDTD_ENT38      KIVPREQYMAAM----------------------------------------------------------
MDTD_SHISS      KIVPREQYMAAM----------------------------------------------------------
MDTD_SHIFL      KIVPREQYMAAM----------------------------------------------------------
MDTD_SHIBS      KIVPREQYMAAM----------------------------------------------------------
MDTD_SHIB3      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOUT      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOSM      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOSE      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOLU      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOLI      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOLC      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOL6      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOL5      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOK1      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOHS      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECODH      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECOBW      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO8A      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO81      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO7I      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO5E      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO57      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO55      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO45      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO27      KIVPREQYMAAM----------------------------------------------------------
MDTD_ECO24      KIVPREQYMAAM----------------------------------------------------------
YBCL_BACSU      XXXSEGKQGSA--IATVVMGFTASIGVPLGRMIAVALGWKSVF---------------------------
SOTB_ERWT9      RVAPQGKKTQALSMMATGTALAMVLGLPIGRMIGQLLGWRITF---------------------------
MDTD_SHIF8      KIVPREQYMAAM----------------------------------------------------------
SOTB_SALTY      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALTI      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALSV      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALPK      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALPC      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALPB      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALPA      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALNS      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALHS      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALG2      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALEP      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALDC      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALCH      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALAR      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_SALA4      RLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTF---------------------------
SOTB_CITK8      RLAPPGKRAQALSLIATGTALAMVLGLPIGRIVGQYFGWRTTF---------------------------
MDTD_ERWCT      KIVPRDQYMAAM----------------------------------------------------------
YUBD_BACSU      XSFPIERRNYALLVL-IGGFYGSVIIGTILGTIATSCGWRWLF---------------------------
SOTB_PSE14      RIAPPGKQVQXXXXXXXXXXXXMVLGIPLGRVLGEALGWRTTF---------------------------
SOTB_PSEU2      RIAPPGKQVQXXXXXXXXXXXXMVLGIPLGRVLGEALGWRT-----------------------------
VBA2_YEAST      DVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASSIGWRWCF---------------------------
SGE1_YEAST      RENHRGIMITALAISYV---IAEGVGPFIGGAFNEHLSWRWCF---------------------------
SOTB_KLEP7      RMAPPGKRAQALSLIATGTALAMVFGIPIGRIIGQYFGWRMTF---------------------------
AZR1_YEAST      TLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSVTWRWCF---------------------------
YWOG_BACSU      DIIPAKRRGEGLGYFAMSMNLAMAIGPFLG----------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YDHP_ECOLI      SVVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSF---------------------------
YDHP_ECO57      SVVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSF---------------------------
SOTB_KLEP3      RMAPPGKRAQALSLIATGTALAMVFGIPIGRIIGQYFGWRMTF---------------------------
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
NORB_STAAN      ----------------------------------------------------------------------
NORB_STAAM      ----------------------------------------------------------------------
NORB_STAA9      ----------------------------------------------------------------------
NORB_STAA2      ----------------------------------------------------------------------
NORB_STAA1      ----------------------------------------------------------------------
SOTB_PSESM      RIAPPGKQVQXXXXXXXXXXXXMVLGIPLGRVLGEALGWRT-----------------------------
SOTB_ERWCH      RMAPPGKRAQALGLIATGSSLAMVLGLPLGRVIGQYLGWRVTF---------------------------
YCEJ_BACSU      VIVQPSQIIKGMGIATAGLAASQMLGLPIGGFLA-SFTWHTPF---------------------------
NORB_STAAB      ----------------------------------------------------------------------
YKH4_CAEEL      NWFPSSEKSTALSIFTLGNQIASAAGPMVAAVCASDLGWPATF---------------------------
NORB_STAAT      ----------------------------------------------------------------------
NORB_STAAE      ----------------------------------------------------------------------
NORB_STAAC      ----------------------------------------------------------------------
NORB_STAA8      ----------------------------------------------------------------------
NORB_STAA3      ----------------------------------------------------------------------
TPO2_YEAST      DMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTG--------------------------------
SOTB_SHISS      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_SHIFL      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_SHIF8      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_SHIBS      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_SHIB3      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOSM      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOSE      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOLU      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOLI      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOLC      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOHS      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECODH      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOBW      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO8A      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO7I      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO5E      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO57      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO55      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO24      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
YDHC_ECOLI      DYYPSQKVNRIFAAIMPLVGLSPALAPLLGSWLLVHFSWQAIF---------------------------
SOTB_ECOUT      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOL6      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOL5      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECOK1      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO81      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO45      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
SOTB_ECO27      RMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTF---------------------------
XYLT_LACBR      ELAPSDKRGTVMVMTGILLAYITNY-----SFSGFYTGWR------------------------------
TPO3_YEAST      DMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTG--------------------------------
YITG_BACSU      DLFKGAQESKVLGLVEASNGMGKVLSPIIGSLIALLVWYGAFF---------------------------
YTTB_BACSU      QLAPKGKEGFYQGFVNSAATGGRMIGPLFGGVLVDHYGIR------------------------------
NEPI_ECO27      RLVPPRTVPKALSVIFGAVSIALVIAAPLGGFLGELIGWRNVF---------------------------
FLVC2_RAT       VWFGANEVSTACSMAGIAIGF-------------------------------------------------
FLVC2_MOUSE     VWFGADEVSTACSVAGIAIGF-------------------------------------------------
SOTB_PASMU      RVAPKDKKSQAIGLLAIGCSLAMILGLPLGRLIGQFFGWRATF---------------------------
ARAJ_ECOLI      SKIIKPGKVTA-AVAGMVSGMANLLGIPLGTYLSQEFSWRYTF---------------------------
AQR1_YEAST      DFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIF---------------------------
MOT9_CHICK      ----------------------------------------------------------------------
CSBC_BACSU      TRGTLGTMNNLMIVTGILLAYIVN----------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
MOT2_MESAU      ----------------------------------------------------------------------
MOT4_MOUSE      ----------------------------------------------------------------------
MOT2_RAT        ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
FLVC2_HUMAN     VWFGANEVSTACSVAGIAIGF-------------------------------------------------
Y4RN_RHISN      ----------------------------------------------------------------------
PLT3_ARATH      SASHRGFLTSLPELCGILLGYVSNY---CFGKLTLKLGWR------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
MOT4_HUMAN      ----------------------------------------------------------------------
SOTB_ENT38      RLAPAGKRXXXXXXXXXXXXXXMVLGLPIGRIVGQYFGWRTTF---------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPC      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_ECO81      ----------------------------------------------------------------------
MOT6_HUMAN      LGFYFVRRANALASMGVSLGI--TLWPLLSRYLLENLGWRGTF---------------------------
LAT3_MOUSE      ----------------------------------------------------------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_ECOUT      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOL6      ----------------------------------------------------------------------
NUON_ECOL5      ----------------------------------------------------------------------
NUON_ECOK1      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
MOT4_RAT        ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ARLDVVSLAQSTLGFGGLLLAXXXXXXXXXXXXXIWAPXXXXXXXXXXXXRRQKRVDDPLISMDIFSSRQ
YHCA_BACSU      IKLDTLGAILSIVGFASLLYGVSEAGSDGWTDPIVLSTXXXXXXXXXXXXXQQLRHDDPMLDFRVFKYDI
YCNB_BACSU      TQIDILSVIXXXXXXXXXXXXXXXXXXXXXXXXTVLISLLVGVIALLLFITRQMKLKKPMLEFRVFTFGV
LMRB_BACSU      PKIDVLSIILSTIGFGGIVFSNAGEGSGGWSSPTXXXXXXXXXXXXXXXXXRQLTMKQPMMNLRAFKYPM
LMRB_LISMO      PKIDILSIILSTLGFGGVVFAFSSAGESGWGSATVLVSIIVGGIALGLFVWRQLTMEKPLMDLKVFKYPM
LMRB_LISIN      PKIDILSIILSTLGFGGVVFAFSSAGENGWGSATVLVSIIVGGIALGLFVWRQLTMEKPLMDLKVFKYPM
TCMA_STRGA      KSFDVSGIVLLSGAMFCLVWGLIKAPAWGWGDLRXXXXXXXXXXXXXXXXXRESRATEPLMPLAMFRSVP
EMRB_ECOLI      XXIDAVGLALLVIGIGSLIMLDRGKELDWFSSQEXXXXXXXXXXXXCFLIVWELTDDNPIVDLSLFKSRN
EMRB_ECO57      XXIDAVGLALLVIGIGSLIMLDRGKELDWFSSQEXXXXXXXXXXXXCFLIVWELTDDNPIVDLSLFKSRN
YFIU_BACSU      KRLDAAGIFLLSLSMYGMTNLDGANLLHSLGNPEVYGCIIFGILCFAALISYEKRVEDPILAYSLLRNHM
BMR3_BACSU      -KIDWGGAITLVVSIVCLMFAELGGKTYDWNSIQIIGLXXXXXXXXXXXXXXERKAEEPIISFWMFKNRL
YEBQ_ECOLI      PRFDLPSAVMNALTFG-LLITALSGFAQGQSLTLIAAELVVMVVVGIFFIRRQXXXXXXXXXXXXXXXXX
QACA_STAAU      HSWDIPSTILSIAGMIGLVWSIKEFSKEGLADIIPWVVIVLAITMIVIFVKRNLSSSDPMLDVRLFKKRS
QACA_STAAM      HSWDIPSTILSIAGMIGLVWSIKEFSKEGLADIIPWVVIVLAITMIVIFVKRNLSSSDPMLDVRLFKKRS
MMR_STRCO       TRLAVPGHLLWIVALAAVSFALIEGPQLGWTAGPXXXXXXXXXXXXXXXXXREHRVTNPVMPWQLFRGPG
YWOD_BACSU      RQLDILGI---VLFAGGIIXXXXXXXXXXTSPHAV--EGVLGLLLLCAFVWRELKTDKPFIDVRLFTQRN
TCR_STRPN       GHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL---------SFLIFVKHIRKVTDPFVDPGLGKNIP
TCR_BACSU       GHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL---------SFLIFVKHIRKVTDPFVDPGLGKNIP
TCR_BACST       GHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL---------SFLIFVKHIRKVTDPFVDPGLGKNIP
TCR_BACCE       GHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL---------SFLIFVKHIRKVTDPFVDPGLGKNIP
MDTD_PECCP      QRFDISGFLWLAVGMATLTLALDGNRSLGIPPIAIFALITVGLIALLSYWLHARRNERALFNLRLFDTHT
EMRB_HAEIN      --------------------------------------------------------DNPVVDISLFHSRN
MDTD_YERE8      ----------------------------------------------------------------------
TCR_STAES       --LDIV---------GIVLMSISIICFMLFTTNYNWXXXXXXXXXXXXXXKHISRVSNPFINPKLGKNIP
TCR_STAAU       --LDIV---------GIVLMSISIICFMLFTTNYNWXXXXXXXXXXXXXXKHISRVSNPFINPKLGKNIP
TCRB_BACSU      GHIDMAGIILMSAGIVFFML-----FTTSYRXXXXXXXXXXXXXXVQHIRKAQDPFVDPELGKNVF----
TCR_STRAG       GHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL---------SFLIFVKHIRKVTDPFVDPGLGKNIL
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
PBUE_BACAM      ----------------------------------------------------------------------
EMRY_ECOLI      --------------------------------------------------------ENPILDLSLFKSRN
YVKA_BACSU      APLDIIG---SLLLAGSIVSIILLTKNEAPWGYTVYS--VLILLFVPLFFRREKRTQHPIIDFALFKSST
BAIG_EUBSP      AGFDKPGAALVVVFFSLFLCIPSFGQNIGWSSTXXXXXXXXXXXXXXXXXMVEKKAKSPIMNGKFMARKE
YFHI_BACSU      ----------------------------------------------------------------------
MMR_BACSU       SRVNIIGHLLGMMALGFLSYALIQGPSAGWRSPVIXXXXXXXXXXXXXXXXREISAKTPILPASLYKNGR
YTBD_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      INFDIAGIFTMIVGVVSLLLALSFGGKDYAWDS--WQXXXXXXXXXXXXVSVESKAKEPILPMYLFKNRT
TCR_STAHY       -----------------------------------------------------RKVTDPFVDPGLGKNIP
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      -----------------------------------------------------------LFSLNLFRNRT
YI32_SCHPO      ----------------------------------------------------------------------
SOTB_HAEIN      ----------------------------------------------------------------------
SOTB_HAEIG      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_KLEP7      -----------------------------------------------------------LFSLNLFRNRT
HSRA_ECOLI      -----------------------------------------------------RRTPNPLISLDLFKTRT
MDTD_SALDC      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SOTB_HAEI8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YBCL_BACSU      ----------------------------------------------------------------------
SOTB_ERWT9      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALTI      ----------------------------------------------------------------------
SOTB_SALSV      ----------------------------------------------------------------------
SOTB_SALPK      ----------------------------------------------------------------------
SOTB_SALPC      ----------------------------------------------------------------------
SOTB_SALPB      ----------------------------------------------------------------------
SOTB_SALPA      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
SOTB_SALHS      ----------------------------------------------------------------------
SOTB_SALG2      ----------------------------------------------------------------------
SOTB_SALEP      ----------------------------------------------------------------------
SOTB_SALDC      ----------------------------------------------------------------------
SOTB_SALCH      ----------------------------------------------------------------------
SOTB_SALAR      ----------------------------------------------------------------------
SOTB_SALA4      ----------------------------------------------------------------------
SOTB_CITK8      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
SOTB_PSE14      ----------------------------------------------------------------------
SOTB_PSEU2      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
SOTB_KLEP7      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------EKRATNPLIDFKLFKNKA
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
SOTB_KLEP3      ----------------------------------------------------------------------
NORB_STAAW      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAAS      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAAN      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAAM      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAA9      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAA2      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAA1      ----------------------------------------------------EKRATNPLIDFKLFKNKA
SOTB_PSESM      ----------------------------------------------------------------------
SOTB_ERWCH      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
NORB_STAAB      ----------------------------------------------------EKRATNPLIDFKLFKNKA
YKH4_CAEEL      ----------------------------------------------------------------------
NORB_STAAT      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAAE      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAAC      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAA8      ----------------------------------------------------EKRATNPLIDFKLFKNKA
NORB_STAA3      ----------------------------------------------------EKRATNPLIDFKLFKNKA
TPO2_YEAST      ----------------------------------------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YTTB_BACSU      ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
FLVC2_RAT       ----------------------------------------------------------------------
FLVC2_MOUSE     ----------------------------------------------------------------------
SOTB_PASMU      ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MOT9_CHICK      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
MOT2_MESAU      ----------------------------------------------------------------------
MOT4_MOUSE      ----------------------------------------------------------------------
MOT2_RAT        ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
FLVC2_HUMAN     ----------------------------------------------------------------------
Y4RN_RHISN      ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
MOT4_HUMAN      ----------------------------------------------------------------------
SOTB_ENT38      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPC      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_ECO81      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
LAT3_MOUSE      ----------------------------------------------------------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_ECOUT      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOL6      ----------------------------------------------------------------------
NUON_ECOL5      ----------------------------------------------------------------------
NUON_ECOK1      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
MOT4_RAT        ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YRAGFIAQNLLNASFMGVTLIVPLYVEGLCGGTALEAGVVLLPGTVAALVLNPLAGVLTDKVGVRPVALV
YHCA_BACSU      FSLSSVINIIITVALYTGMFLLPIYLQNLVGFTALQSGLLLLPGAIVMLIMSPISGILFDKFGPRPLAII
YCNB_BACSU      FSLTTLLGTLVFALLIGTETILPLYTQNVRDVTAFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIA
LMRB_BACSU      FILGVIMVFICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYG--PKWLV
LMRB_LISMO      FTLGLILVFISFMMILSTMILLPLYLQNSLALAAFSAXXXXXXXXXXXXXMSPFTGRLFDAYGPRALVIP
LMRB_LISIN      FTLGLILVFISFMMILSTMILLPLYLQNSLALAAFSAXXXXXXXXXXXXXMSPFTGRLFDAYGPRALVIP
TCMA_STRGA      LSAGTVLMVLMAFSFIGGLFFVTFYLQNVHGMSPVESGVHLLPLTGMMIVGAPVSGIVISRFXXXXXXXX
EMRB_ECOLI      FTIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTF
EMRB_ECO57      FTIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTF
YFIU_BACSU      FQRTXXXXXXXXXXXAAV-IFIPSYVEQYLGVPAAKAGYWMTPLALASGIGAWLGGALTDKKGPVKTVIL
BMR3_BACSU      FATAQILAFLYGGTFIILAVFIPIFVQAVYGSSATSAGFILTPXXXXXXXXXXXXXXFQTKASFRNLMLI
YEBQ_ECOLI      FSLSICTSVCSFCAQMLAMVSLPFYLQTVLGRSEVETGLLLTPWPLATMVMAPLAGYLIERVHAGLLGAL
QACA_STAAU      FSXXXXXXXXXXXXXXSVLLLASQWLQVVEELSPFKAGLYLLPMAIGDMVFAPIAPGLAARFGPKIVLPS
QACA_STAAM      FSXXXXXXXXXXXXXXSVLLLASQWLQVVEELSPFKAGLYLLPMAIGDMVFAPIAPGLAARFGPKIVLPS
MMR_STRCO       FTGANLVGFLFNFALFGSTFMLGLYFQHARGATPFQAGLELLPMT----IFFPVANIVYARISAR-----
YWOD_BACSU      LSAVYVQFILLNVFFYCLFFGLPSYFQDEMHLSVQTSGLFMLFMSGMSIVVSPLTGKWIDRSGVVKPIFA
TCR_STRPN       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNI
TCR_BACSU       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNI
TCR_BACST       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNI
TCR_BACCE       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNI
MDTD_PECCP      FSIGLTGGLLARIGSGMLPFMTPLFLQLGMGFSPFHAGLMMVPMVLGNMGMKRIVVQIVNRLGYR-----
EMRB_HAEIN      FSVGCLCTSLAFLIYLGSVVLIPLLLQQVFHYTATWAGLAASPVGLFPILLSPIIGRFGYKIDMRILVTI
MDTD_YERE8      ----------------------------------------------------------------------
TCR_STAES       FMLGLFSGGLIFSIVAGFISMVPYMMKTIYHNVATIGNSVIFPGTMSVIVFGYFGGFLVDRKG-------
TCR_STAAU       FMLGLFSGGLIFSIVAGFISMVPYMMKTIYHNVATIGNSVIFPGTMSVIVFGYFGGFLVDRKG-------
TCRB_BACSU      FVIGTLCGGLIFGTVAGFVSMVPYMMKDVHHSTAAIGSGIIFPGTMSVIIFGYIGGLLVDRKGSLYVLTI
TCR_STRAG       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNI
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
PBUE_BACAM      ----------------------------------------------------------------------
EMRY_ECOLI      FTIGIVSITCAYLFYSGAIVLMPQLLQETMGYNAIWAGLAYAPIGIMPLLISPLIGRYGNKIDMRLLVTF
YVKA_BACSU      FTNANLSVLLSNLMMYAVLLIMPLFMTNQFGLNTSNSGMALSVFSIFMSASNWVGAQLHHKWGAKKIIFL
BAIG_EUBSP      FVLPFLTQGLMMANMTNVIVFVRYTQPDNVIISSFAISIMYIGMSLGSVIIGPVA----DKKEPKTVLTF
YFHI_BACSU      ----------------------------------------------------------------------
MMR_BACSU       FSAAQFIGFLLNXXXXXXXXXXXXXXQEAGGASSFMAGVELLPMMAVFVIGNLLFARLANRFEAGQLMFV
YTBD_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      FTFLNLIGFFMSIGMFGAITFVPFFMQGIVGVSASEXXXXXXXXXXXXXXXXXXXXQLVYKIGIKPQIIT
TCR_STAHY       FMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGVIIFPGTMSVIIFGYIGGILVDRRVPLYALNI
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      FSLG------LGGSFAGLPFMTPVFLQIGLGFSPFHAGLMMIPMVLGSMGMKRIVVQVVNRFGYRRVLVA
YI32_SCHPO      -----------------VTYYIPIYFQSIKGDGPLMSGVHTXXXXXXXXXXXXISGMGIGKLKNYRYPMI
SOTB_HAEIN      ----------------------------------------------------------------------
SOTB_HAEIG      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_KLEP7      FSLG------LGGSFAGLPFMTPVFLQIGLGFSPFHAGLMMIPMVLGSMGMKRIVVQVVNRFGYRRVLVA
HSRA_ECOLI      FSIGIVGNIATRLGTGCVPFLMPLMLQVGFGYQAFIAGCMMAPTALGSIIAKSMVTQVLRRLGYRHTLVG
MDTD_SALDC      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SOTB_HAEI8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YBCL_BACSU      ----------------------------------------------------------------------
SOTB_ERWT9      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALTI      ----------------------------------------------------------------------
SOTB_SALSV      ----------------------------------------------------------------------
SOTB_SALPK      ----------------------------------------------------------------------
SOTB_SALPC      ----------------------------------------------------------------------
SOTB_SALPB      ----------------------------------------------------------------------
SOTB_SALPA      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
SOTB_SALHS      ----------------------------------------------------------------------
SOTB_SALG2      ----------------------------------------------------------------------
SOTB_SALEP      ----------------------------------------------------------------------
SOTB_SALDC      ----------------------------------------------------------------------
SOTB_SALCH      ----------------------------------------------------------------------
SOTB_SALAR      ----------------------------------------------------------------------
SOTB_SALA4      ----------------------------------------------------------------------
SOTB_CITK8      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
SOTB_PSE14      ----------------------------------------------------------------------
SOTB_PSEU2      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
SOTB_KLEP7      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
NORB_STAAR      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTFGCKKPMLI
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
SOTB_KLEP3      ----------------------------------------------------------------------
NORB_STAAW      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAAS      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAAN      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAAM      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAA9      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAA2      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAA1      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
SOTB_PSESM      ----------------------------------------------------------------------
SOTB_ERWCH      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
NORB_STAAB      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSLLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
YKH4_CAEEL      ----------------------------------------------------------------------
NORB_STAAT      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAAE      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAAC      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAA8      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
NORB_STAA3      Y-TGATASNFLLNGVAGTLIVANTFVQRGLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLI
TPO2_YEAST      ----------------------------------------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YTTB_BACSU      ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
FLVC2_RAT       ----------------------------------------------------------------------
FLVC2_MOUSE     ----------------------------------------------------------------------
SOTB_PASMU      ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MOT9_CHICK      -----------------VIVIVSFFTQFLCYGSPLAVGVLYLEGSLAGLLASPVCSICVSSFGARPVAIF
CSBC_BACSU      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
MOT2_MESAU      ----------------------------------------------------PISSVLVNNYGSRPVVII
MOT4_MOUSE      ----------------------------------------------------PLCSVCVNRFGCRPVMLV
MOT2_RAT        ----------------------------------------------------PISSVLVNNYGSRPVLIV
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
FLVC2_HUMAN     ----------------------------------------------------------------------
Y4RN_RHISN      ------------------------------------AGWLTFAAIVPGLIVSPLAGVLLDCVGVRIDMIA
PLT3_ARATH      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
MOT4_HUMAN      ----------------------------------------------------PLCSVCVNRFGCRPVMLV
SOTB_ENT38      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPC      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_ECO81      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
LAT3_MOUSE      -------------------------------------------------------GILMDRFGPRPLRLV
NUON_SALPA      ----------------------------------------------------------------------
NUON_ECOUT      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOL6      ----------------------------------------------------------------------
NUON_ECOL5      ----------------------------------------------------------------------
NUON_ECOK1      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
MOT4_RAT        ----------------------------------------------------PLCSMCVNRFGCRPVMLV
MOT2_HUMAN      ----------------------------------------------------PVSSVLVNKYGSRPVVIA


                         .         .         .         .         *         .         .:420
query           SGAFLATGAVLMSFLDADTPLYVTTLCQAVRAVGVSGLVGPLTSWSLAQLPRPIVADGSSFCISARQACA
YHCA_BACSU      GXXXXXXXXXXXXXXXIDTPYTHIMLIYSIRAFGMSLLMMPVMTAGMNQLPARLNSHGTAMSNTLRQISG
YCNB_BACSU      GFCIIFLTSLPFMQLTDHTSLAWIVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGG
LMRB_BACSU      IPGFVIVTVVLWFFSNVTTTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPDGTAIMNTLQQMAG
LMRB_LISMO      GFIVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAIMNTLQQVSG
LMRB_LISIN      GFIVAVIALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAIMNTLQQVSG
TCMA_STRGA      XXXXTAASLWGMSTLEADSGMGITSLWFVLLGLGLAPVMVGTTDVIVSNAPAELAGVAGGLQQSAMQVGG
EMRB_ECOLI      SFIMYAVCFYWRAYFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAG
EMRB_ECO57      SFIMYAVCFYWRAYFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAG
YFIU_BACSU      SGIISCAGFALF-------PLWVT----------------------------------------------
BMR3_BACSU      SVIAFFIGMLLLSNMTPDTARVWLTVFMMISGFGV-----------------------------------
YEBQ_ECOLI      GLFIMAAGLFSLVLLPASPAIWPMILCGA----GFGLFQSPNNHTIITSAPRERSGGASGMLGTARLLGQ
QACA_STAAU      XXXXXXXXMFIMYFF--GHPLSYSTMALALILVG-AGMASLAVASALIMLETPTSKAGNAAAV-------
QACA_STAAM      XXXXXXXXMFIMYFF--GHPLSYSTMALALILVG-AGMASLAVASALIMLETPTSKAGNAAAV-------
MMR_STRCO       ----------------------------------------------------------------------
YWOD_BACSU      GALLMTAGAVLLTFINVQT---------------------------------------------------
TCR_STRPN       GVTFLSVSFLTASFLLETTSWFMTII--------------------------------------------
TCR_BACSU       GVTFLSVSFLTASFLLETTSWFMTII--------------------------------------------
TCR_BACST       GVTFLSVSFLTASFLLETTSWFMTII--------------------------------------------
TCR_BACCE       GVTFLSVSFLTASFLLETTSWFMTII--------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
EMRB_HAEIN      SFIVYATFEPSMTFVDVALP-------QLVQGLAVSCFFMPLTTITLSGLPAHKMASASSLFNFLRTLAG
MDTD_YERE8      ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
TCRB_BACSU      GSALLSSGFLIAAFFIDAAPWIMTII--------------------------------------------
TCR_STRAG       GVTFLSVSFLTAFFLLETTSWFMTII--------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
PBUE_BACAM      ----------------------------------------------------------------------
EMRY_ECOLI      SFLMYAVCYYWRSVTFMPTIDFTIILPQFFQGFAVACFFLPLTTISFSGLPDNKFANASSMSNFFRTLSG
YVKA_BACSU      SFAMMA----------------------------------------------------------------
BAIG_EUBSP      SLVLTAIGCALMYLFKADSSVAIFAASLGILGFGLGGNATIFMKVALSGLSSEVAGSGTGTYGLFRDISA
YFHI_BACSU      ----------------------------------------------------------------------
MMR_BACSU       SMAVSCIIALLLFVLSPDFPYWQLAVLMSV----------------------------------------
YTBD_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      GMLVMAGGFXXXXXXXXXXSKLVATSFMAIIGLGM-GLVMPILTLALQE---------------------
TCR_STAHY       GVTFLSVSFLTASFLLETTSWFMTII--------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      STLGLAAVSLLFMFSALAGWYYALPLVLFLQGMINSSRFSSMNTLTLKDLPDDLASSGNXXXXXXXXXXX
YI32_SCHPO      GGIVLLAGTGSMIAIYYDTPIPRTMGFLALTAVGIGNLFQPNLIAIQASVPPALMATSCSAFMLLRNMGA
SOTB_HAEIN      ----------------------------------------------------------------------
SOTB_HAEIG      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_KLEP7      STLGLAAVSLLFMFSALAGWYYVLPLVLFLQGMINASRFSSMNTLTLKDLPDDLASSGNXXXXXXXXXXX
HSRA_ECOLI      ITVIIGLMIAQFSLQSPAMAIWMLILPLFILGMAMSTQFTAMNTITLADLTDDNASSGNSVLAVTQQLSI
MDTD_SALDC      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SOTB_HAEI8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YBCL_BACSU      ----------------------------------------------------------------------
SOTB_ERWT9      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALTI      ----------------------------------------------------------------------
SOTB_SALSV      ----------------------------------------------------------------------
SOTB_SALPK      ----------------------------------------------------------------------
SOTB_SALPC      ----------------------------------------------------------------------
SOTB_SALPB      ----------------------------------------------------------------------
SOTB_SALPA      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
SOTB_SALHS      ----------------------------------------------------------------------
SOTB_SALG2      ----------------------------------------------------------------------
SOTB_SALEP      ----------------------------------------------------------------------
SOTB_SALDC      ----------------------------------------------------------------------
SOTB_SALCH      ----------------------------------------------------------------------
SOTB_SALAR      ----------------------------------------------------------------------
SOTB_SALA4      ----------------------------------------------------------------------
SOTB_CITK8      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
SOTB_PSE14      ----------------------------------------------------------------------
SOTB_PSEU2      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
SOTB_KLEP7      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
NORB_STAAR      GTAVLIVGECLISLTFLPEILYV-----------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
SOTB_KLEP3      ----------------------------------------------------------------------
NORB_STAAW      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAAS      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAAN      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAAM      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAA9      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAA2      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
NORB_STAA1      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
SOTB_PSESM      ----------------------------------------------------------------------
SOTB_ERWCH      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
NORB_STAAB      GTGVLIVGECLISLTFLPEILYV-----------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
NORB_STAAT      GTGVLIVGECLISLTFLPEIFYV-----------------------------------------------
NORB_STAAE      GTGVLIVGECLISLTFLPEIFYV-----------------------------------------------
NORB_STAAC      GTGVLIVGECLISLTFLPEIFYV-----------------------------------------------
NORB_STAA8      GTGVLIVGECLISLTFLPEIFYV-----------------------------------------------
NORB_STAA3      GTGVLIVGECLISLTFLPEIFYV-----------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YTTB_BACSU      ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
FLVC2_RAT       ----------------------------------------------------------------------
FLVC2_MOUSE     ----------------------------------------------------------------------
SOTB_PASMU      ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MOT9_CHICK      SGFMVAGGLMMSSF--------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
MOT2_MESAU      GGLLCCTGMILASFSNSVLELYLT----------------------------------------------
MOT4_MOUSE      GGLFASLGMVAASFCRSIIQIYLTT---------------------------------------------
MOT2_RAT        GGLLCCTGMILASFSSSVIELYLT----------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
FLVC2_HUMAN     ----------------------------------------------------------------------
Y4RN_RHISN      STAFI-TAISLAGWLGWSSPPVVCTLAMLFSLAGPLGIAG------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
MOT4_HUMAN      GGLFASLGMVAASFCRSIIQVYLTT---------------------------------------------
SOTB_ENT38      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPC      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_ECO81      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
LAT3_MOUSE      GSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNM--------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_ECOUT      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOL6      ----------------------------------------------------------------------
NUON_ECOL5      ----------------------------------------------------------------------
NUON_ECOK1      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
MOT4_RAT        GGLFASLGMVAASFCRSIIQIYLTT---------------------------------------------
MOT2_HUMAN      GGLLCCLGMVLASFSSSVVQLYLT----------------------------------------------


                         .         .         +         .         .         .         .:490
query           SLGTSVMVFLIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHCA_BACSU      SIGTSLI--------------------------------------------
YCNB_BACSU      SIGTALLV-------------------------------------------
LMRB_BACSU      AIGTAVAVSIM----------------------------------------
LMRB_LISMO      AIGTAVAITIM----------------------------------------
LMRB_LISIN      AIGTAVAITIM----------------------------------------
TCMA_STRGA      SLGTAVLGVLM----------------------------------------
EMRB_ECOLI      SIGTSI---------------------------------------------
EMRB_ECO57      SIGTSI---------------------------------------------
YFIU_BACSU      ---------------------------------------------------
BMR3_BACSU      ---------------------------------------------------
YEBQ_ECOLI      SSGAALVALML----------------------------------------
QACA_STAAU      ---------------------------------------------------
QACA_STAAM      ---------------------------------------------------
MMR_STRCO       ---------------------------------------------------
YWOD_BACSU      ---------------------------------------------------
TCR_STRPN       ---------------------------------------------------
TCR_BACSU       ---------------------------------------------------
TCR_BACST       ---------------------------------------------------
TCR_BACCE       ---------------------------------------------------
MDTD_PECCP      ---------------------------------------------------
EMRB_HAEIN      SVGTSLTTFM-----------------------------------------
MDTD_YERE8      ---------------------------------------------------
TCR_STAES       ---------------------------------------------------
TCR_STAAU       ---------------------------------------------------
TCRB_BACSU      ---------------------------------------------------
TCR_STRAG       ---------------------------------------------------
MDTD_SERP5      ---------------------------------------------------
MDTD_YERPS      ---------------------------------------------------
PBUE_BACSU      ---------------------------------------------------
MDTD_YERPY      ---------------------------------------------------
MDTD_YERPP      ---------------------------------------------------
MDTD_YERPN      ---------------------------------------------------
MDTD_YERPG      ---------------------------------------------------
MDTD_YERPE      ---------------------------------------------------
MDTD_YERPB      ---------------------------------------------------
MDTD_YERPA      ---------------------------------------------------
MDTD_YERP3      ---------------------------------------------------
PBUE_BACAM      ---------------------------------------------------
EMRY_ECOLI      SVGTSLTMTL-----------------------------------------
YVKA_BACSU      ---------------------------------------------------
BAIG_EUBSP      PFGVAVFV-------------------------------------------
YFHI_BACSU      ---------------------------------------------------
MMR_BACSU       ---------------------------------------------------
YTBD_BACSU      ---------------------------------------------------
YUSP_BACSU      ---------------------------------------------------
TCR_STAHY       ---------------------------------------------------
MDTD_CITK8      ---------------------------------------------------
MDTD_SALPB      ---------------------------------------------------
MDTD_SALHS      ---------------------------------------------------
MDTD_ENTS8      ---------------------------------------------------
MDTD_KLEP3      XIGVTIAGLLL----------------------------------------
YI32_SCHPO      SVGISI---------------------------------------------
SOTB_HAEIN      ---------------------------------------------------
SOTB_HAEIG      ---------------------------------------------------
MDTD_SALTY      ---------------------------------------------------
MDTD_SALTI      ---------------------------------------------------
MDTD_SALSV      ---------------------------------------------------
MDTD_SALPK      ---------------------------------------------------
MDTD_SALPA      ---------------------------------------------------
MDTD_SALNS      ---------------------------------------------------
MDTD_SALEP      ---------------------------------------------------
MDTD_SALA4      ---------------------------------------------------
MDTD_KLEP7      XIGVTIAGLLL----------------------------------------
HSRA_ECOLI      SLGVAV---------------------------------------------
MDTD_SALDC      ---------------------------------------------------
YAN6_SCHPO      ---------------------------------------------------
VBA5_YEAST      ---------------------------------------------------
SOTB_HAEI8      ---------------------------------------------------
MDTD_ESCF3      ---------------------------------------------------
MDTD_ENT38      ---------------------------------------------------
MDTD_SHISS      ---------------------------------------------------
MDTD_SHIFL      ---------------------------------------------------
MDTD_SHIBS      ---------------------------------------------------
MDTD_SHIB3      ---------------------------------------------------
MDTD_ECOUT      ---------------------------------------------------
MDTD_ECOSM      ---------------------------------------------------
MDTD_ECOSE      ---------------------------------------------------
MDTD_ECOLU      ---------------------------------------------------
MDTD_ECOLI      ---------------------------------------------------
MDTD_ECOLC      ---------------------------------------------------
MDTD_ECOL6      ---------------------------------------------------
MDTD_ECOL5      ---------------------------------------------------
MDTD_ECOK1      ---------------------------------------------------
MDTD_ECOHS      ---------------------------------------------------
MDTD_ECODH      ---------------------------------------------------
MDTD_ECOBW      ---------------------------------------------------
MDTD_ECO8A      ---------------------------------------------------
MDTD_ECO81      ---------------------------------------------------
MDTD_ECO7I      ---------------------------------------------------
MDTD_ECO5E      ---------------------------------------------------
MDTD_ECO57      ---------------------------------------------------
MDTD_ECO55      ---------------------------------------------------
MDTD_ECO45      ---------------------------------------------------
MDTD_ECO27      ---------------------------------------------------
MDTD_ECO24      ---------------------------------------------------
YBCL_BACSU      ---------------------------------------------------
SOTB_ERWT9      ---------------------------------------------------
MDTD_SHIF8      ---------------------------------------------------
SOTB_SALTY      ---------------------------------------------------
SOTB_SALTI      ---------------------------------------------------
SOTB_SALSV      ---------------------------------------------------
SOTB_SALPK      ---------------------------------------------------
SOTB_SALPC      ---------------------------------------------------
SOTB_SALPB      ---------------------------------------------------
SOTB_SALPA      ---------------------------------------------------
SOTB_SALNS      ---------------------------------------------------
SOTB_SALHS      ---------------------------------------------------
SOTB_SALG2      ---------------------------------------------------
SOTB_SALEP      ---------------------------------------------------
SOTB_SALDC      ---------------------------------------------------
SOTB_SALCH      ---------------------------------------------------
SOTB_SALAR      ---------------------------------------------------
SOTB_SALA4      ---------------------------------------------------
SOTB_CITK8      ---------------------------------------------------
MDTD_ERWCT      ---------------------------------------------------
YUBD_BACSU      ---------------------------------------------------
SOTB_PSE14      ---------------------------------------------------
SOTB_PSEU2      ---------------------------------------------------
VBA2_YEAST      ---------------------------------------------------
SGE1_YEAST      ---------------------------------------------------
SOTB_KLEP7      ---------------------------------------------------
AZR1_YEAST      ---------------------------------------------------
YWOG_BACSU      ---------------------------------------------------
NORB_STAAR      ---------------------------------------------------
YDHP_ECOLI      ---------------------------------------------------
YDHP_ECO57      ---------------------------------------------------
SOTB_KLEP3      ---------------------------------------------------
NORB_STAAW      ---------------------------------------------------
NORB_STAAS      ---------------------------------------------------
NORB_STAAN      ---------------------------------------------------
NORB_STAAM      ---------------------------------------------------
NORB_STAA9      ---------------------------------------------------
NORB_STAA2      ---------------------------------------------------
NORB_STAA1      ---------------------------------------------------
SOTB_PSESM      ---------------------------------------------------
SOTB_ERWCH      ---------------------------------------------------
YCEJ_BACSU      ---------------------------------------------------
NORB_STAAB      ---------------------------------------------------
YKH4_CAEEL      ---------------------------------------------------
NORB_STAAT      ---------------------------------------------------
NORB_STAAE      ---------------------------------------------------
NORB_STAAC      ---------------------------------------------------
NORB_STAA8      ---------------------------------------------------
NORB_STAA3      ---------------------------------------------------
TPO2_YEAST      ---------------------------------------------------
SOTB_SHISS      ---------------------------------------------------
SOTB_SHIFL      ---------------------------------------------------
SOTB_SHIF8      ---------------------------------------------------
SOTB_SHIBS      ---------------------------------------------------
SOTB_SHIB3      ---------------------------------------------------
SOTB_ECOSM      ---------------------------------------------------
SOTB_ECOSE      ---------------------------------------------------
SOTB_ECOLU      ---------------------------------------------------
SOTB_ECOLI      ---------------------------------------------------
SOTB_ECOLC      ---------------------------------------------------
SOTB_ECOHS      ---------------------------------------------------
SOTB_ECODH      ---------------------------------------------------
SOTB_ECOBW      ---------------------------------------------------
SOTB_ECO8A      ---------------------------------------------------
SOTB_ECO7I      ---------------------------------------------------
SOTB_ECO5E      ---------------------------------------------------
SOTB_ECO57      ---------------------------------------------------
SOTB_ECO55      ---------------------------------------------------
SOTB_ECO24      ---------------------------------------------------
YDHC_ECOLI      ---------------------------------------------------
SOTB_ECOUT      ---------------------------------------------------
SOTB_ECOL6      ---------------------------------------------------
SOTB_ECOL5      ---------------------------------------------------
SOTB_ECOK1      ---------------------------------------------------
SOTB_ECO81      ---------------------------------------------------
SOTB_ECO45      ---------------------------------------------------
SOTB_ECO27      ---------------------------------------------------
XYLT_LACBR      ---------------------------------------------------
TPO3_YEAST      ---------------------------------------------------
YITG_BACSU      ---------------------------------------------------
YTTB_BACSU      ---------------------------------------------------
NEPI_ECO27      ---------------------------------------------------
FLVC2_RAT       ---------------------------------------------------
FLVC2_MOUSE     ---------------------------------------------------
SOTB_PASMU      ---------------------------------------------------
ARAJ_ECOLI      ---------------------------------------------------
AQR1_YEAST      ---------------------------------------------------
MOT9_CHICK      ---------------------------------------------------
CSBC_BACSU      ---------------------------------------------------
NUON_ENT38      ---------------------------------------------------
MOT2_MESAU      ---------------------------------------------------
MOT4_MOUSE      ---------------------------------------------------
MOT2_RAT        ---------------------------------------------------
GALP_ECOLI      ---------------------------------------------------
GALP_ECOL6      ---------------------------------------------------
FLVC2_HUMAN     ---------------------------------------------------
Y4RN_RHISN      ---------------------------------------------------
PLT3_ARATH      ---------------------------------------------------
NUON_SALAR      ---------------------------------------------------
NUON_CITK8      ---------------------------------------------------
MOT4_HUMAN      ---------------------------------------------------
SOTB_ENT38      ---------------------------------------------------
NUON_SHISS      ---------------------------------------------------
NUON_SALTY      ---------------------------------------------------
NUON_SALTI      ---------------------------------------------------
NUON_SALSV      ---------------------------------------------------
NUON_SALPC      ---------------------------------------------------
NUON_SALPB      ---------------------------------------------------
NUON_SALNS      ---------------------------------------------------
NUON_SALHS      ---------------------------------------------------
NUON_SALG2      ---------------------------------------------------
NUON_SALEP      ---------------------------------------------------
NUON_SALDC      ---------------------------------------------------
NUON_SALCH      ---------------------------------------------------
NUON_SALA4      ---------------------------------------------------
NUON_ECO81      ---------------------------------------------------
MOT6_HUMAN      ---------------------------------------------------
LAT3_MOUSE      ---------------------------------------------------
NUON_SALPA      ---------------------------------------------------
NUON_ECOUT      ---------------------------------------------------
NUON_ECOSM      ---------------------------------------------------
NUON_ECOSE      ---------------------------------------------------
NUON_ECOLI      ---------------------------------------------------
NUON_ECOLC      ---------------------------------------------------
NUON_ECOL6      ---------------------------------------------------
NUON_ECOL5      ---------------------------------------------------
NUON_ECOK1      ---------------------------------------------------
NUON_ECOHS      ---------------------------------------------------
NUON_ECOBW      ---------------------------------------------------
NUON_ECO8A      ---------------------------------------------------
NUON_ECO7I      ---------------------------------------------------
NUON_ECO5E      ---------------------------------------------------
NUON_ECO57      ---------------------------------------------------
NUON_ECO55      ---------------------------------------------------
NUON_ECO27      ---------------------------------------------------
NUON_ECO24      ---------------------------------------------------
MOT4_RAT        ---------------------------------------------------
MOT2_HUMAN      ---------------------------------------------------