[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56840.1

[Show Plain Result]


## Summary of Sequence Search
    1::435
   11::266     3e-62  48%  282 aa  DHPS_SHIFL RecName: Full=Dihydropteroate synthase;       
   11::266     3e-62  48%  282 aa  DHPS_ECOLI RecName: Full=Dihydropteroate synthase;       
   11::266     3e-62  48%  282 aa  DHPS_ECOL6 RecName: Full=Dihydropteroate synthase;       
   30::276     3e-55  44%  289 aa  DHPS_SYNY3 RecName: Full=Dihydropteroate synthase;       
   11::262     3e-54  45%  275 aa  DHPS_HAEIN RecName: Full=Dihydropteroate synthase;       
    5::276     4e-51  42%  285 aa  DHPS_NEIMB RecName: Full=Dihydropteroate synthase;       
   14::254     3e-49  47%  266 aa  DHPS_STRP6 RecName: Full=Dihydropteroate synthase;       
   14::254     7e-49  47%  266 aa  DHPS_STRP8 RecName: Full=Dihydropteroate synthase;       
   14::254     7e-49  47%  266 aa  DHPS_STRP3 RecName: Full=Dihydropteroate synthase;       
   14::254     1e-48  47%  266 aa  DHPS_STRP1 RecName: Full=Dihydropteroate synthase;       
    5::274     2e-47  40%  283 aa  DHPS_NEIMC RecName: Full=Dihydropteroate synthase;       
    6::253     2e-47  43%  267 aa  DHPS_STAAU RecName: Full=Dihydropteroate synthase;       
    6::253     2e-47  43%  267 aa  DHPS_STAAR RecName: Full=Dihydropteroate synthase;       
    5::274     2e-47  40%  283 aa  DHPS_NEIMA RecName: Full=Dihydropteroate synthase;       
    6::253     2e-46  43%  267 aa  DHPS_STAAW RecName: Full=Dihydropteroate synthase;       
    8::265     2e-46  44%  284 aa  DHPS1_MYCLE RecName: Full=Dihydropteroate synthase 1;       
   14::254     2e-46  45%  266 aa  DHPS_STRPY RecName: Full=Dihydropteroate synthase;       
    6::253     3e-46  43%  267 aa  DHPS_STAAN RecName: Full=Dihydropteroate synthase;       
    6::253     3e-46  43%  267 aa  DHPS_STAAM RecName: Full=Dihydropteroate synthase;       
    6::253     4e-46  42%  267 aa  DHPS_STAAS RecName: Full=Dihydropteroate synthase;       
    6::253     8e-46  42%  267 aa  DHPS_STAAC RecName: Full=Dihydropteroate synthase;       
    6::248     8e-45  45%  272 aa  DHPS_STAEQ RecName: Full=Dihydropteroate synthase;       
    6::253     7e-44  41%  267 aa  DHPS_STAHA RecName: Full=Dihydropteroate synthase;       
    6::248     7e-44  45%  272 aa  DHPS_STAES RecName: Full=Dihydropteroate synthase;       
   26::263     6e-43  41%  285 aa  DHPS_BACSU RecName: Full=Dihydropteroate synthase;       
  473::422     2e-42  39%  740 aa  FOL1_PNECA RecName: Full=Folic acid synthesis protein
  419::668     3e-41  41%  686 aa  FOL1_SCHPO RecName: Full=Folic acid synthesis protein
    6::216     1e-38  41%  271 aa  DHP2_SHIFL RecName: Full=Dihydropteroate synthase type-2;       
    6::216     1e-38  41%  271 aa  DHP2_ECOLX RecName: Full=Dihydropteroate synthase type-2;       
    8::265     1e-37  40%  280 aa  DHPS1_MYCTU RecName: Full=Dihydropteroate synthase 1;       
    8::265     1e-37  40%  280 aa  DHPS1_MYCBO RecName: Full=Dihydropteroate synthase 1;       
    1::248     4e-36  38%  279 aa  DHP1_PSEAE RecName: Full=Dihydropteroate synthase type-1;       
    1::248     4e-36  38%  279 aa  DHP1_ECOLX RecName: Full=Dihydropteroate synthase type-1;       
    1::248     4e-36  38%  279 aa  DHP1_CORGL RecName: Full=Dihydropteroate synthase type-1;       
   16::253     5e-36  36%  269 aa  DHPS_CLOB8 RecName: Full=Dihydropteroate synthase;       
    8::252     7e-36  38%  283 aa  DHP1_MYCFO RecName: Full=Dihydropteroate synthase type-1;       
  182::143     1e-32  34%  450 aa  FOLKP_CHLPN RecName: Full=Folate synthesis bifunctional
   16::282     1e-28  35%  291 aa  DHPS2_MYCLE RecName: Full=Dihydropteroate synthase 2;       
   11::294     2e-28  35%  314 aa  DHPS_STRR6 RecName: Full=Dihydropteroate synthase;       
  180::144     3e-28  33%  447 aa  FOLKP_CHLCV RecName: Full=Folate synthesis bifunctional
   11::294     7e-28  33%  314 aa  DHPS_STRPN RecName: Full=Dihydropteroate synthase;       
  506::439     2e-27  40%  824 aa  FOL1_YEAST RecName: Full=Folic acid synthesis protein
  335::586     2e-25  45%  657 aa  FOL1_DICDI RecName: Full=Folic acid synthesis protein
  182::142     1e-23  37%  450 aa  FOLKP_CHLMU RecName: Full=Folate synthesis bifunctional
   20::132     6e-22  44%  167 aa  HPPK_BACSU RecName:
    4::134     1e-20  42%  159 aa  HPPK_ECOLI RecName:
    9::139     3e-20  39%  160 aa  HPPK_HAEIN RecName:
   43::309     4e-20  31%  318 aa  DHPS2_MYCTU RecName: Full=Dihydropteroate synthase 2;       
   43::309     4e-20  31%  318 aa  DHPS2_MYCBO RecName: Full=Dihydropteroate synthase 2;       
    4::140     2e-19  40%  158 aa  HPPK_METEA RecName:
  127::250     8e-19  44%  270 aa  SULD_STRR6 RecName: Full=Bifunctional folate synthesis
  127::250     8e-19  44%  270 aa  SULD_STRPN RecName: Full=Bifunctional folate synthesis
   19::132     8e-19  39%  349 aa  FOLKE_LACLA RecName: Full=Bifunctional protein folKE;Includes:
   19::132     1e-18  40%  349 aa  FOLKE_LACLM RecName: Full=Bifunctional protein folKE;Includes:
  182::142     2e-18  34%  450 aa  FOLKP_CHLTR RecName: Full=Folate synthesis bifunctional
    7::133     3e-18  39%  166 aa  HPPK_STRP8 RecName:
    7::152     1e-17  38%  162 aa  HPPK_STRP3 RecName:
   16::147     3e-17  39%  195 aa  HPPK_SYNY3 RecName:
    7::133     3e-17  39%  166 aa  HPPK_STRPY RecName:
    7::133     3e-17  39%  166 aa  HPPK_STRP1 RecName:
    7::152     6e-17  37%  166 aa  HPPK_STRP6 RecName:
   18::136     1e-15  37%  147 aa  HPPK_PORGI RecName:
   18::136     1e-15  37%  147 aa  HPPK_PORG3 RecName:
   59::151     1e-12  35%  163 aa  HPPK_HELPJ RecName:
   59::151     1e-11  34%  163 aa  HPPK_HELPY RecName:
    7::125     4e-11  34%  162 aa  HPPK_PSEAE RecName:
   36::131     5e-10  34%  160 aa  HPPK_AQUAE RecName:
   12::139     7e-09  37%  188 aa  HPPK_MYCTU RecName:
   12::139     7e-09  37%  188 aa  HPPK_MYCBO RecName:
   30::154     7e-09  33%  157 aa  HPPK_CAMJE RecName:
   34::136     5e-07  40%  191 aa  HPPK_MYCLE RecName:
    5::115     2e-06  32%  120 aa  HPPK_PSEPU RecName:
   68::275     1e-04  25%  307 aa  SPEB_PHOLL RecName: Full=Agmatinase;         EC=3.5.3.11;AltName:
  140::257     4e-04  29%  278 aa  Y2857_SHESH RecName: Full=UPF0276 protein Ssed_2857;
    1::435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
DHPS_SHIFL      ----------DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS
DHPS_ECOLI      ----------DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS
DHPS_ECOL6      ----------DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS
DHPS_SYNY3      ----------------VMGILNTTPDSFSDGGEFNSLPTAIHQAKTMVQGGAHIIDIGGQSTRPGAETVS
DHPS_HAEIN      ----------DLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGESTRPNADEVS
DHPS_NEIMB      -VWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGVYSNAQTALAHAEQLLKEGADILDIGGESTRSGADYVS
DHPS_STRP6      ----------------IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVS
DHPS_STRP8      ----------------IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVS
DHPS_STRP3      ----------------IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVS
DHPS_STRP1      ----------------IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVS
DHPS_NEIMC      -VWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGVYSNAQTALAHAEQLLKEGADILDIGGESTRSGADYVS
DHPS_STAAU      ----------------IMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
DHPS_STAAR      ----------------IMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
DHPS_NEIMA      -VWQAGRFEIGLDKPKIMGIVNLTPDSLSDGGAYSNAQTALAHAERLLKEGADILDIGGESTRPGADYVS
DHPS_STAAW      ----------------IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVS
DHPS1_MYCLE     ----------------VIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGGESTRPGAIRTD
DHPS_STRPY      ----------------IMGILNVTPDSFSDGGSYTTVQKVLQQVDQLIAGGAKIIDVGGESTRPGYQFVS
DHPS_STAAN      ----------------IMGILNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIIDVGGVSTRPGHEMVT
DHPS_STAAM      ----------------IMGILNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIIDVGGVSTRPGHEMVT
DHPS_STAAS      ----------------IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGVDIIDVGGVSTRPGHEMVS
DHPS_STAAC      ----------------IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSMRPGHEMVS
DHPS_STAEQ      ----------------IMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVS
DHPS_STAHA      ----------------IIGILNVTPDSFSDGGKYNSVDKAIARAKEMIDEGVDIIDVGGVSTRPGHTEVS
DHPS_STAES      ----------------IMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVS
DHPS_BACSU      ---------------LVMGILNVTPDSFSDGGKYDSLDKALLHAKEMXXXXXXXXXXXXESTRPGAECVS
FOL1_PNECA      ----------------IMAILNLTPDSFFDGGIHS-YDSVLIDVEKFINAGATIIDIGGQSTRPGSYIIP
FOL1_SCHPO      ---------------LTMGILNVTPDSFSDGGKVSQ-NNILEKAKSMVGDGASILDIGGQSTKPGADPVS
DHP2_SHIFL      ---------------IIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
DHP2_ECOLX      ---------------IIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
DHPS1_MYCTU     ----------------VMGVLNVTDDSFSDGGCYLDLDDXXXXXXXXXXXXXXXXXXXXESSRPGATRVD
DHPS1_MYCBO     ----------------VMGVLNVTDDSFSDGGCYLDLDDXXXXXXXXXXXXXXXXXXXXESSRPGATRVD
DHP1_PSEAE      -------------MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVS
DHP1_ECOLX      -------------MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVS
DHP1_CORGL      -------------MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVS
DHPS_CLOB8      ----------------IMGILNFTPDSFSDGGKFNDIDVAVKHVKEMIDNGADIIDVGGESTRPGYXXXX
DHP1_MYCFO      ----------------VFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVS
FOLKP_CHLPN     ---------------MLMGVVNVTNDSMSDGGMFLDPEKAVAQAEKLFTEGAAVIDFGAQATNPKVKQLS
DHPS2_MYCLE     ---------------LIMAIVNRTPDSFYDRGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGQG-VD
DHPS_STRR6      ---------------VICGIINVTPDSFSDGGXXXXXXXXXXXXRKLIAEGASMLDIGGESTRPGSSYVE
FOLKP_CHLCV     ---------------LLMGVVNVTDNSISDEGLYLEASKAVAHAEKLFAQGASVIDFGGQATNPKVQQLN
DHPS_STRPN      ---------------VICGIINVTPDSFSDGGXXXXXXXXXXXXRKLIAEGASMLDIGGESTRPGSSYVE
FOL1_YEAST      ----------------IMAIFNATPDSFSDGGEHFAIESQLNDIIKLCKDASVIIDVGGCSTRPNSIQAS
FOL1_DICDI      ----------------IMGILNVTPDSFVDGGKFNTLEKSIQQATALIEQGADIIDIGGQSTYPGAQQIS
FOLKP_CHLMU     ----------------IMGIVNVTDDSISDTGLFLEAKRAAAHAERLFAEGASIIDLGAQATNPRVRDLS
HPPK_BACSU      ----------------------------------------------------------------------
HPPK_ECOLI      ----------------------------------------------------------------------
HPPK_HAEIN      ----------------------------------------------------------------------
DHPS2_MYCTU     ---------------LIMAIVNRTPDSFYDKGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGER-VD
DHPS2_MYCBO     ---------------LIMAIVNRTPDSFYDKGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGER-VD
HPPK_METEA      ----------------------------------------------------------------------
SULD_STRR6      ----------------------------------------------------------------------
SULD_STRPN      ----------------------------------------------------------------------
FOLKE_LACLA     ----------------------------------------------------------------------
FOLKE_LACLM     ----------------------------------------------------------------------
FOLKP_CHLTR     ----------------IMGIVNITDNSISDTGXXXXXXXXXXXXXXXXXXXXSIIDLGAQATNPRVKDLS
HPPK_STRP8      ----------------------------------------------------------------------
HPPK_STRP3      ----------------------------------------------------------------------
HPPK_SYNY3      ----------------------------------------------------------------------
HPPK_STRPY      ----------------------------------------------------------------------
HPPK_STRP1      ----------------------------------------------------------------------
HPPK_STRP6      ----------------------------------------------------------------------
HPPK_PORGI      ----------------------------------------------------------------------
HPPK_PORG3      ----------------------------------------------------------------------
HPPK_HELPJ      ----------------------------------------------------------------------
HPPK_HELPY      ----------------------------------------------------------------------
HPPK_PSEAE      ----------------------------------------------------------------------
HPPK_AQUAE      ----------------------------------------------------------------------
HPPK_MYCTU      ----------------------------------------------------------------------
HPPK_MYCBO      ----------------------------------------------------------------------
HPPK_CAMJE      ----------------------------------------------------------------------
HPPK_MYCLE      ----------------------------------------------------------------------
HPPK_PSEPU      ----------------------------------------------------------------------
SPEB_PHOLL      LAWESRRWPWDFKLHNCLKVVDCGDVVFNFGDAQDMSDKLQAHAEKVLASGKRMLSFGGDH---------
Y2857_SHESH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
DHPS_SHIFL      VEEELQRVIPVVEAIAQREVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHM
DHPS_ECOLI      VEEELQRVIPVVEAIAQREVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHM
DHPS_ECOL6      VEEELQRVIPVVEAIAQREVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHM
DHPS_SYNY3      LKEELERTIPIIQALRQEDIPISIDTTRAEVARQALQAGADMVNDISGATEPEILAVAAQHKAPIILMHI
DHPS_HAEIN      EQEELHRVVPVVEAVRNRFDCISVDSSKAVVMREAANVGMDLINDIRALQEPNALETAVKLALPVCIMHM
DHPS_NEIMB      PEEEWARVEPVLAEVAGWGVPISLDTRRTVIMEKALALGGIIINDVAALNDEGAVELLRQADTGICLMHM
DHPS_STRP6      ATDEIDRVVPVIKAIKENDILISIDTYKTETARAALEAGADILNDVAGLYDGQMFALAAEYDAPIILMHN
DHPS_STRP8      ATDEIDRVVPVIKAIKENDILISIDTYKTETARAALEAGADILNDVAGLYDGQMFALAAEYDAPIILMHN
DHPS_STRP3      ATDEIDRVVPVIKAIKENDILISIDTYKTETARAALEAGADILNDVAGLYDGQMFALAAEYDAPIILMHN
DHPS_STRP1      ATDEIDRVVPVIKAIKENDILISIDTYKTETARAALEAGADILNDVAGLYDGQMFALAAEYDAPIILMHN
DHPS_NEIMC      PEEEWARVEPVLAEVAGWGVPISLDTRRTVIMEKALALGGIIINDVAALNDEGAVELLRQADTGICLMHM
DHPS_STAAU      VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
DHPS_STAAR      VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQAGLYDHRMFQVVAKYDAEIVLMH-
DHPS_NEIMA      PEEEWARVESVLAEVAGWGVPVSLDTRHTVVMEKALALGGIIINDVAALTDEGALELLAQADTGICLMHM
DHPS_STAAW      LEEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQAGLYDHRMFQIVAKYDAEIILMH-
DHPS1_MYCLE     PRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSGARIVNDVSGGRDPAMAPLVAEAGVAWVLMHW
DHPS_STRPY      AADEIERVVPMIKAIAKYDVLISIDTYKTETARAALEAGADILNDVAGLYDGEMLALAAEYDVPIILMHN
DHPS_STAAN      LEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQAGLYDHRMFQIVAKYDAEIILMH-
DHPS_STAAM      LEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQAGLYDHRMFQIVAKYDAEIILMH-
DHPS_STAAS      LEEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQAGLYDHRMFQIVAKYDAEIILMH-
DHPS_STAAC      LEEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQAGLYDHRMFQIVAKYDAEIILMH-
DHPS_STAEQ      LKEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQAGLFDSNMFNVVSQYGAEIVLMH-
DHPS_STAHA      LXXXXXXXXXXXXQLVKLDVQISVDTYRSEVAEACLKLGATMINDQAGLYDPKIFDVVSDYNAEIVLMH-
DHPS_STAES      LKEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQAGLFDSNMFNVVSQYGAEIVLTH-
DHPS_BACSU      EDEEMSRVIPVIRITKELGVPISVDTYKASVADEAVKAGASIINDIWGAKDPKMASVAAEHNVPIVLMHN
FOL1_PNECA      LEEEIFRVIPAIKYLQKTDILISIDTFRSEVAEQAVKAGASLVNDISGGRDPKMFNTVARLKVPICIMHM
FOL1_SCHPO      VEEELRRVIPMISLLRSSGITVSIDTYYSKVAKLAIEAGANIINDVTGMGDEKMLPLAASLQVPICIMHM
DHP2_SHIFL      SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHS
DHP2_ECOLX      SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHS
DHPS1_MYCTU     PAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRDPAMGPLLAEADVPWVLMHW
DHPS1_MYCBO     PAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRDPAMGPLLAEADVPWVLMHW
DHP1_PSEAE      PADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHQ
DHP1_ECOLX      PADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHQ
DHP1_CORGL      PADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHQ
DHPS_CLOB8      XXXXXXXXXXXXKAIKEDDIPVSIDTYKAKVAEQAIEAGANLINDIWGFXXXXXXXXXXXXNVPCCLMHN
DHP1_MYCFO      PADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHQ
FOLKP_CHLPN     VDQEWERLEPVLRLLKEQYPIISLDTFYPEIILRAMDIPIQWINDVSG-GSQSMAEVARDCELSLVMNHS
DHPS2_MYCLE     VDTEIARLVPFIEWLAYTDLLISVDTWRAEVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHT
DHPS_STRR6      IEEEIQRVVPVIKAIKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMDEKMPHVVAEARAQVVVMAR
FOLKP_CHLCV     VEQEWSRLEPVLKLLAEKWADISLDTFYPEIIKRALEIPIRWINDVSG-GSKEMAEIARDANLLLVINHS
DHPS_STRPN      IEEEIQRVVPVIKAIKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMDEKMAYVVAEARAKVVIMFN
FOL1_YEAST      EEEEIRRSIPLIKALPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGFDSNMFAVIAENPEICYILSHT
FOL1_DICDI      IEEEINRVVPTIKKIRENDIPLSIDTLHHQVAKEAILAGCNIINDVSGFRVPIILN--------------
FOLKP_CHLMU     VEQEWERLEPVLQILAEKDADVSIDTFRPEVIRRAIQVPIRWINDVSG-GSLEMAHLAKDLGLRLLINHS
HPPK_BACSU      ----------------------------------------------------------------------
HPPK_ECOLI      ----------------------------------------------------------------------
HPPK_HAEIN      ----------------------------------------------------------------------
DHPS2_MYCTU     VDTEITRLVPFIEWLAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGAGLVCAHT
DHPS2_MYCBO     VDTEITRLVPFIEWLAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGAGLVCAHT
HPPK_METEA      ----------------------------------------------------------------------
SULD_STRR6      ----------------------------------------------------------------------
SULD_STRPN      ----------------------------------------------------------------------
FOLKE_LACLA     ----------------------------------------------------------------------
FOLKE_LACLM     ----------------------------------------------------------------------
FOLKP_CHLTR     VEQEWERLEPVLRLLAERQQCVSIDTFRPEIIRRAVEVPIRWINDVSG-GSLEMAHLAKEFGLRLLINHS
HPPK_STRP8      ----------------------------------------------------------------------
HPPK_STRP3      ----------------------------------------------------------------------
HPPK_SYNY3      ----------------------------------------------------------------------
HPPK_STRPY      ----------------------------------------------------------------------
HPPK_STRP1      ----------------------------------------------------------------------
HPPK_STRP6      ----------------------------------------------------------------------
HPPK_PORGI      ----------------------------------------------------------------------
HPPK_PORG3      ----------------------------------------------------------------------
HPPK_HELPJ      ----------------------------------------------------------------------
HPPK_HELPY      ----------------------------------------------------------------------
HPPK_PSEAE      ----------------------------------------------------------------------
HPPK_AQUAE      ----------------------------------------------------------------------
HPPK_MYCTU      ----------------------------------------------------------------------
HPPK_MYCBO      ----------------------------------------------------------------------
HPPK_CAMJE      ----------------------------------------------------------------------
HPPK_MYCLE      ----------------------------------------------------------------------
HPPK_PSEPU      ----------------------------------------------------------------------
SPEB_PHOLL      -----FITLPLLRAHAKHFGKMAL--VHFDAHADTYPNGSQFDHGTMFYHAPGLIDPHHSVQIGIRTEHG
Y2857_SHESH     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
DHPS_SHIFL      QGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFN
DHPS_ECOLI      QGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFN
DHPS_ECOL6      QGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFN
DHPS_SYNY3      RGNPQTMQNLTDYGDLIGEMRQFFSAQVDLARHYGVLPEQIILDPGIGFAKTAEQNITLLRQLPELKRLG
DHPS_HAEIN      QGQPRTMQANPYYENVVQDVLAFLQKRTNECLSAGIKKENLIWDMGFGFGKSVQHNYQLLQNLNEFCQIG
DHPS_NEIMB      QGLPKTMQINPKYQDVVGEVARYLKARSAECIAAGIAPQRIILDPGSGFGKPLQHNIALMRHLPELMETG
DHPS_STRP6      QDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQQNMELLKGLDRVCQLG
DHPS_STRP8      QDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQQNTELLKGLDRVCQLG
DHPS_STRP3      QDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQQNTELLKRLDRVCQLG
DHPS_STRP1      QDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWVDPGFGFAKSVQQNTELLKGLDRVCQLG
DHPS_NEIMC      QGLPKNMQINPKYQDVVGEVARYLKXXXXXXXXXXXXPQRITLDPGFCFGKTLQHNITLMRHLPELMETG
DHPS_STAAU      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_STAAR      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_NEIMA      QGLPKNMQINPKYQDVVGEVARYLKXXXXXXXXXXXXPQRITLDPGFCFGKTLQHNITLMRHLPELMETG
DHPS_STAAW      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS1_MYCLE     RMSAERPYEAPNYRDVVAEVRXXXXXXXXXXXXXXXXPGSLVIDPGLGFAKTGQHNWALLNALPELVATG
DHPS_STRPY      QKE-------EVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFGFPKSVQHNMELLKGLDHVCQLG
DHPS_STAAN      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_STAAM      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_STAAS      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_STAAC      ------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
DHPS_STAEQ      --------NGDGHRDVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIGFAKTREEENEVMARLDELVATE
DHPS_STAHA      NGDGQREQ------PVVEEMLLSLLTQANKAEMAGIEKGNIWLDPGIGFAKSRSEEKEVMARLDELVATE
DHPS_STAES      --------NGDGHRDVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIGFPKTREEENEVMARLDELVATE
DHPS_BACSU      RPE-------RNYNDLLPDMLSDLMESVKIAVEAGVDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLG
FOL1_PNECA      RGNFLNMDNLTDYTDIIEQITIELEKLLNSAEKSGIPRWNIILDPGLGFSKTLHQNIELLRRFNELKSKG
FOL1_SCHPO      RGTPETMKALSIYEDIVEEVAVELSSRVEAAVQSGVHRYNIILDPGFGFAKTPKQSAGLLGRLHELMKKD
DHP2_SHIFL      VQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFGAAPETSLSVLARFDELLRFD
DHP2_ECOLX      VQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFGAAPETSLSVLARFDELLRFD
DHPS1_MYCTU     RAVSADTPHVPRYGNVVAEVRXXXXXXXXXXXXXXXXXXRLVLDPGLGFAKTAQHNWAILHALPELVATG
DHPS1_MYCBO     RAVSADTPHVPRYGNVVAEVRXXXXXXXXXXXXXXXXXXRLVLDPGLGFAKTAQHNWAILHALPELVATG
DHP1_PSEAE      RDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFSPAPETSLHVLSNLQKLSALG
DHP1_ECOLX      RDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFSPAPETSLHVLSNLQKLSALG
DHP1_CORGL      RDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFSPAPETSLHVLSNLQKLSALG
DHPS_CLOB8      RDN-------TEYKNLMEDILNDLKECINIAKDAGVKDENIILDPGIGFGKTYEQNLEAMNNLERIKELG
DHP1_MYCFO      RDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFSPAPETSLHVLSNLQKLSALG
FOLKP_CHLPN     SSLPVDPKNILSFSVPIGELLSWGEKQLKMFSDVGLNANQVIFDPGIGFGKGAAQSLATLYEIAKFKRLG
DHPS2_MYCLE     GGAPRTRPFRVSYGGVVDDVIRQXXXXXXXXXXXXXXXDSVLVDPTHDFGKNTFHGLLLLRHVDELVKTG
DHPS_STRR6      PQHPSSL-IFPHFGFGQAFTEEELADXXXXXXXXGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXG
FOLKP_CHLCV     CSLPPRPDKTLAFTTCASDLLSWGEKQIEAFVALGLRQDQIIFDPGIGFGTTQIQALNVLHKMKKFRKLG
DHPS_STRPN      PGQTFTEKELADFETLPIEMVXXXXXXXXXXXXXGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXG
FOL1_YEAST      RGDISTMNRLAHYENLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRNSQVYVNLN
FOL1_DICDI      ----------------------------------GLFRWQIILDPGLGFYKTYEQSIEILQRGKELMGLG
FOLKP_CHLMU     CSLPPRPDCVLSYEE--SPVTQMLRWGESQLETAQIGLDQVVFDPGIGFGKTPVQSMQLMEGVAKFKHLK
HPPK_BACSU      ----------------------------------------------------------------------
HPPK_ECOLI      ----------------------------------------------------------------------
HPPK_HAEIN      ----------------------------------------------------------------------
DHPS2_MYCTU     GGAPRTRPFRVSYGTVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHDFGKNTFHGLLLLRHVADLVMTG
DHPS2_MYCBO     GGAPRTRPFRVSYGTVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHDFGKNTFHGLLLLRHVADLVMTG
HPPK_METEA      ----------------------------------------------------------------------
SULD_STRR6      ----------------------------------------------------------------------
SULD_STRPN      ----------------------------------------------------------------------
FOLKE_LACLA     ----------------------------------------------------------------------
FOLKE_LACLM     ----------------------------------------------------------------------
FOLKP_CHLTR     CSLPPRPDCVLSYEE--SPIEQMLRWGESQLEQAQVGLDQVVFDPGIGFGKTPVQSMLLMDGVKQFKRLE
HPPK_STRP8      ----------------------------------------------------------------------
HPPK_STRP3      ----------------------------------------------------------------------
HPPK_SYNY3      ----------------------------------------------------------------------
HPPK_STRPY      ----------------------------------------------------------------------
HPPK_STRP1      ----------------------------------------------------------------------
HPPK_STRP6      ----------------------------------------------------------------------
HPPK_PORGI      ----------------------------------------------------------------------
HPPK_PORG3      ----------------------------------------------------------------------
HPPK_HELPJ      ----------------------------------------------------------------------
HPPK_HELPY      ----------------------------------------------------------------------
HPPK_PSEAE      ----------------------------------------------------------------------
HPPK_AQUAE      ----------------------------------------------------------------------
HPPK_MYCTU      ----------------------------------------------------------------------
HPPK_MYCBO      ----------------------------------------------------------------------
HPPK_CAMJE      ----------------------------------------------------------------------
HPPK_MYCLE      ----------------------------------------------------------------------
HPPK_PSEPU      ----------------------------------------------------------------------
SPEB_PHOLL      RDNGFTVLDADSVDDLLAQIKETVGDMPVYL-----TFDIDCLDPAPGTGTTTDRALKLLRGLQPLNIVG
Y2857_SHESH     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPxALIGMGCN
DHPS_SHIFL      LPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAM--------------
DHPS_ECOLI      LPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAM--------------
DHPS_ECOL6      LPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAM--------------
DHPS_SYNY3      FPLLVGPSRKSFIGKILDQPDPKERVWGTGATCCRAIAGGADIVRVHDVEA-------------------
DHPS_HAEIN      YPVLAGLSRKSMIGAV--LDKPDQRIIGSAAGALIAVQKGAKILRVHDVAAT------------------
DHPS_NEIMB      FPLLIGVSRKSTIGELTGEANAAERVHXXXXXXXXXXXXXXQIVRVHDVKATADALK-------------
DHPS_STRP6      YPVLFGISRKALLG---GNTKAKERDGATAALSAYALGKGCQIVRVHDVKA-------------------
DHPS_STRP8      YPVLFGISRKALLG---GNTKAKERDGATAALSAYALGKGCQIVRVHDVKA-------------------
DHPS_STRP3      YPVLFGISRKALLG---GNTKAKERDGATAALSAYALGKGCQIVRVHDVKA-------------------
DHPS_STRP1      YPVLFGISRKALLG---GNTKAKERDGATAALSAYALGKGCQIVRVHDVKA-------------------
DHPS_NEIMC      YPLLIGVSRKSMIGELTGETDXXXXXXXXXXXXXXXXXXXXKIVRVHDVKATADALK-------------
DHPS_STAAU      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_STAAR      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_NEIMA      YPLLIGVSRKSMIGELTGETDXXXXXXXXXXXXXXXXXXXXKIVRVHDVKATADALK-------------
DHPS_STAAW      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS1_MYCLE     VPILLGASRKRFLGRLLAVRPPDGRETATAVISALAALHGAWGVRVHDVRASVDALK-------------
DHPS_STRPY      YPVLFGISRKGVVDALLGGNKAKERDGATAALSAYALGKGCQLVRVHDVKA-------------------
DHPS_STAAN      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_STAAM      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_STAAS      YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_STAAC      YPVLLATSRKRFTKKMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAKGI-----------
DHPS_STAEQ      YPVLLATSRKRYIKEMMNQDSPSDRDEATAATTAYGIMKGVRGVRVHNV---------------------
DHPS_STAHA      YPVLLATSRKRFIKEMIGKETPAERDEATAATTVYGIMKGIQAVRVHNVDLNVKLAQSI-----------
DHPS_STAES      YPVLLATSRKRYIKEMMNQDSPSDRDEATAATTAYGIMKGVRGVRVHNV---------------------
DHPS_BACSU      YPVLLATSRKRFIGRVLDL-PPEERAEGTGATVCLGIQKGCDIVRVHDV---------------------
FOL1_PNECA      LPWLLGPSRKRFTGFITGDNMPKDRIWGTVAAVVASISGGCDIIRVHDV--------------------N
FOL1_SCHPO      MHWLSGPSRKGFTGYFTGDASPKDRIWGTSACVTASVLQGVSIVRVHD----------------------
DHP2_SHIFL      LPVLLSVSRKSFL---------------------------------------------------------
DHP2_ECOLX      LPVLLSVSRKSFL---------------------------------------------------------
DHPS1_MYCTU     IPVLVGASRKRFLGALLGVMRPTGRDTATAVISALAALHGAWGVRVHDVRASVDAIK-------------
DHPS1_MYCBO     IPVLVGASRKRFLGALLGVMRPTGRDTATAVISALAALHGAWGVRVHDVRASVDAIK-------------
DHP1_PSEAE      LPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIGNGADYVRTH-----------------------
DHP1_ECOLX      LPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIGNGADYVRTH-----------------------
DHP1_CORGL      LPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIGNGADYVRTH-----------------------
DHPS_CLOB8      YPILLGTSRKSMIGLALNLPVEERIEGTVATTVIGIMKDACDFVRVHDV---------------------
DHP1_MYCFO      LPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIGNGADYVRTH-----------------------
FOLKP_CHLPN     CPILIGHSRKSFLS-LFGNHDPKDRDWETVGLSILLQQQGVDYLRVHNVAASVAACEACAP---------
DHPS2_MYCLE     WPVLMSLSNKDFVGETLGVG-LTERLEGXXXXXXXXXXXGVRMFRVHEVVATVASIQGTRP---------
DHPS_STRR6      YPIFLGVSRKRFVGFEVNPETELGRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE-------------
FOLKP_CHLCV     CATLVGHSRKSCFS-LLGKYDAKDRDWETVSLSVLLQQQGVNYLRVHDVEANQRVL--------------
DHPS_STRPN      YPIFLGVSRKRFVGFEVNPETELGRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE-------------
FOL1_YEAST      MPVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHDV---------------------
FOL1_DICDI      FPVLIGPSRKGFI---------------------------------------------------------
FOLKP_CHLMU     CPVLIGHSRKSCLS-LLGRFSSQDRDWETIGCSVALHNQGVDYLRVHQV---------------------
HPPK_BACSU      ----------------------------------------------------------------------
HPPK_ECOLI      --------------------------------------------------------------AYIAIGSN
HPPK_HAEIN      ----------------------------------------------------------------------
DHPS2_MYCTU     WPVLMALSNKDVVGETLGVD-XXXXXXXXXXXXXXXXXXXXXMFRVHEVAATVASIQGVRP---------
DHPS2_MYCBO     WPVLMALSNKDVVGETLGVD-XXXXXXXXXXXXXXXXXXXXXMFRVHEVAATVASIQGVRP---------
HPPK_METEA      --------------------------------------------------------------AYLGLGSN
SULD_STRR6      ----------------------------------------------------------------------
SULD_STRPN      ----------------------------------------------------------------------
FOLKE_LACLA     ----------------------------------------------------------------------
FOLKE_LACLM     ----------------------------------------------------------------------
FOLKP_CHLTR     CPVLIGHSRKSCLS-MLGRFNSNDRDWETIGCSVSLHDRGVDYLRVHQV---------------------
HPPK_STRP8      ----------------------------------------------------------------------
HPPK_STRP3      ----------------------------------------------------------------------
HPPK_SYNY3      --------------------------------------------------------------AVVGLGGN
HPPK_STRPY      ----------------------------------------------------------------------
HPPK_STRP1      ----------------------------------------------------------------------
HPPK_STRP6      ----------------------------------------------------------------------
HPPK_PORGI      ----------------------------------------------------------------------
HPPK_PORG3      ----------------------------------------------------------------------
HPPK_HELPJ      ----------------------------------------------------------------------
HPPK_HELPY      ----------------------------------------------------------------------
HPPK_PSEAE      ----------------------------------------------------------------------
HPPK_AQUAE      ----------------------------------------------------------------------
HPPK_MYCTU      ----------------------------------------------------------------------
HPPK_MYCBO      ----------------------------------------------------------------------
HPPK_CAMJE      --------------------------------------------------------------ALIGLGSN
HPPK_MYCLE      ----------------------------------------------------------------------
HPPK_PSEPU      --------------------------------------------------------------AYVGLGSN
SPEB_PHOLL      MDVV------------------------------------------------------------------
Y2857_SHESH     ---------------------------------------------------------------------N


                         .         *         .         .         .         .         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
DHPS_SHIFL      ----------------------------------------------------------------------
DHPS_ECOLI      ----------------------------------------------------------------------
DHPS_ECOL6      ----------------------------------------------------------------------
DHPS_SYNY3      ----------------------------------------------------------------------
DHPS_HAEIN      ----------------------------------------------------------------------
DHPS_NEIMB      ----------------------------------------------------------------------
DHPS_STRP6      ----------------------------------------------------------------------
DHPS_STRP8      ----------------------------------------------------------------------
DHPS_STRP3      ----------------------------------------------------------------------
DHPS_STRP1      ----------------------------------------------------------------------
DHPS_NEIMC      ----------------------------------------------------------------------
DHPS_STAAU      ----------------------------------------------------------------------
DHPS_STAAR      ----------------------------------------------------------------------
DHPS_NEIMA      ----------------------------------------------------------------------
DHPS_STAAW      ----------------------------------------------------------------------
DHPS1_MYCLE     ----------------------------------------------------------------------
DHPS_STRPY      ----------------------------------------------------------------------
DHPS_STAAN      ----------------------------------------------------------------------
DHPS_STAAM      ----------------------------------------------------------------------
DHPS_STAAS      ----------------------------------------------------------------------
DHPS_STAAC      ----------------------------------------------------------------------
DHPS_STAEQ      ----------------------------------------------------------------------
DHPS_STAHA      ----------------------------------------------------------------------
DHPS_STAES      ----------------------------------------------------------------------
DHPS_BACSU      ----------------------------------------------------------------------
FOL1_PNECA      EAVYISLGSNLGNRIKFILDAIEKM-SIKGIKVLKTSMLYESKPMYFKDQPAFYNAVCKVQTSLHPEQLL
FOL1_SCHPO      ----------------------------------------------------------------------
DHP2_SHIFL      ----------------------------------------------------------------------
DHP2_ECOLX      ----------------------------------------------------------------------
DHPS1_MYCTU     ----------------------------------------------------------------------
DHPS1_MYCBO     ----------------------------------------------------------------------
DHP1_PSEAE      ----------------------------------------------------------------------
DHP1_ECOLX      ----------------------------------------------------------------------
DHP1_CORGL      ----------------------------------------------------------------------
DHPS_CLOB8      ----------------------------------------------------------------------
DHP1_MYCFO      ----------------------------------------------------------------------
FOLKP_CHLPN     ----------------------------------------------------YFNSVLVGETTLSLRELL
DHPS2_MYCLE     ----------------------------------------------------------------------
DHPS_STRR6      ----------------------------------------------------------------------
FOLKP_CHLCV     ----------------------------------------------------FFNSVLIGKTTLSPKQLL
DHPS_STRPN      ----------------------------------------------------------------------
FOL1_YEAST      ----------------------------------NISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELL
FOL1_DICDI      --------------------------------IQSTSFMYESSPQYYREQDSFYNCACKVSTDLKPHDLL
FOLKP_CHLMU     ----------------------------------------------------YFNCVAIGETQLSPDELV
HPPK_BACSU      -----------------LRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQFLNMAVEIKTSLNPFELL
HPPK_ECOLI      L---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELL
HPPK_HAEIN      -------GSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLL
DHPS2_MYCTU     ----------------------------------------------------------------------
DHPS2_MYCBO     ----------------------------------------------------------------------
HPPK_METEA      IG----------DKAAMLAGAVEHLAATPGIRVVARSADYRTPPWGDTDQDWFLNAAVAIDTELTPHGLL
SULD_STRR6      -------GSNMGDKQANLKQAIDKLRAR-GIHILKESSVLATEPWGGVEQDSFANQVVEVETWLPAQDLL
SULD_STRPN      -------GSNMGDKQANLKQAIDKLRAR-GIHILKESSVLATEPWGGVEQDSFANQVVEVETWLPAQDLL
FOLKE_LACLA     -----------------LHEAIRLLGKHPKIMIEKVSNFYESTPVGGVKQDDFTNLALKVATLLEPLELL
FOLKE_LACLM     -----------------LHEAIRLLGKHPKIMIEKVSNFYESSPVGGVKQDDFTNLALKVATLLEPLELL
FOLKP_CHLTR     ----------------------------------------------------YFNSVVIGETQLSPDELI
HPPK_STRP8      -----SLGTNMRDRAAYLQKALETLADLPQTRLLAQSSIYETAAWGKTDQADFLNMACQLDTQLTAADFL
HPPK_STRP3      -----SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTSQADFLNMAYQLDTQLTAADFL
HPPK_SYNY3      IGPV----------LDNLQGAIAELALVAGIEVERCSSWYRSR-AFGPPQPDYINGCVTLRVSLSPPELL
HPPK_STRPY      -----SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLTAADFL
HPPK_STRP1      -----SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLTAADFL
HPPK_STRP6      -----SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLTAADFL
HPPK_PORGI      -----------------LLSAALEMLQTRVGRLLTLSRFYETEPWGFESPHPFLNAVVALRSELKPQDIL
HPPK_PORG3      -----------------LLSAALEMLQTRVGRLLTLSRFYETEPWGFESPHPFLNAVVALRSELKPQDIL
HPPK_HELPJ      ------------------------------------SPIYINPPFGYTNQPNFYNATIILKTSLGLRHFF
HPPK_HELPY      ------------------------------------SPIYINPPFGYTKQPNFYNATIILKTSLSLRHFF
HPPK_PSEAE      VALGSNLAEPRE----QIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVXXXXXXXXXXXXX
HPPK_AQUAE      ------------------------------------STVYESKAWGFENQGNFLNFVLKAKTSLLPQXXX
HPPK_MYCTU      -----------------LGDRLARLRSVADGALIAASPIYEADPWGGVEQGQFLNAVLIADDPTEPREWL
HPPK_MYCBO      -----------------LGDRLARLRSVADGALIAASPIYEADPWGGVEQGQFLNAVLIADDPTEPREWL
HPPK_CAMJE      I-------EPEKKRFDMLFRVMMDDKRF---KILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALL
HPPK_MYCLE      ------------------------------------SPVYDTVPWGAVEQRSFLNAVVIADPAYDTKAWL
HPPK_PSEPU      LD---SPAEQ-------LRSAFQALDQVEATRLVAASALYTSD-SLLPGQPXYTNXXXXXXXXXXXXXXX
SPEB_PHOLL      ----------------------------------------------------------------------
Y2857_SHESH     VSFYAAPGAEMT-EFEFVNAVLSEACRL----LLDVNNIYVNSVNHHYDASQFLGSM--------PTERI


                         .         .         .         .         *         .         .:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV
DHPS_SHIFL      ----------------------------------------------------------------------
DHPS_ECOLI      ----------------------------------------------------------------------
DHPS_ECOL6      ----------------------------------------------------------------------
DHPS_SYNY3      ----------------------------------------------------------------------
DHPS_HAEIN      ----------------------------------------------------------------------
DHPS_NEIMB      ----------------------------------------------------------------------
DHPS_STRP6      ----------------------------------------------------------------------
DHPS_STRP8      ----------------------------------------------------------------------
DHPS_STRP3      ----------------------------------------------------------------------
DHPS_STRP1      ----------------------------------------------------------------------
DHPS_NEIMC      ----------------------------------------------------------------------
DHPS_STAAU      ----------------------------------------------------------------------
DHPS_STAAR      ----------------------------------------------------------------------
DHPS_NEIMA      ----------------------------------------------------------------------
DHPS_STAAW      ----------------------------------------------------------------------
DHPS1_MYCLE     ----------------------------------------------------------------------
DHPS_STRPY      ----------------------------------------------------------------------
DHPS_STAAN      ----------------------------------------------------------------------
DHPS_STAAM      ----------------------------------------------------------------------
DHPS_STAAS      ----------------------------------------------------------------------
DHPS_STAAC      ----------------------------------------------------------------------
DHPS_STAEQ      ----------------------------------------------------------------------
DHPS_STAHA      ----------------------------------------------------------------------
DHPS_STAES      ----------------------------------------------------------------------
DHPS_BACSU      ----------------------------------------------------------------------
FOL1_PNECA      FELQLIEKELGRVKVIDKGPRCIDLDIVFYGRKIINSESLIIPHPRVLERSFVLKPLLDI----------
FOL1_SCHPO      ----------------------------------------------------------------------
DHP2_SHIFL      ----------------------------------------------------------------------
DHP2_ECOLX      ----------------------------------------------------------------------
DHPS1_MYCTU     ----------------------------------------------------------------------
DHPS1_MYCBO     ----------------------------------------------------------------------
DHP1_PSEAE      ----------------------------------------------------------------------
DHP1_ECOLX      ----------------------------------------------------------------------
DHP1_CORGL      ----------------------------------------------------------------------
DHPS_CLOB8      ----------------------------------------------------------------------
DHP1_MYCFO      ----------------------------------------------------------------------
FOLKP_CHLPN     VTIKQIEKVVGRAEESPPSPRTIDVDILLYESFCCDHTEITIPLSNLLSRPFLIALIASLCP--------
DHPS2_MYCLE     ----------------------------------------------------------------------
DHPS_STRR6      ----------------------------------------------------------------------
FOLKP_CHLCV     SGVKQIERRLGRVNALPWSPRVLDIDILLYGDENHQQEDVKIPHERITERPFLLSLIASLCPTRI-----
DHPS_STRPN      ----------------------------------------------------------------------
FOL1_YEAST      KLCKKIEEELQRVKHFDNGPRTIDLDIVMFEDIIVNEPDLNIPHPRMLERTFVLEPLCELIPVHL-----
FOL1_DICDI      KFIKQIENDMGRVETFRNGPRVIDIDIIYYNGLIIKTDDLEIPHPLMWERDFVLLPLSDIAPNFI-----
FOLKP_CHLMU     KEIKMIENRLSRDSSLKWGPRSIDIDVLLYESYSCCSERCIIPHPRLLERPFLLSMMASLCP--------
HPPK_BACSU      ELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMYERLFVLAPLAEI----------
HPPK_ECOLI      NHTQRIELQQGRVRKARWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP--------
HPPK_HAEIN      DELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPN--
DHPS2_MYCTU     ----------------------------------------------------------------------
DHPS2_MYCBO     ----------------------------------------------------------------------
HPPK_METEA      EVCLSIEAALGRVRERRWGPRVIDIDVLAYEGAQVSDERLVLPHRFVRERAFVLVPLAEIAPDLVIGGE-
SULD_STRR6      ETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------
SULD_STRPN      ETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAP--------
FOLKE_LACLA     SFIHEVELSLNRERKIHWGPRTIDIDIIFYDDLEMQVENLVIPHKEAFNRLFVLKPIFELI---------
FOLKE_LACLM     DFIHEVELSLNRERKIHWGPRTIDIDIIFYGNSEIQEENLIVPHKEAFNRLFVLKPIFELL---------
FOLKP_CHLTR     EEIKMIESRFGQDASLKWGPRPIDIDVLFYEAFSYHSDKCTIPHPKVLERPFLLSMIASLCP--------
HPPK_STRP8      KETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLIPLLELQP--------
HPPK_STRP3      KETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLIPLLELQPNHKLLRDY
HPPK_SYNY3      QTLLAIEQKFGRIRLEKWGPRTLDLDLIFYGDRQLEQARLTIPHPQMQYRPFVLVPLAEIAPDWV-----
HPPK_STRPY      KETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLIPLLELQP--------
HPPK_STRP1      KETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLIPLLELQP--------
HPPK_STRP6      KETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLIPLLELQPNHKFLRDY
HPPK_PORGI      HITQAIERELGRTQKSNGGDRPIDIDILLHSVYKVQSPELELPHPQMWQRDFVRMPLSDVAP--------
HPPK_PORG3      HITQAIERELGRTQKSNGGDRPIDIDILLHSVYKVQSPELELPHPQMWQRDFVRMPLSDVAP--------
HPPK_HELPJ      ALVFYIERRFGRARDFKDAPRTLDIDIIAFNQVILRQNDLTLPHPKWSERDSVLVPL-------------
HPPK_HELPY      ALVFYIERRFGRQRDFKDAPRTLDIDIIAFNQVILRQNDLALPHPKWSERDSVLVPL-------------
HPPK_PSEAE      XXXXXIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFV-----------------
HPPK_AQUAE      XXXXXXXXXXXXXXXXXWGPREIDIDILLYKDEVIRTKLLKVPHPFLEKRDFFVYPLLEIEP--------
HPPK_MYCTU      RRAQEFERAAGRVRGQRWGPRNLDVDLIAYQTSATEALVLTLPHPLAHLRAFVLIPWIAVDP--------
HPPK_MYCBO      RRAQEFERAAGRVRGQRWGPRNLDVDLIAYQTSATEALVLTLPHPLAHLRAFVLIPWIAVDP--------
HPPK_CAMJE      KVLLYYEVKFKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPL-------------
HPPK_MYCLE      CRAQELERNAGRVRGQRWGARTLDVDLISYQTVITCESNLTLPHPRAHLRAFVLVPWL------------
HPPK_PSEPU      XXXXXIENDQGXVRKERWGPRTLDLDILLFSDQVLDQPRLKVPH--------------------------
SPEB_PHOLL      ----------------------------------------------------------------------
Y2857_SHESH     AYLH-IAGHYEEAEDLIVDTHGADIISPVWQLLRECYEIHGV-HPTLLERDFNIPPTSELL---------


                         .         .         +         .         .         .         .:490
query           PVSVDxxxxxxxxxx
DHPS_SHIFL      ---------------
DHPS_ECOLI      ---------------
DHPS_ECOL6      ---------------
DHPS_SYNY3      ---------------
DHPS_HAEIN      ---------------
DHPS_NEIMB      ---------------
DHPS_STRP6      ---------------
DHPS_STRP8      ---------------
DHPS_STRP3      ---------------
DHPS_STRP1      ---------------
DHPS_NEIMC      ---------------
DHPS_STAAU      ---------------
DHPS_STAAR      ---------------
DHPS_NEIMA      ---------------
DHPS_STAAW      ---------------
DHPS1_MYCLE     ---------------
DHPS_STRPY      ---------------
DHPS_STAAN      ---------------
DHPS_STAAM      ---------------
DHPS_STAAS      ---------------
DHPS_STAAC      ---------------
DHPS_STAEQ      ---------------
DHPS_STAHA      ---------------
DHPS_STAES      ---------------
DHPS_BACSU      ---------------
FOL1_PNECA      ---------------
FOL1_SCHPO      ---------------
DHP2_SHIFL      ---------------
DHP2_ECOLX      ---------------
DHPS1_MYCTU     ---------------
DHPS1_MYCBO     ---------------
DHP1_PSEAE      ---------------
DHP1_ECOLX      ---------------
DHP1_CORGL      ---------------
DHPS_CLOB8      ---------------
DHP1_MYCFO      ---------------
FOLKP_CHLPN     ---------------
DHPS2_MYCLE     ---------------
DHPS_STRR6      ---------------
FOLKP_CHLCV     ---------------
DHPS_STRPN      ---------------
FOL1_YEAST      ---------------
FOL1_DICDI      ---------------
FOLKP_CHLMU     ---------------
HPPK_BACSU      ---------------
HPPK_ECOLI      ---------------
HPPK_HAEIN      ---------------
DHPS2_MYCTU     ---------------
DHPS2_MYCBO     ---------------
HPPK_METEA      ---------------
SULD_STRR6      ---------------
SULD_STRPN      ---------------
FOLKE_LACLA     ---------------
FOLKE_LACLM     ---------------
FOLKP_CHLTR     ---------------
HPPK_STRP8      ---------------
HPPK_STRP3      LAALD----------
HPPK_SYNY3      ---------------
HPPK_STRPY      ---------------
HPPK_STRP1      ---------------
HPPK_STRP6      LAALD----------
HPPK_PORGI      ---------------
HPPK_PORG3      ---------------
HPPK_HELPJ      ---------------
HPPK_HELPY      ---------------
HPPK_PSEAE      ---------------
HPPK_AQUAE      ---------------
HPPK_MYCTU      ---------------
HPPK_MYCBO      ---------------
HPPK_CAMJE      ---------------
HPPK_MYCLE      ---------------
HPPK_PSEPU      ---------------
SPEB_PHOLL      ---------------
Y2857_SHESH     ---------------